Nesprin-1

Overview
NameNesprin-1
Smed IDSMED30015584
Length (bp)23779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nesprin-1 (SMED30015584) t-SNE clustered cells

Violin plots show distribution of expression levels for Nesprin-1 (SMED30015584) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nesprin-1 (SMED30015584) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nesprin-1 (SMED30015584) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015584

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015584SMESG000016745.1 SmedASXL_017228SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015584SMESG000016745.1 SmedASXL_000538SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015584SMESG000016745.1 SmedASXL_000551SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015584SMESG000016745.1 SmedASXL_003512SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015584SMESG000016745.1 SmedASXL_019914SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_23532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_23532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30015584SMESG000016745.1 dd_Smed_v4_23532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_17767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_17767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_34184_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_23535_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_23535_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_13561_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30015584SMESG000016745.1 dd_Smed_v4_16850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015584SMESG000016745.1 dd_Smed_v4_16850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_16850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015584SMESG000016745.1 dd_Smed_v4_16850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30015584SMESG000016745.1 dd_Smed_v4_16850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015584SMESG000016745.1 dd_Smed_v4_16850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015584SMESG000016745.1 dd_Smed_v6_13561_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30015584SMESG000016745.1 dd_Smed_v6_16850_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30015584SMESG000016745.1 dd_Smed_v6_17767_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015584SMESG000016747.1 SMESG000016745.1 dd_Smed_v6_5365_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30015584SMESG000016745.1 dd_Smed_v4_23532_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30015584SMESG000016745.1 dd_Smed_v4_17767_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30015584SMESG000016745.1 dd_Smed_v4_17767_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30015584SMESG000016745.1 dd_Smed_v4_34184_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30015584SMESG000016745.1 dd_Smed_v4_23535_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 204.527 bits (519), Expect = 7.480e-54
Identity = 122/266 (45.86%), Postives = 173/266 (65.04%), Query Frame = 1
Query:  142 IGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSASDKG-----------VKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            I N++++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  MK++H ++N+  AL +L  RKIKLVNIN +DI +G+P IVLGL+W IIL+FQI+E      +L   S  + +V    ++ + S               K  LL W+Q    ++  + + DFGKSW SG+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:   14 IANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 279          
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 202.216 bits (513), Expect = 3.316e-52
Identity = 122/266 (45.86%), Postives = 173/266 (65.04%), Query Frame = 1
Query:  142 IGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            I N++++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  MK++H ++N+  AL +L  RKIKLVNIN +DI +G+P IVLGL+W IIL+FQI+E      +L   S  + +V    ++ + S               K  LL W+Q    ++  + + DFGKSW SG+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:   14 IANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 279          
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 204.142 bits (518), Expect = 4.926e-51
Identity = 121/266 (45.49%), Postives = 172/266 (64.66%), Query Frame = 1
Query:  142 IGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE--------HELDKKSQQSGAVRQANANNSASDKGVKLK--------LLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            I N++++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  MK++H ++N+  AL +L  RKIKLVNIN +DI +G+P IVLGL+W IIL+FQI+E          L   +    ++  +   +  S + V  K        LL W+Q    ++  + + DFGKSW SG+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:   14 IANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 279          
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 203.756 bits (517), Expect = 4.979e-51
Identity = 122/266 (45.86%), Postives = 173/266 (65.04%), Query Frame = 1
Query:  142 IGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            I N++++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  MK++H ++N+  AL +L  RKIKLVNIN +DI +G+P IVLGL+W IIL+FQI+E      +L   S  + +V    ++ + S               K  LL W+Q    ++  + + DFGKSW SG+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:   14 IANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 279          
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 190.274 bits (482), Expect = 2.865e-50
Identity = 119/269 (44.24%), Postives = 169/269 (62.83%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERK-------IKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE--------HELDKKSQQSGAVRQANANNSASDKGVKLK--------LLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            +++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  MK++H ++N+  AL +L  RK       IKLVNIN +DI +G+P IVLGL+W IIL+FQI+E          L   +    ++  +   +  S + V  K        LL W+Q    ++  + + DFGKSW SG+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:    1 MQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 269          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 156.762 bits (395), Expect = 7.133e-37
Identity = 98/267 (36.70%), Postives = 143/267 (53.56%), Query Frame = 1
Query:  160 KYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXX----XXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKG-----VKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKN---LDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPR 924
            KY DE+D +QKKTFTKW+NK+L K D    + DLFVD+RDG  LI LLE L+G  ++KE G    + H + NV+  L++L ++ IKLVNI P DIVEG   + L     +I    +    Q   L+    +  + +    N+  S  G      +  LL W + +      + + +F  SW  G+AF+A++  +  + +D   +   D   N   L++AF  A+R  G+ +LLD+EDV    PDEKSI+TYVS         PE  R
Sbjct:   32 KYNDERDNVQKKTFTKWVNKHLSKTDHK--IDDLFVDLRDGYALIALLEALTGERIQKENG--YTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKI-SSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSR 293          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 156.762 bits (395), Expect = 7.139e-37
Identity = 98/267 (36.70%), Postives = 143/267 (53.56%), Query Frame = 1
Query:  160 KYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXX----XXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKG-----VKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKN---LDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPR 924
            KY DE+D +QKKTFTKW+NK+L K D    + DLFVD+RDG  LI LLE L+G  ++KE G    + H + NV+  L++L ++ IKLVNI P DIVEG   + L     +I    +    Q   L+    +  + +    N+  S  G      +  LL W + +      + + +F  SW  G+AF+A++  +  + +D   +   D   N   L++AF  A+R  G+ +LLD+EDV    PDEKSI+TYVS         PE  R
Sbjct:   32 KYNDERDNVQKKTFTKWVNKHLSKTDHK--IDDLFVDLRDGYALIALLEALTGERIQKENG--YTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKI-SSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSR 293          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 156.762 bits (395), Expect = 7.349e-37
Identity = 102/267 (38.20%), Postives = 146/267 (54.68%), Query Frame = 1
Query:  160 KYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXX----XXXXXXXEHELDKKSQQSGAVRQANANNSASDKG-----VKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKN---LDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPR 924
            KY DE+D +QKKTFTKW+NK+L K D    + DLFVD+RDG  LI LLE L+G  ++KE G    + H + NV+  L++L ++ IKLVNI P DIVEG   + LGLIW I     +    Q   L+    +  + +    N+  S  G      +  LL W + +      + + +F  SW  G+AF+A++  +  + +D   +   D   N   L++AF  A+R  G+ +LLD+EDV    PDEKSI+TYVS         PE  R
Sbjct:   32 KYNDERDNVQKKTFTKWVNKHLSKTDHK--IDDLFVDLRDGYALIALLEALTGERIQKENG--YTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKI-SSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSR 293          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 156.762 bits (395), Expect = 7.504e-37
Identity = 98/267 (36.70%), Postives = 143/267 (53.56%), Query Frame = 1
Query:  160 KYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXX----XXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKG-----VKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKN---LDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPR 924
            KY DE+D +QKKTFTKW+NK+L K D    + DLFVD+RDG  LI LLE L+G  ++KE G    + H + NV+  L++L ++ IKLVNI P DIVEG   + L     +I    +    Q   L+    +  + +    N+  S  G      +  LL W + +      + + +F  SW  G+AF+A++  +  + +D   +   D   N   L++AF  A+R  G+ +LLD+EDV    PDEKSI+TYVS         PE  R
Sbjct:   32 KYNDERDNVQKKTFTKWVNKHLSKTDHK--IDDLFVDLRDGYALIALLEALTGERIQKENG--YTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKI-SSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSR 293          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 156.377 bits (394), Expect = 8.685e-37
Identity = 98/267 (36.70%), Postives = 143/267 (53.56%), Query Frame = 1
Query:  160 KYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXX----XXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKG-----VKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKN---LDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPR 924
            KY DE+D +QKKTFTKW+NK+L K D    + DLFVD+RDG  LI LLE L+G  ++KE G    + H + NV+  L++L ++ IKLVNI P DIVEG   + L     +I    +    Q   L+    +  + +    N+  S  G      +  LL W + +      + + +F  SW  G+AF+A++  +  + +D   +   D   N   L++AF  A+R  G+ +LLD+EDV    PDEKSI+TYVS         PE  R
Sbjct:   32 KYNDERDNVQKKTFTKWVNKHLSKTDHK--IDDLFVDLRDGYALIALLEALTGERIQKENG--YTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKI-SSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSR 293          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332405)

HSP 1 Score: 239.965 bits (611), Expect = 7.954e-62
Identity = 223/806 (27.67%), Postives = 400/806 (49.63%), Query Frame = 1
Query:  139 QIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASD------------KGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVN---DKIKRFIINVKESRIEKLKQIENFNDVF--------------KLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLL-HK---IASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIER--------------EIKYIETSLRTYIEEWHKMEELYNETVDWM-------NSTDDFSIS-PQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHEN--KSLHVDNL---RKEYKIKVENIKKWLEKSEA-LESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKL 2373
            Q  + I++ ++EQ+ +QKKTFT WIN YL K    L + DL  D+RDG  LI LLEVLSG  +  E+G  +++ H+LSN   AL +L+ ++IKLVNINP+D+V+G+P +VLGLIW IIL+FQI+E+  + +    G     ++ +S  +            +G +  LL W+ N +P++  + + DFG SW  G+AF ALI+    NLV++  + +   ++ L++AFD+AE  LGIAKLLD+EDV   KPDEKSIMTYV+QFL              K   P+ A  ++  V    D+++RF++  K +  E +  + +F   F                 + LK  +E    + Q S      +++ ++  +  ++   WLLD  +   +  + KWL  +E++L    +N  D+   ++ E    ++ +++E++  F + P         KR  +      ++ +    ++ERR+Q+V  +    R +L  L HK   IA L + E     K++ W  ++        +L  +++ ++         +   D+++++     +K      +  I+DI+R              E+K  + SL   +  W    +L     +W+       N ++D  +   Q+    K K   +  +  +L     +   + L ++   ++  F R   N  + +H  ++   R+EYK  +E + +WL  +E+ L+   +  +++ V EY Q L +     ++ +E FK +S+  Q + +  S++E ++M+  LK +K  L+ +   R +L  KL
Sbjct:  616 QYDSHIKEKREEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLASKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLH-------------KYPEPKGASRDQSHVQQEADELRRFLVE-KTTEYEPMVMMSSFPRDFGEYLLARSEVDAHLAAYNRLKQLIESQSGFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGTVGKWLAEAEKLL---MDN--DIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPV----AQQIPLEQLRNMERRLQEVGPKAAERRIRLKFLEHKCCLIAFLNLVEN----KMRGWTGKYGHEEKVAQQLEQYKNFVSRNKIFQEFQKAFVDMQQVVE---EYKRDGNVPRKEINDIDRFMYETEERWKRVSMELKCCQNSLEEVVNCWRSWNQLAPTCEEWLQLAEQKVNQSEDERLDFFQDIPVWKDKFDALASSANYLIASCEEPIAQQLRQRHGALSERFERLFANTKQYMHAGDIIRSRQEYKSGIEQLSRWLRGAESVLDQRQVLGNSEQVKEYGQQLQQLASEIDDNEELFKTISRNFQSLIQDLSRDEVDKMMKLLKQEKESLVRI---RAQLPAKL 1388          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303385)

HSP 1 Score: 239.965 bits (611), Expect = 8.227e-62
Identity = 223/806 (27.67%), Postives = 400/806 (49.63%), Query Frame = 1
Query:  139 QIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASD------------KGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVN---DKIKRFIINVKESRIEKLKQIENFNDVF--------------KLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLL-HK---IASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIER--------------EIKYIETSLRTYIEEWHKMEELYNETVDWM-------NSTDDFSIS-PQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHEN--KSLHVDNL---RKEYKIKVENIKKWLEKSEA-LESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKL 2373
            Q  + I++ ++EQ+ +QKKTFT WIN YL K    L + DL  D+RDG  LI LLEVLSG  +  E+G  +++ H+LSN   AL +L+ ++IKLVNINP+D+V+G+P +VLGLIW IIL+FQI+E+  + +    G     ++ +S  +            +G +  LL W+ N +P++  + + DFG SW  G+AF ALI+    NLV++  + +   ++ L++AFD+AE  LGIAKLLD+EDV   KPDEKSIMTYV+QFL              K   P+ A  ++  V    D+++RF++  K +  E +  + +F   F                 + LK  +E    + Q S      +++ ++  +  ++   WLLD  +   +  + KWL  +E++L    +N  D+   ++ E    ++ +++E++  F + P         KR  +      ++ +    ++ERR+Q+V  +    R +L  L HK   IA L + E     K++ W  ++        +L  +++ ++         +   D+++++     +K      +  I+DI+R              E+K  + SL   +  W    +L     +W+       N ++D  +   Q+    K K   +  +  +L     +   + L ++   ++  F R   N  + +H  ++   R+EYK  +E + +WL  +E+ L+   +  +++ V EY Q L +     ++ +E FK +S+  Q + +  S++E ++M+  LK +K  L+ +   R +L  KL
Sbjct:  616 QYDSHIKEKREEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLASKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLH-------------KYPEPKGASRDQSHVQQEADELRRFLVE-KTTEYEPMVMMSSFPRDFGEYLLARSEVDAHLAAYNRLKQLIESQSGFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGTVGKWLAEAEKLL---MDN--DIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPV----AQQIPLEQLRNMERRLQEVGPKAAERRIRLKFLEHKCCLIAFLNLVEN----KMRGWTGKYGHEEKVAQQLEQYKNFVSRNKIFQEFQKAFVDMQQVVE---EYKRDGNVPRKEINDIDRFMYETEERWKRVSMELKCCQNSLEEVVNCWRSWNQLAPTCEEWLQLAEQKVNQSEDERLDFFQDIPVWKDKFDALASSANYLIASCEEPIAQQLRQRHGALSERFERLFANTKQYMHAGDIIRSRQEYKSGIEQLSRWLRGAESVLDQRQVLGNSEQVKEYGQQLQQLASEIDDNEELFKTISRNFQSLIQDLSRDEVDKMMKLLKQEKESLVRI---RAQLPAKL 1388          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303383)

HSP 1 Score: 239.58 bits (610), Expect = 1.113e-61
Identity = 222/806 (27.54%), Postives = 399/806 (49.50%), Query Frame = 1
Query:  139 QIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASD------------KGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVN---DKIKRFIINVKESRIEKLKQIENFNDVF--------------KLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLL-HK---IASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIER--------------EIKYIETSLRTYIEEWHKMEELYNETVDWM-------NSTDDFSIS-PQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHEN--KSLHVDNL---RKEYKIKVENIKKWLEKSEA-LESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKL 2373
            Q  + I++ ++EQ+ +QKKTFT WIN YL K    L + DL  D+RDG  LI LLEVLSG  +  E+G  +++ H+LSN   AL +L+ ++IKLVNINP+D+V+G+P +VLGLIW IIL+FQI+E+  + +    G     ++ +S  +            +G +  LL W+ N +P++  + + DFG SW  G+AF ALI+    NLV++  + +   ++ L++AFD+AE  LGIAKLLD+EDV   KPDEKSIMTYV+QFL              K   P+ A  ++  V    D+++RF++  K +  E +  + +F   F                 + LK  +E    + Q S      +++ ++  +  ++   WLLD  +   +  + KWL  +E++L  +     D+   ++ E    ++ +++E++  F + P         KR  +      ++ +    ++ERR+Q+V  +    R +L  L HK   IA L + E     K++ W  ++        +L  +++ ++         +   D+++++     +K      +  I+DI+R              E+K  + SL   +  W    +L     +W+       N ++D  +   Q+    K K   +  +  +L     +   + L ++   ++  F R   N  + +H  ++   R+EYK  +E + +WL  +E+ L+   +  +++ V EY Q L +     ++ +E FK +S+  Q + +  S++E ++M+  LK +K  L+ +   R +L  KL
Sbjct:  616 QYDSHIKEKREEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLASKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLH-------------KYPEPKGASRDQSHVQQEADELRRFLVE-KTTEYEPMVMMSSFPRDFGEYLLARSEVDAHLAAYNRLKQLIESQSGFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGTVGKWLAEAEKLLMDN-----DIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPV----AQQIPLEQLRNMERRLQEVGPKAAERRIRLKFLEHKCCLIAFLNLVEN----KMRGWTGKYGHEEKVAQQLEQYKNFVSRNKIFQEFQKAFVDMQQVVE---EYKRDGNVPRKEINDIDRFMYETEERWKRVSMELKCCQNSLEEVVNCWRSWNQLAPTCEEWLQLAEQKVNQSEDERLDFFQDIPVWKDKFDALASSANYLIASCEEPIAQQLRQRHGALSERFERLFANTKQYMHAGDIIRSRQEYKSGIEQLSRWLRGAESVLDQRQVLGNSEQVKEYGQQLQQLASEIDDNEELFKTISRNFQSLIQDLSRDEVDKMMKLLKQEKESLVRI---RAQLPAKL 1388          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332404)

HSP 1 Score: 238.424 bits (607), Expect = 2.410e-61
Identity = 222/801 (27.72%), Postives = 397/801 (49.56%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDK------------GVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVN---DKIKRFIINVKESRIEKLKQIENFNDVF--------------KLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLL-HK---IASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIER--------------EIKYIETSLRTYIEEWHKMEELYNETVDWM-------NSTDDFSIS-PQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHEN--KSLHVDNL---RKEYKIKVENIKKWLEKSEA-LESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKL 2373
            I + ++EQ+ +QKKTFT WIN YL K    L + DL  D+RDG  LI LLEVLSG  +  E+G  +++ H+LSN   AL +L+ ++IKLVNINP+D+V+G+P +VLGLIW IIL+FQI+E+  + +    G     ++ +S  ++            G +  LL W+ N +P++  + + DFG SW  G+AF ALI+    NLV++  + +   ++ L++AFD+AE  LGIAKLLD+EDV   KPDEKSIMTYV+QFL              K   P+ A  ++  V    D+++RF++  K +  E +  + +F   F                 + LK  +E    + Q S      +++ ++  +  ++   WLLD  +   +  + KWL  +E++L    +N  D+   ++ E    ++ +++E++  F + P         KR  +      ++ +    ++ERR+Q+V  +    R +L  L HK   IA L + E     K++ W  ++        +L  +++ ++         +   D+++++     +K      +  I+DI+R              E+K  + SL   +  W    +L     +W+       N ++D  +   Q+    K K   +  +  +L     +   + L ++   ++  F R   N  + +H  ++   R+EYK  +E + +WL  +E+ L+   +  +++ V EY Q L +     ++ +E FK +S+  Q + +  S++E ++M+  LK +K  L+ +   R +L  KL
Sbjct:  262 ILQLQEEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLASKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLH-------------KYPEPKGASRDQSHVQQEADELRRFLVE-KTTEYEPMVMMSSFPRDFGEYLLARSEVDAHLAAYNRLKQLIESQSGFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGTVGKWLAEAEKLL---MDN--DIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPV----AQQIPLEQLRNMERRLQEVGPKAAERRIRLKFLEHKCCLIAFLNLVEN----KMRGWTGKYGHEEKVAQQLEQYKNFVSRNKIFQEFQKAFVDMQQVVE---EYKRDGNVPRKEINDIDRFMYETEERWKRVSMELKCCQNSLEEVVNCWRSWNQLAPTCEEWLQLAEQKVNQSEDERLDFFQDIPVWKDKFDALASSANYLIASCEEPIAQQLRQRHGALSERFERLFANTKQYMHAGDIIRSRQEYKSGIEQLSRWLRGAESVLDQRQVLGNSEQVKEYGQQLQQLASEIDDNEELFKTISRNFQSLIQDLSRDEVDKMMKLLKQEKESLVRI---RAQLPAKL 1029          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303388)

HSP 1 Score: 238.424 bits (607), Expect = 2.493e-61
Identity = 222/801 (27.72%), Postives = 397/801 (49.56%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDK------------GVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVN---DKIKRFIINVKESRIEKLKQIENFNDVF--------------KLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLL-HK---IASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIER--------------EIKYIETSLRTYIEEWHKMEELYNETVDWM-------NSTDDFSIS-PQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHEN--KSLHVDNL---RKEYKIKVENIKKWLEKSEA-LESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKL 2373
            I + ++EQ+ +QKKTFT WIN YL K    L + DL  D+RDG  LI LLEVLSG  +  E+G  +++ H+LSN   AL +L+ ++IKLVNINP+D+V+G+P +VLGLIW IIL+FQI+E+  + +    G     ++ +S  ++            G +  LL W+ N +P++  + + DFG SW  G+AF ALI+    NLV++  + +   ++ L++AFD+AE  LGIAKLLD+EDV   KPDEKSIMTYV+QFL              K   P+ A  ++  V    D+++RF++  K +  E +  + +F   F                 + LK  +E    + Q S      +++ ++  +  ++   WLLD  +   +  + KWL  +E++L    +N  D+   ++ E    ++ +++E++  F + P         KR  +      ++ +    ++ERR+Q+V  +    R +L  L HK   IA L + E     K++ W  ++        +L  +++ ++         +   D+++++     +K      +  I+DI+R              E+K  + SL   +  W    +L     +W+       N ++D  +   Q+    K K   +  +  +L     +   + L ++   ++  F R   N  + +H  ++   R+EYK  +E + +WL  +E+ L+   +  +++ V EY Q L +     ++ +E FK +S+  Q + +  S++E ++M+  LK +K  L+ +   R +L  KL
Sbjct:  262 ILQLQEEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLASKRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLH-------------KYPEPKGASRDQSHVQQEADELRRFLVE-KTTEYEPMVMMSSFPRDFGEYLLARSEVDAHLAAYNRLKQLIESQSGFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGTVGKWLAEAEKLL---MDN--DIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPV----AQQIPLEQLRNMERRLQEVGPKAAERRIRLKFLEHKCCLIAFLNLVEN----KMRGWTGKYGHEEKVAQQLEQYKNFVSRNKIFQEFQKAFVDMQQVVE---EYKRDGNVPRKEINDIDRFMYETEERWKRVSMELKCCQNSLEEVVNCWRSWNQLAPTCEEWLQLAEQKVNQSEDERLDFFQDIPVWKDKFDALASSANYLIASCEEPIAQQLRQRHGALSERFERLFANTKQYMHAGDIIRSRQEYKSGIEQLSRWLRGAESVLDQRQVLGNSEQVKEYGQQLQQLASEIDDNEELFKTISRNFQSLIQDLSRDEVDKMMKLLKQEKESLVRI---RAQLPAKL 1029          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 186.037 bits (471), Expect = 1.659e-45
Identity = 121/266 (45.49%), Postives = 174/266 (65.41%), Query Frame = 1
Query:  166 KDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERK-------IKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDK----------------GVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLE 894
            +DEQ+ +QK+TFTKWIN +L K +  L+V DLF D++DG+ML+ LLEVLSG  +  E+G  ++++H+++NV  AL +L  R+       IKLVNIN +D+V+G+P IVLGLIW IIL+FQI+E      + Q  +   ++  +S S +                G K  LL W+QN   +   + + DFG SW +G+AFHA+I    P+LV+M+ V +   ++NL+ AF +AER LGI +LLD EDV  +KPDEKSIMTYV+QFL+
Sbjct:   35 RDEQEAVQKRTFTKWINSHLAKRNPPLVVSDLFEDVKDGVMLLALLEVLSGHKLPCEQGRKLRRIHWVANVGRALKFLEGRRVRQSIPTIKLVNINTTDVVDGRPSIVLGLIWTIILYFQIEELTSHLPALQPQSSSNSSVESSNSTETSSPPVKRKPRLSFQGGAKRALLKWVQNTATKRMGLDVKDFGPSWRTGVAFHAVIFALRPHLVNMERVWRRGNRENLEEAFSLAERELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLK 300          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: pleca (plectin a [Source:ZFIN;Acc:ZDB-GENE-030131-8984])

HSP 1 Score: 175.252 bits (443), Expect = 3.107e-42
Identity = 112/256 (43.75%), Postives = 151/256 (58.98%), Query Frame = 1
Query:  148 NIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPE 915
            N+  KYKDE+D +QKKTFTKW+NK+L K   +  + DL+ D+RDG  LI LLEVLSG T+ +E+G    + H L NV+IAL++L  R++KLVNI   DI +G P + LGLIW IIL FQ               +     N  + D   K KLL W Q ++     +   +F  SW  G  F+A+I    PNL+D+  V +    +NL+ AF IAER LG+ +LLD EDV    PDEKSI+TYVS   ++    P+
Sbjct:   24 NVREKYKDERDRVQKKTFTKWVNKHLVKAQRH--ITDLYEDLRDGHNLISLLEVLSGETLPREKG--RMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQ---------------ISDIQVNGQSDDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHKHRPNLIDINKVYRQTNLENLEQAFSIAERDLGVTRLLDPEDVDVPHPDEKSIITYVSSMYDVMPRVPD 260          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 172.555 bits (436), Expect = 1.751e-41
Identity = 115/271 (42.44%), Postives = 155/271 (57.20%), Query Frame = 1
Query:  166 KDEQDFIQKKTFTKWINKYLKKH---DSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNE 969
            KDE+D +QKKTFTKW+NK+L KH   ++   V DL+ D+RDG  LI LLEVLSG T+ +ERG    + H L NV+IAL++L  R++KLVNI   DI +G P + LGLIW IIL FQ               +     N  + D   K KLL W Q ++   + +   +F  SW  G  F+A+I    P L+DM  V +    +NL+ AF +AE+ LG+ +LLD EDV    PDEKSI+TYVS   +     P  P       + + AK+NE
Sbjct:   40 KDERDRVQKKTFTKWVNKHLIKHWRSETQRHVNDLYEDLRDGHNLISLLEVLSGETLPRERG--RMRFHKLQNVQIALDFLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQ---------------ISDIQVNGQSDDMSAKEKLLFWSQRMVDGYHGIRCDNFTTSWRDGKLFNAIIHKHEPRLIDMPKVYRQTNMENLEQAFTVAEKELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAM---PRVP------DVQDGAKTNE 284          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 171.4 bits (433), Expect = 4.947e-41
Identity = 109/246 (44.31%), Postives = 146/246 (59.35%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKH---DSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVS 882
            I +  DE+D +QKKTFTKW+NK+L KH   ++   V DL+ D+RDG  LI LLEVLSG T+ +ERG    + H L NV+IAL++L  R++KLVNI   DI +G P + LGLIW IIL FQ               +     N  + D   K KLL W Q ++   + +   +F  SW  G  F+A+I    P L+DM  V +    +NL+ AF +AE+ LG+ +LLD EDV    PDEKSI+TYVS
Sbjct:   60 ILRIADERDRVQKKTFTKWVNKHLIKHWRSETQRHVNDLYEDLRDGHNLISLLEVLSGETLPRERG--RMRFHKLQNVQIALDFLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQ---------------ISDIQVNGQSDDMSAKEKLLFWSQRMVDGYHGIRCDNFTTSWRDGKLFNAIIHKHEPRLIDMPKVYRQTNMENLEQAFTVAEKELGVTRLLDPEDVDVPHPDEKSIITYVS 288          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 169.474 bits (428), Expect = 1.568e-40
Identity = 114/268 (42.54%), Postives = 153/268 (57.09%), Query Frame = 1
Query:  166 KDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNE 969
            KDE+D +QKKTFTKW+NK+L K   +  V DL+ D+RDG  LI LLEVLSG T+ +ERG    + H L NV+IAL++L  R++KLVNI   DI +G P + LGLIW IIL FQ               +     N  + D   K KLL W Q ++   + +   +F  SW  G  F+A+I    P L+DM  V +    +NL+ AF +AE+ LG+ +LLD EDV    PDEKSI+TYVS   +     P  P       + + AK+NE
Sbjct:   40 KDERDRVQKKTFTKWVNKHLIKTQRH--VNDLYEDLRDGHNLISLLEVLSGETLPRERG--RMRFHKLQNVQIALDFLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQ---------------ISDIQVNGQSDDMSAKEKLLFWSQRMVDGYHGIRCDNFTTSWRDGKLFNAIIHKHEPRLIDMPKVYRQTNMENLEQAFTVAEKELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAM---PRVP------DVQDGAKTNE 279          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 189.504 bits (480), Expect = 2.416e-46
Identity = 122/301 (40.53%), Postives = 176/301 (58.47%), Query Frame = 1
Query:  163 YKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERK--------IKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE--------HELDKKSQQSGAVRQANANNSASDKGV--------KLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKI--VLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDK 987
            + DEQ+ +QK+TFTKWIN +L K    +++ +LF DI+DG  LI LLEVLSG  +  E+G  +K++H+++N+  AL +L  R+        IKLVNIN +DI +G+P IVLGLIW IIL+FQI+E        H +   +    +V  + A +    + +        K  LL W+Q    +   + + DFG SW +GIAFH++I    P+LVDM I  + +   ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTY++QFL+                 P+P  ++  G  DK
Sbjct:   29 FSDEQEAVQKRTFTKWINSHLAKRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEGRRVMTFLIFQIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLK---------------HYPDPHHTSLDGQEDK 314          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 171.4 bits (433), Expect = 6.904e-41
Identity = 106/250 (42.40%), Postives = 157/250 (62.80%), Query Frame = 1
Query:  196 TFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE--------HELDKKSQQSGAVRQANANNSASDKGV--------KLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKI--VLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            T  +++  +L++H   +++ +LF DI+DG  LI LLEVLSG  +  E+G  +K++H+++N+  AL +L  R+IKLVNIN +DI +G+P IVLGLIW IIL+FQI+E        H +   +    +V  + A +    + +        K  LL W+Q    +   + + DFG SW +GIAFH++I    P+LVDM I  + +   ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTY++QFL
Sbjct:   29 TLNQYVISFLQRHPP-MVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFL 277          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 170.244 bits (430), Expect = 1.774e-40
Identity = 106/250 (42.40%), Postives = 157/250 (62.80%), Query Frame = 1
Query:  196 TFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE--------HELDKKSQQSGAVRQANANNSASDKGV--------KLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKI--VLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            T  +++  +L++H   +++ +LF DI+DG  LI LLEVLSG  +  E+G  +K++H+++N+  AL +L  R+IKLVNIN +DI +G+P IVLGLIW IIL+FQI+E        H +   +    +V  + A +    + +        K  LL W+Q    +   + + DFG SW +GIAFH++I    P+LVDM I  + +   ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTY++QFL
Sbjct:    8 TLNQYVISFLQRHPP-MVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFL 256          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 169.859 bits (429), Expect = 2.193e-40
Identity = 106/250 (42.40%), Postives = 157/250 (62.80%), Query Frame = 1
Query:  196 TFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE--------HELDKKSQQSGAVRQANANNSASDKGV--------KLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKI--VLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            T  +++  +L++H   +++ +LF DI+DG  LI LLEVLSG  +  E+G  +K++H+++N+  AL +L  R+IKLVNIN +DI +G+P IVLGLIW IIL+FQI+E        H +   +    +V  + A +    + +        K  LL W+Q    +   + + DFG SW +GIAFH++I    P+LVDM I  + +   ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTY++QFL
Sbjct:    8 TLNQYVISFLQRHPP-MVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFL 256          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 169.474 bits (428), Expect = 2.339e-40
Identity = 106/250 (42.40%), Postives = 157/250 (62.80%), Query Frame = 1
Query:  196 TFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE--------HELDKKSQQSGAVRQANANNSASDKGV--------KLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKI--VLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            T  +++  +L++H   +++ +LF DI+DG  LI LLEVLSG  +  E+G  +K++H+++N+  AL +L  R+IKLVNIN +DI +G+P IVLGLIW IIL+FQI+E        H +   +    +V  + A +    + +        K  LL W+Q    +   + + DFG SW +GIAFH++I    P+LVDM I  + +   ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTY++QFL
Sbjct:    8 TLNQYVISFLQRHPP-MVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFL 256          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 202.216 bits (513), Expect = 2.497e-53
Identity = 121/266 (45.49%), Postives = 174/266 (65.41%), Query Frame = 1
Query:  142 IGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            I N++++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  +K++H ++N+  AL +L  RKIKLVNIN +DI +G+P IVLGL+W IIL+FQI+E      +L   S  + +V    +  +AS               K  LL W+Q+   ++  + + DFGKSW +G+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:   14 ITNVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEGRKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 279          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 196.438 bits (498), Expect = 5.468e-49
Identity = 121/273 (44.32%), Postives = 174/273 (63.74%), Query Frame = 1
Query:  142 IGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERK-------IKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            I N++++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  +K++H ++N+  AL +L  RK       IKLVNIN +DI +G+P IVLGL+W IIL+FQI+E      +L   S  + +V    +  +AS               K  LL W+Q+   ++  + + DFGKSW +G+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:   14 ITNVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEGRKSMYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 286          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 197.593 bits (501), Expect = 5.963e-49
Identity = 121/273 (44.32%), Postives = 174/273 (63.74%), Query Frame = 1
Query:  142 IGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERK-------IKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            I N++++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  +K++H ++N+  AL +L  RK       IKLVNIN +DI +G+P IVLGL+W IIL+FQI+E      +L   S  + +V    +  +AS               K  LL W+Q+   ++  + + DFGKSW +G+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:   14 ITNVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEGRKSMYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 286          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Macf1 (microtubule-actin crosslinking factor 1 [Source:MGI Symbol;Acc:MGI:108559])

HSP 1 Score: 165.236 bits (417), Expect = 1.555e-43
Identity = 113/254 (44.49%), Postives = 155/254 (61.02%), Query Frame = 1
Query:  166 KDEQDFIQKKTFTKWINKYL---KKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPES 918
            +DE+D +QKKTFTKW+NK+L   +KH     + DL+ D+RDG  LI LLEVLSG  + +E+G    + H L NV+IAL++L +R++KLVNI   DI +G P + LGLIW IIL FQI +  +   S +SG            D   K KLL W Q +      +  T+F   WS G  F+ALI  + P+LVDM+ V     ++NL+ AF++AER LG+ +LLD+EDV    PDEKS++TYVS   +     PE 
Sbjct:   17 RDERDRVQKKTFTKWVNKHLMKVRKH-----INDLYEDLRDGHNLISLLEVLSGIKLPREKG--RMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYI---SGESG------------DMSAKEKLLLWTQKVTAGYTGVKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQVQSNRENLEQAFEVAER-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEG 247          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Plec (plectin [Source:MGI Symbol;Acc:MGI:1277961])

HSP 1 Score: 170.244 bits (430), Expect = 2.557e-42
Identity = 115/271 (42.44%), Postives = 160/271 (59.04%), Query Frame = 1
Query:  118 TVVGNIMQIGNII------RKYKDEQD---FIQKKTFTKWINKYLKKH---DSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLE 894
             VVG+++ +  +       R+ KDEQD    +QKKTFTKW+NK+L KH   ++   + DL+ D+RDG  LI LLEVLSG ++ +E+G    + H L NV+IAL+YL  R++KLVNI   DI +G P + LGLIW IIL FQI + ++  +S+               D   K KLL W Q ++     +   +F  SW  G  F+A+I    P L+DM  V +    +NLD AF +AER LG+ +LLD EDV   +PDEKSI+TYVS   +
Sbjct:   12 VVVGHVVTLAAVWHWRKGHRQAKDEQDERDRVQKKTFTKWVNKHLIKHWRAEAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKG--RMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSE---------------DMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYD 265          
BLAST of Nesprin-1 vs. UniProt/SwissProt
Match: sp|Q6ZWR6|SYNE1_MOUSE (Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 3.832e-50
Identity = 121/266 (45.49%), Postives = 174/266 (65.41%), Query Frame = 1
Query:  142 IGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            I N++++ +DEQ+ +QK+TFTKWIN +L K    ++V DLF D++DG+ L+ LLEVLSG  +  E+G  +K++H ++N+  AL +L  RKIKLVNIN +DI +G+P IVLGL+W IIL+FQI+E      +L   S  + +V    +  +AS               K  LL W+Q+   ++  + + DFGKSW +G+AFH++I    P LVD++ V     ++NL+ AF IAE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:   14 ITNVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEGRKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 279          
BLAST of Nesprin-1 vs. UniProt/SwissProt
Match: sp|Q6ZWQ0|SYNE2_MOUSE (Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 3.671e-39
Identity = 116/327 (35.47%), Postives = 165/327 (50.46%), Query Frame = 1
Query:  115 PTVVG-NIMQIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXX------XXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDK-------------GVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKL 1035
            PT  G   + I ++    + EQ+  QKKTFT WIN  L KH    +V DLF DI+ G +L+ LLEVLSG  + +++G N  +     N++ AL +L  R IKL+NI+ +DIVEG P I       + L + I    Q    + ++ S +  +V  ++  +S   K               K  LL W Q    R  ++ +TDF  SW +G+AF A+I    P+L+DM  +     + NL  AF IAE  L I KLL+ EDV    PDEKSIMTYV+QFL            K     P P  S +  V D +    + ++E R +K+
Sbjct:    8 PTEDGEGFLGIDDLHFSLQAEQEDTQKKTFTCWINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRI--NIEHALTFLKNRSIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVSVAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKSIMTYVAQFL------------KYSKDAPGPGDSTQAKVRDAL--VWLTLQEKRFQKM 318          
BLAST of Nesprin-1 vs. UniProt/SwissProt
Match: sp|D3ZHV2|MACF1_RAT (Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 6.641e-39
Identity = 109/256 (42.58%), Postives = 151/256 (58.98%), Query Frame = 1
Query:  160 KYKDEQDFIQKKTFTKWINKYL---KKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPES 918
            +  DE+D +QKKTFTKW+NK+L   +KH     + DL+ D+RDG  LI LLEVLSG  + +E+G    + H L NV+IAL++L +R++KLVNI   DI +G P + LGLIW IIL FQ               +     +  + D   K KLL W Q +      +  T+F   WS G  F+ALI  + P+LVDM+ V     ++NL+ AF++AER LG+ +LLD+EDV    PDEKS++TYVS   +     PE 
Sbjct:   71 RVADERDRVQKKTFTKWVNKHLMKVRKH-----INDLYEDLRDGHNLISLLEVLSGIKLPREKG--RMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQ---------------ISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAER-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEG 303          
BLAST of Nesprin-1 vs. UniProt/SwissProt
Match: sp|Q9QXS1|PLEC_MOUSE (Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3)

HSP 1 Score: 167.162 bits (422), Expect = 6.688e-39
Identity = 113/262 (43.13%), Postives = 155/262 (59.16%), Query Frame = 1
Query:  118 TVVGNIMQIGNIIRKYKDEQDFIQKKTFTKWINKYLKKH---DSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLE 894
            T VG + + G       DE+D +QKKTFTKW+NK+L KH   ++   + DL+ D+RDG  LI LLEVLSG ++ +E+G    + H L NV+IAL+YL  R++KLVNI   DI +G P + LGLIW IIL FQI + ++  +S+               D   K KLL W Q ++     +   +F  SW  G  F+A+I    P L+DM  V +    +NLD AF +AER LG+ +LLD EDV   +PDEKSI+TYVS   +
Sbjct:  164 TTVGTLARPGPEPAPATDERDRVQKKTFTKWVNKHLIKHWRAEAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKG--RMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSE---------------DMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYD 408          
BLAST of Nesprin-1 vs. UniProt/SwissProt
Match: sp|Q9UPN3|MACF1_HUMAN (Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4)

HSP 1 Score: 166.777 bits (421), Expect = 8.334e-39
Identity = 109/258 (42.25%), Postives = 152/258 (58.91%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYL---KKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPES 918
            + +  DE+D +QKKTFTKW+NK+L   +KH     + DL+ D+RDG  LI LLEVLSG  + +E+G    + H L NV+IAL++L +R++KLVNI   DI +G P + LGLIW IIL FQ               +     +  + D   K KLL W Q +      +  T+F   WS G  F+ALI  + P+LVDM+ V     ++NL+ AF++AER LG+ +LLD+EDV    PDEKS++TYVS   +     PE 
Sbjct:   69 VVRVADERDRVQKKTFTKWVNKHLMKVRKH-----INDLYEDLRDGHNLISLLEVLSGIKLPREKG--RMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQ---------------ISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAER-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEG 303          
BLAST of Nesprin-1 vs. TrEMBL
Match: A0A267EWS2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031215g1 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.418e-64
Identity = 319/1192 (26.76%), Postives = 531/1192 (44.55%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLK------LLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKL--------SMPEPAK-SNERGVND---------KIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLL---------LDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILE--FHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHK----IASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDI----EKLLSAD-----PTFKE---WAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNST-----------DDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHEN--KSLHVDNL---RKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEI---ERELAEMLTNFQSKANQQQ----EMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFA-LLVSKKIQE---SSWLTPF------KSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDS---------------MRIALDEILLKIQESDDD-------ELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQE----IIYKHNVYFEECDFKVTSLSYLSEMK---TLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLS 3390
            ++  +DEQ+ +QKKTFT WIN YL +      + DLF +++DG+ L+ LLEVLSG  +  E    M+++H LSNV+ AL++L  +KIKLVNINP+DIV+GKP IVLGLIW IIL+FQI+E E          + ++      +++G K K      LL W QN +  +Y + I DFG SW  G AF+A++   +P+LVDM+ +     ++NL++AF  AE  L I +L+D EDV  +KPDEKSIMTYV+QFL+     PE  +KK KL        S  E AK + E+  ND          ++R +    + R + ++  + F +  +  + LK   E +    +  + G LL         L+  ++AA   +   +W LD ++      +  WL  +ER L   F      +  + I+  L   LT    E+   F ++P       E ++          +       ++RR+ +V ++E  +RQKL  L      +A   + E+    KL  W   +  L   E  L D+++ +  G  +  V + ++      E L   D     P  +E   +A E       + RE++     L+   E W +  +       W+ S            D F      + +R  ++ +       L+   + +  + + ++L+ IN  +    E   +S  +D     RK Y      +  WL+++E L   ++  +   + E +  L  +    E ++ +FK +SK  Q + +   ++    MLG LKI K RL  L   R +L ++   L  +L   +SL + +++ V  I   ER LA+   + + K  +++    +   G+IN     +  K + LT +K       S KV N     + A+     E LN  R F  LL + +  E    +WL         KS L  W+ E    LA       D  N  L++S+A   S                  A +++L  + ES D         ++ E   L+++FN I   LSEA + R  R+  + C   +  + T  D E+ L       + +E    I+  H  YF +  ++      L+EM+    +     +  A   + E L +  E L  R+  + +     E+ L E +      N+L+     + S+ D +
Sbjct:   11 VKNLRDEQERVQKKTFTNWINTYLIQCQPPCKIADLFPEVKDGIKLLLLLEVLSGQKLPHESRKVMQRVHCLSNVRTALSFLESKKIKLVNINPADIVDGKPSIVLGLIWTIILYFQIEEQE--------DTIMKSLEGTELAERGEKFKGSAKKALLAWAQNNLGDKYAIDIRDFGNSWRDGSAFNAMVHNIDPSLVDMEKLGDRTNRENLEAAFAAAESGLNIPRLIDPEDVDVDKPDEKSIMTYVAQFLK---AYPEGSKKKPKLLEQIEDAQSKVEAAKQAAEQERNDLRKISDFCEAVERELPTSGKGRGDPVENYKKFEEFRQQQAALKEAYEALL---KRRADGHLLTLKPDEVDALEAQWRAASDQLNEWRWQLDSALPGDLGKVGGWLARAERCLREPFPDTAAGEPDEAIAQALHQRLT----EHRAIFADAPAMRKAFQEARKSA-----GRGLPAEQLADIDRRLTQVQQDEPEVRQKLEFLESKYRVLAYFIVTER----KLPEWTGNYGHLPEVEALLADYDNFVVAGKLLPSVDQALDSFRQQAEALKKRDSGKSMPETRENDRFATEATRKWDRLRREVQAAPEPLKRIAESWKQFLDEAEAIESWLPSAQAALRGSAEERDSFFADFANWEARHRRLNDAG---GLLTANCAPAAADEVRQRLQRINRQWKELSEGHKQSERMDAAEKSRKGYHASTTALTDWLDRAEQLVEAELPCNVRCIRENLASLQATQDQQEPMEAEFKSVSKTAQSMVKDLPEQTVNEMLGNLKIIKDRLQNL---RKRLPERSRGLKSVLPNVESLENGLEELVSWIEAGERLLAQHGGDSEDKTIEEKIEAHKTHFGQINYFKSVLDGKNRFLTKIK-------SSKVKNLNTDEVDAQ----FEDLN--RRFKDLLAASRSWERRLDAWLRRLDAYEKKKSELTAWLGEAGGALA------QDDAN--LDDSIARHRSFFDSNQQKQRQLLTNFLTASNDLLNSLTESGDGGATELARRIEAETQQLEADFNDI---LSEAPN-RLLRLTLDSCDAKLNQLLT--DGEDALASFNQRVEAKEPLDRILKNHETYFFKSHYRQNCEQLLNEMRQADVIAGAAARIDAQTDRFETLWQAAESLRTRLKDLPAKWKLFEDRLHEIQAFAEHSNDLLDRLAGLESSPDTA 1142          
BLAST of Nesprin-1 vs. TrEMBL
Match: R7T5N2 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_118770 PE=4 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 5.209e-64
Identity = 313/1202 (26.04%), Postives = 555/1202 (46.17%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE--HELDKKSQQS------------GAVRQANANNSASDK---GVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKES----------RIEKLKQIENFNDVFKLISNLKNELELIPEWDQ---TSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEF-------HKNNQIDVSKEIS--PELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQ----YWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSAD---PTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVD----WMNSTDDFSISPQEYISR--------KHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHV-----DNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIES-----LKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESS-------W--LTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALD--------EILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYR----KFRILENKCIEFIKNIETQ----LDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENF----PKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLD-LSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVA 3480
            DEQ+ +QKKTFT WIN YL + D    +++LF DI+DG  L+ LLEVLSG  +  E+GP +K+LH++SN+  AL++L  ++IKLVNIN +D+V+GKP IVLGL+W IIL+FQI+E    L ++SQ +            GA   A  + SA DK   G K  +L W Q  + + + + + DFG+SW SG+AF+A++    P+L+DM  + Q   + NL++AFD AE+HLGI +LLDSEDV  +KPDEKSIMTYV+QFLE     P++        + +   S +R  ND ++ ++   +E+          R ++ KQ   F +  K  + +   LE     D     +     ++ Q + +  +     QW LD ++      +  WL  +E ++E        H++   ++  ++        DL    KE+ +   NS +    L    R  I +D N + F + T   +  ++++  EE   R  LL    +A  K+K   +    Q       +++ +  + ++   +++    +    A V +   D +  + AD    +  +  +++++    ++ EI  ++T L   +E W +    Y+  VD    W+   +     P E  +         + K+  +++   FL E   +   + +  ++ +I+  +       ++++     +  R+EY + +E ++ WL  +E L       +   + +++  L       E ++  FK +S+  Q + +   +     ML  LK  K RL++L  D P+ +K L SL   +   ++ +S++ Q +   ER L     +             G INV  + + + +        Y + +ES      KVS    K +     E +    N R  + + S K  E+        W  L      LE W++E    LA       D++N L+ +  A  D++   +D        E+L  + E D +EL+     L  +  +I     E    R    +F++ E    EF++NIET       +++ L +  N   I+EI+ KH V F+E     T L  L EM T + +     P++  +    E   R+ E+L   I+ +   L   E   +  +E  +K +  +     V   +  L +  +++++Y   L+KF  +I ++D  ++ A
Sbjct:    1 DEQERVQKKTFTNWINSYLLRRDPPCRIEELFEDIKDGTKLLMLLEVLSGEKLAMEKGPRLKRLHFISNISTALSFLESKRIKLVNINSTDVVDGKPAIVLGLVWTIILYFQIEEFTKSLAQQSQHTPMSSTSSLGSHDGAT-PAKKSRSALDKFKGGAKKMMLGWAQKAVTKRFGIEVKDFGRSWRSGLAFNAMVHNVRPDLIDMNSLAQNPNRVNLENAFDCAEKHLGIPRLLDSEDVDVDKPDEKSIMTYVAQFLE-KYPDPDA-------DVTDSGDSKQRHYNDLLE-WLTQAEETLSIVDLPVNDRQQEYKQYMTFTEELKTKTKMYERLEKHGNDDSFLTLTQEKWTVVRQRWTSVTQQTRIWQWKLDSNLPGQLGYIGDWLYRAEEMVESEIQYVDKHEDTATNIKMKLDELKGFFQDLEQIKKEFHSIKGNSTYEGVVLP---RSQI-SDMNLR-FQTLTKKSDTMVRRLEYEEMQYR--LLAFLVVAEAKLKAWTVKCGRQDEVEALCKDYMNFVHEQELFKEYDKTYQDCKRRADVHKR-QDPQNTVEADRVNKSLDDITEKWRH----LKVEISSVQTMLEEVVEYWKR----YHACVDLFHVWLGDAEQMLKKPPEERADFFENLDKWEEKLQVLKEASNFLVEAVDEPIAQEVKEQVLFIDRRWHDVQGQVTVYLSKQTTEKSRQEYSVGLETMQNWLRNAEELLKKKPQSTHGEIRKHLTQLDSILAEEEQLEAQFKVVSRTAQSLVKDSDQATIREMLELLKACKQRLVSLQRDVPEKLKPLKSLMAQVESLENGISDLSQWLDSGERLLDSHRID-------------GNINVVEDRLVAHKDHFKETTYYKSMLESKNKVYQKVSKNGTKHLQISSLEEVMVEINKRFQSCVTSSKDWENRLEKGLRLWRNLQSKAQPLEEWVQEAEVVLA----QGGDNINDLIASHRAFFDTVDSQMDSDFTRAGQELLAVLAEEDCEELETSMGVLHDKQKEI----LEFAPIRLIKLQFQLPEE---EFLQNIETAEKTLAQQKQALEQKGN---IKEILRKHKVIFQESGLSRTCLQCLEEMATCVHDLQQRQPEHLGLQEAYEDHVRRWENLRLEIEALRVQL---EEVPQRWQEYNTKRDAFISWMGTVEETIQRLEEQTLSTNEYKETLDKFQEVIRNIDQHRDDA 1146          
BLAST of Nesprin-1 vs. TrEMBL
Match: A0A1I8GMD0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 8.785e-63
Identity = 232/806 (28.78%), Postives = 392/806 (48.64%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKG------VKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPES----PRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELE-LIP---EWDQTSSTGDLL----LDQD-----FKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYT--ISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEK----LLSADPTFKEWAQEF----KYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWM-NSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSS--------------DSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVD 2427
            ++  +DEQ+ +QKKTFT WIN YL        + DLF +I+DG  L+ LLEVLSG+ ++KE   NM+++H LSNV+ AL++L  ++IKLVNINP+DIV+GKP IVLGL+W IIL+FQI+E E          +R++      +++G       K  LL W QN +  +Y++ + DFG SW  G AF+A++   +P+LVDM  +     ++NL++AF  AE  L I +LLD+EDV  +KPDEKSIMTY++QFL+     PE     P+ + +L     A   ER   D I  F   V         + E  N  ++ ++ L+ E + L P   +  + S  G LL     D D     ++ A   +   +W LD  +   +  + +WL  +E  L +      D   + + E   +L+ +++E+   F   P        ++R +    +     +S     +++ R+ +V+ +E  +R++L  L     L     +   KL  W  +       ED   D+ + + +G  V  V + ++ + K    +   DP+    A  F    +     ++R+++     L   I  W     L  E  DW+ ++      +P E       I + E ++  L+E +S               + ++T+ R+ + +  +F +  +  SL  +  R++Y      ++ WL++SE L   ++  S + V E +  + E     E ++ +FK LSK  Q +++   K   + ML  LK  + RL  +   R  L +K   L  IL + ++L S +D
Sbjct:   10 VKSLRDEQERVQKKTFTNWINTYLITCQPPCKISDLFTEIKDGTRLLLLLEVLSGNKLQKENRGNMQRVHCLSNVRTALSFLESKQIKLVNINPADIVDGKPTIVLGLMWTIILYFQIEEQE--------DMIRKSLEGTELAERGELFKGSAKKALLAWAQNNLGDKYDVDLKDFGSSWRDGAAFNAMVHNIDPSLVDMDALRSRSNRENLEAAFQAAENGLNIPRLLDAEDVDVDKPDEKSIMTYIAQFLK---AYPEGGKNRPKLQDQLDAARQAGEKERLDLDSINDFCRKV---------ESEAPNGDYQTLAELQAERDNLQPSVEDLAKRSKDGRLLSTPPADVDAALAAWRQADDQLRKLRWRLDAELPGDFGRIGQWLGRAEACL-YQDWPADDAPDDSAAE---ELSERLREHNEVFSEDP------QSVRRDLQAARRAPPAGVSDAQIANMDTRLGRVIADEPDVRRRLEFLEPKRRLLASLAQCERKLPLWTGKCGKQQEVEDLFSDYNAFVIDGKLVDGVEQALDSLRKQAEPMRKRDPSGSREADRFLSDTRKRWDKVKRDVQGAGGPLEKAISCWKTYSRLSVEFNDWLPDAEQALRSTPDERDRFFADIRKRESDMRELNEAASYLTGCCVEPVASEIRTQQQTIGRRWKALFEDFKKTEKLDSLERN--RRDYHDGSGRLRDWLDRSETLADAEVACSREKVKESLDQIQELVDQQEAMEGEFKTLSKAAQDMAKELPKASLDEMLASLKEARERLQKV---RRSLPEKGRGLRGILPQIETLESGLD 780          
BLAST of Nesprin-1 vs. TrEMBL
Match: A0A267EZS9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015905g1 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.461e-62
Identity = 265/960 (27.60%), Postives = 445/960 (46.35%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLK------LLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKL--------SMPEPAKSNERGVND---KIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLL---------LDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILE--FHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHK----IASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDI----EKLLSAD-----PTFKE---WAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNST-----------DDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHEN--KSLHVDNL---RKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEI---ERELAEMLTNFQSKANQQQ----EMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRL---ETWIEETTSNLAILKNLETDSVNSL 2823
            ++  +DEQ+ +QKKTFT WIN YL +      + DLF +++DG+ L+ LLEVLSG  +  E    M+++H LSNV+ AL++L  +KIKLVNINP+DIV+GKP IVLGLIW IIL+FQI+E E          + ++      +++G K K      LL W QN +  +Y + I DFG SW  G AF+A++   +P+LVDM+ +     ++NL++AF  AE  L I +L+D EDV  +KPDEKSIMTYV+QFL+     PE  +KK KL           E  +++ R ++D    ++R +    + R + ++  + F +  +  + LK   E +    +  + G LL         L+  ++AA   +   +W LD ++      +  WL  +ER L   F      +  + I+  L   LT    E+   F ++P       E ++          +       ++RR+ +V ++E  +RQKL  L      +A   + E+    KL  W   +  L   E  L D+++ +  G  +  V + ++      E L   D     P  +E   +A E       + RE++     L+   E W +  +       W+ S            D F      + +R  ++ +       L+   + +  + + ++L+ IN  +    E   +S  +D     RK Y      +  WL++++ L   ++  +   + E +  L  +    E ++ +FK +SK  Q + +   ++    MLG LKI K RL  L   R +L ++   L  +L   +SL + +++ V  I   ER LA+   + + K  +++    +   G+ N     +  K + LT +K       S KV N     + A+     E LN  R F  L+S+  QE+  +   +S L   + W+      L  L + E     SL
Sbjct:   11 VKNLRDEQERVQKKTFTNWINTYLIQCQPPCKIADLFPEVKDGIKLLLLLEVLSGQKLPHESRKVMQRVHCLSNVRTALSFLESKKIKLVNINPADIVDGKPSIVLGLIWTIILYFQIEEQE--------DTIMKSLEGTELAERGEKFKGSAKKALLAWAQNNLGDKYAIDIRDFGNSWRDGSAFNAMVHNIDPSLVDMEKLGDRTNRENLEAAFAAAESGLNIPRLIDPEDVDVDKPDEKSIMTYVAQFLK---AYPEGSKKKPKLLEQVEAAKQAAEQERNDLRKISDFCEAVERELPTSGKGRGDPVENYKKFEEFRQQQAALKEAYEALL---KRRADGHLLTLKPDEVDALEAQWRAASDQLNEWRWQLDSALPGDLGKVGGWLARAERCLREPFPDTAAGEPDEAIAQALHQRLT----EHRAIFADAPAMRKAFQEARKSA-----GRGLPAEQLADIDRRLTQVQQDEPEVRQKLEFLESKYRVLAYFIVTER----KLPEWTGNYGHLPEVEALLADYDNFVVAGKLLPSVDQALDSFRQQAEALKKRDSGKSMPETRENDRFATEATRKWDRLRREVQAAPEPLKRIAESWKQFLDEAEAIESWLPSAQAALRGSAEERDSFFADFANWEARHRRLNDAG---GLLTANCAPAAADEVRQRLQRINRQWKELSEGHKQSERMDAAEKSRKGYHASTTALTDWLDRAKQLVEAELPCNVRCIRENLASLQATQDQQEPMEAEFKSVSKTAQSMVKDLPEQTVNEMLGNLKIIKDRLQNL---RKRLPERSRGLKSVLPNVESLENGLEELVSWIEAGERLLAQHGGDSEDKTIEEKIEAHKTHFGQTNYFKSVLDGKNRFLTKIK-------SSKVKNLNTDEVDAQ----FEDLN--RRFKALLSRAEQEAQDMQAAQSSLKLAKDWLRTAGDRLEPLTSTEAGDKASL 924          
BLAST of Nesprin-1 vs. TrEMBL
Match: A0A267F524 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010703g1 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.063e-61
Identity = 232/806 (28.78%), Postives = 392/806 (48.64%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKG------VKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPES----PRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELE-LIP---EWDQTSSTGDLL----LDQD-----FKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYT--ISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEK----LLSADPTFKEWAQEF----KYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWM-NSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSS--------------DSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVD 2427
            ++  +DEQ+ +QKKTFT WIN YL        + DLF +I+DG  L+ LLEVLSG+ ++KE   NM+++H LSNV+ AL++L  ++IKLVNINP+DIV+GKP IVLGL+W IIL+FQI+E E          +R++      +++G       K  LL W QN +  +Y++ + DFG SW  G AF+A++   +P+LVDM  +     ++NL++AF  AE  L I +LLD+EDV  +KPDEKSIMTY++QFL+     PE     P+ + +L     A   ER   D I  F   V         + E  N  ++ ++ L+ E + L P   +  + S  G LL     D D     ++ A   +   +W LD  +   +  + +WL  +E  L +      D   + + E   +L+ +++E+   F   P        ++R +    +     +S     +++ R+ +V+ +E  +R++L  L     L     +   KL  W  +       ED   D+ + + +G  V  V + ++ + K    +   DP+    A  F    +     ++R+++     L   I  W     L  E  DW+ ++      +P E       I + E ++  L+E +S               + ++T+ R+ + +  +F +  +  SL  +  R++Y      ++ WL++SE L   ++  S + V E +  + E     E ++ +FK LSK  Q +++   K   + ML  LK  + RL  +   R  L +K   L  IL + ++L S +D
Sbjct:   10 VKSLRDEQERVQKKTFTNWINTYLISCQPPCKISDLFTEIKDGTRLLLLLEVLSGNKLQKENRGNMQRVHCLSNVRTALSFLESKQIKLVNINPADIVDGKPTIVLGLMWTIILYFQIEEQE--------DMIRKSLEGTELAERGELFKGSAKKALLAWAQNNLGDKYDVDLKDFGSSWRDGAAFNAMVHNIDPSLVDMDALRSRSNRENLEAAFQAAENGLNIPRLLDAEDVDVDKPDEKSIMTYIAQFLK---AYPEGGKNRPKLQDQLDAARQAGEKERLDLDSINDFCRKV---------ESEAPNGDYQTLAELQAERDNLQPSVEDLAKRSKDGRLLSTPPADVDAALAAWRQADDQLRKLRWRLDAELPGDFGRIGQWLGRAEACL-YQDWPADDAPDDSAAE---ELSERLREHNEVFSEDP------QSVRRDLQAARRAPPAGVSDAQIANMDTRLGRVIADEPDVRRRLEFLEPKRRLLASLAQCERKLPLWTGKCGKQQEVEDLFSDYNAFVIDGKLVDGVEQALDSLRKQAEPMRKRDPSGSREADRFLSDTRKRWDKVKRDVQGAGGPLEKAISCWKTYSRLSVEFNDWLPDAEQALRSTPDERDRFFADIRKRESDMRELNEAASYLTGCCVEPVASEIRTQQQTIGRRWKALFEDFKKTEKLDSLERN--RRDYHDGSGRLRDWLDRSETLADAEVACSREKVKESLDQIQELVDQQEAMEGEFKTLSKAAQDMAKELPKASLDEMLASLKEARERLQKV---RRSLPEKGRGLRGILPQIETLESGLD 780          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000036923.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24166584:24185412:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000036923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 2.832e-52
Identity = 127/318 (39.94%), Postives = 187/318 (58.81%), Query Frame = 1
Query:  148 NIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERK-------IKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEK 1032
            +I  +  +EQ+ +QK+TFTKWIN +L K +  L + DLF DI+DG+ L+ LLEVLSG  +  E+G  +K++H++SN+  AL +L  R+       IKLVNIN +DI +G+P IVLGL+W IIL+FQI+E       L   S  + +V    ++ +AS               K  LL W+Q    +   + + DFG SW +G+AFH++I    P+LVDM++V +   ++NL+ AF +AE  LGI +LLD EDV  +KPDEKSIMTYV+QFL+                 P+P +S   G  +++    +NV   R E+
Sbjct:    5 SIKSRCPNEQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLK---------------HYPDPHQSETDGQQEEVLNSSLNVFVQREER 307          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000039764.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24167966:24185412:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000039764.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.512 bits (493), Expect = 3.929e-52
Identity = 126/310 (40.65%), Postives = 183/310 (59.03%), Query Frame = 1
Query:  172 EQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERK-------IKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEK 1032
            EQ+ +QK+TFTKWIN +L K +  L + DLF DI+DG+ L+ LLEVLSG  +  E+G  +K++H++SN+  AL +L  R+       IKLVNIN +DI +G+P IVLGL+W IIL+FQI+E       L   S  + +V    ++ +AS               K  LL W+Q    +   + + DFG SW +G+AFH++I    P+LVDM++V +   ++NL+ AF +AE  LGI +LLD EDV  +KPDEKSIMTYV+QFL+                 P+P +S   G  +++    +NV   R E+
Sbjct:   10 EQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLK---------------HYPDPHQSETDGQQEEVLNSSLNVFVQREER 304          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000045503.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24166584:24193162:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000045503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 8.638e-49
Identity = 119/271 (43.91%), Postives = 171/271 (63.10%), Query Frame = 1
Query:  148 NIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERK-------IKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSAS-----------DKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFL 891
            +I  +  +EQ+ +QK+TFTKWIN +L K +  L + DLF DI+DG+ L+ LLEVLSG  +  E+G  +K++H++SN+  AL +L  R+       IKLVNIN +DI +G+P IVLGL+W IIL+FQI+E       L   S  + +V    ++ +AS               K  LL W+Q    +   + + DFG SW +G+AFH++I    P+LVDM++V +   ++NL+ AF +AE  LGI +LLD EDV  +KPDEKSIMTYV+QFL
Sbjct:    5 SIKSRCPNEQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFL 275          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 166.007 bits (419), Expect = 2.960e-41
Identity = 107/256 (41.80%), Postives = 154/256 (60.16%), Query Frame = 1
Query:  160 KYKDEQDFIQKKTFTKWINKYL---KKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPES 918
            +  DE+D +QKKTFTKW+NK+L   +KH     + DL+ D+RDG  LI LLEVLSG  + +E+G    + H L NV+IAL++L +R++KLVNI   DI +G P + LGLIW IIL FQ               + +   +  + D   K KLL W Q        +  ++F  SWS+G  F+AL+  + P+L+DM++V +   ++NL+ AF+IAE  LG+ +LLD+EDV    PDEKS++TYVS   +     PE 
Sbjct:   62 RVADERDRVQKKTFTKWVNKHLIKVRKH-----ITDLYEDLRDGHNLISLLEVLSGVQLPREKG--RMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQ---------------ISEIYVSGESGDLTAKEKLLLWTQQATEGYPGLRCSNFSSSWSNGRMFNALLHRYRPDLIDMEVVARQSNRENLEQAFEIAES-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKIPEG 294          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 169.088 bits (427), Expect = 2.135e-40
Identity = 108/240 (45.00%), Postives = 143/240 (59.58%), Query Frame = 1
Query:  163 YKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVS 882
            + DE+D +QKKTFTKW+NK+L K   +  V DL+ D+RDG  LI LLEVLSG T+ +E+G    + H L NV+IAL++L  R++KLVNI   DI +G P + LGLIW IIL FQ               +     N  + D   K KLL W Q ++     M   +F  SW  G  F+A+I    P LVDM  V +    +NL+ AF++AE+ LG+ +LLD EDV    PDEKSI+TYVS
Sbjct:    7 FPDERDRVQKKTFTKWVNKHLIKAQRH--VSDLYEDLRDGHNLISLLEVLSGETLPREKG--RMRFHKLQNVQIALDFLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQ---------------ISDIQVNGQSDDMSAKEKLLLWSQRMVEGYQGMRCDNFTTSWRDGKLFNAVIHRHEPRLVDMSKVYRQTNLQNLEQAFNVAEKELGVTRLLDPEDVDVPHPDEKSIITYVS 227          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009426.1 (pep scaffold:Pmarinus_7.0:GL476614:383620:553344:1 gene:ENSPMAG00000008375.1 transcript:ENSPMAT00000009426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.267 bits (469), Expect = 6.086e-46
Identity = 109/260 (41.92%), Postives = 146/260 (56.15%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKP--------------XXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIP----REYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLE 894
            DEQ+ +QK+TFTKWIN +L      L+V DLF D+RDG+ LI LLEVL+G  +  E+G  +K++H LSN+  AL ++  R+IKLVNIN   I +GKP               I      L+ +     E  L      S A  Q     +      K  LL W+Q ++P    R     I DFG SW +GIAFH +I    P LV+++ V Q    +NL+ AF +AE  LGI +LLD +DV  +KPDEK IMTYV+QFL+
Sbjct:    1 DEQEAVQKRTFTKWINSHLALVRPPLVVDDLFKDLRDGVKLIALLEVLTGERLPYEQGRQLKRIHALSNIGTALKFMEARRIKLVNINAPYIADGKPSIVLGLIWTIILYFQIEEATNNLLPISPWSSETSLSSMEGSSTASPQRKRRQTPMRSTAKKALLKWVQLVVPSLESRVGGTEIRDFGASWRTGIAFHLMIRAIQPELVNLEQVTQRSNHENLEEAFIVAEEKLGIPRLLDPKDVDVDKPDEKIIMTYVAQFLK 260          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002838.1 (pep scaffold:Pmarinus_7.0:GL477168:22072:87306:1 gene:ENSPMAG00000002584.1 transcript:ENSPMAT00000002838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 2.126e-40
Identity = 109/252 (43.25%), Postives = 150/252 (59.52%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYL---KKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPE 915
            DE+D +QKKTFTKW+NK+L   +KH     V D++ D+RDG  LI LLEVLSG  + +E+G    + H L NV+IAL++L  R+IKLVNI   DI +G P + LGLIW IIL FQI + ++  +S+               D   K +LL W Q ++     +   +F  SW  G  F+A+I    P L+DMK V     ++NL+ AF +AER +G+ +LLD EDV    PDEKSI+TYVS   ++    PE
Sbjct:    6 DERDRVQKKTFTKWVNKHLMKVRKH-----VNDMYEDLRDGHNLISLLEVLSGEKLPREKG--RMRFHRLHNVQIALDFLRLRQIKLVNIRSDDIADGNPKLTLGLIWTIILHFQIADIQVSGQSE---------------DMTAKDRLLLWSQRMVEGYPGIRCDNFTTSWRDGRLFNAIIHRHRPELIDMKRVAVRANRENLEQAFTVAERDMGVTRLLDPEDVDVPSPDEKSIITYVSSLYDVIPRMPE 235          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006515.1 (pep scaffold:Pmarinus_7.0:GL476558:286719:335794:-1 gene:ENSPMAG00000005865.1 transcript:ENSPMAT00000006515.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 4.277e-37
Identity = 94/240 (39.17%), Postives = 138/240 (57.50%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQF 888
            DE+D +QKKTFTKWIN +L++   N  + DL+ D+RDG  LI LLE LSG  + +E+G    ++H++ N++I LNYL  +++KLVNI   DIV+G P + LGLIW IIL +                  Q +A         + +LL W + +      ++  +F  SW  G    A++    P LVD++ V +   ++NL+ A  +AE  LG+ +LLD EDV  + PDEKSI+TYVS  
Sbjct:    1 DERDRVQKKTFTKWINSHLQQVRMN--IGDLYEDLRDGQALISLLESLSGDCIIREKG--RLRVHHVQNIQIVLNYLQHQQVKLVNIRKEDIVDGNPKLTLGLIWTIILHY------------------QVSAGQVGGGTPGRERLLAWARLVAKDVPGLSCHNFSSSWRDGRLLCAIVHAHRPGLVDLEEVRRRGARQNLEEALSLAESELGVPRLLDPEDVDVDAPDEKSIITYVSAL 218          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006506.1 (pep scaffold:Pmarinus_7.0:GL476558:286440:335800:-1 gene:ENSPMAG00000005865.1 transcript:ENSPMAT00000006506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.14 bits (383), Expect = 7.590e-37
Identity = 95/240 (39.58%), Postives = 142/240 (59.17%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQF 888
            DE+D +QKKTFTKWIN +L++   N  + DL+ D+RDG  LI LLE LSG  + +E+G    ++H++ N++I LNYL  +++KLVNI   DIV+G P + LGLIW IIL +            Q+ +      N+S+     + +LL W + +      ++  +F  SW  G    A++    P LVD++ V +   ++NL+ A  +AE  LG+ +LLD EDV  + PDEKSI+TYVS  
Sbjct:    3 DERDRVQKKTFTKWINSHLQQVRMN--IGDLYEDLRDGQALISLLESLSGDCIIREKG--RLRVHHVQNIQIVLNYLQHQQVKLVNIRKEDIVDGNPKLTLGLIWTIILHY------------QNASFAHIEGNHSSMQS--RERLLAWARLVAKDVPGLSCHNFSSSWRDGRLLCAIVHAHRPGLVDLEEVRRRGARQNLEEALSLAESELGVPRLLDPEDVDVDAPDEKSIITYVSAL 224          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004049.1 (pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1 gene:ENSPMAG00000003699.1 transcript:ENSPMAT00000004049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.525 bits (384), Expect = 1.269e-36
Identity = 99/240 (41.25%), Postives = 145/240 (60.42%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQF 888
            DE++ +QKKTFTKW+N +L +   +  + DL+ D+RDG MLI LLEVLSG  + K     M ++H L NV+ AL +L E+++ L N+   DIV+G   + LGLIW IIL FQIQ+  ++ +             +S   K  K  LL W Q       N+ + +F  SW  G+AF+ALI    P+L+D   +   DP  N+ +AF++AE+ LG+ +LLD+ED+  E PDEKS++TYV  +
Sbjct:    2 DEREEVQKKTFTKWVNSHLSR--VSCRIGDLYADLRDGRMLIKLLEVLSGERLPKPTKGKM-RIHCLENVEKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETE-------------DSREVKSAKDALLLWCQMKTAGYPNVRVHNFTTSWRDGLAFNALIHKHRPDLIDFDALDPADPYGNMQTAFNVAEQKLGLTQLLDAEDIAVEHPDEKSVITYVVTY 225          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO37406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFT6])

HSP 1 Score: 162.925 bits (411), Expect = 5.330e-44
Identity = 109/260 (41.92%), Postives = 159/260 (61.15%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGA--VRQANANNS----------------ASDKGVKLK--LLTWIQNIIPREY--NMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVS 882
            D+Q+ IQKKTFTKW+N YL K   ++ V D+F +++DG  L+ LLEVLSG  +RKERG   K+ H L+N+   +++L+E+K+KLVNI+P  IV+G   I+LGL+W+II  +Q  +   + K+Q+S +   R   A+NS                A+ K V+ +  +L W +    +    N  I DF  SW +G AF  +I  F P+LV++  + + D   NL  AFD+A  HL + KLL+ EDV  EKPDEKSIMTY++
Sbjct:    7 DDQEKIQKKTFTKWMNFYLAKSKPSVQVDDIFTELQDGTKLLTLLEVLSGEKLRKERGN--KRPHQLANLGHVIDFLTEKKVKLVNIHPESIVDGNTTIILGLLWIIIHHYQSSKIAQNIKAQRSLSEKYRIVPASNSLVPCAFETISQIQGFYATKKKVRTRKFMLEWAKKATSKASGSNEAIKDFSTSWRTGQAFLQIIHSFRPDLVNIATIAERDNITNLTEAFDLAYTHLNVPKLLEPEDVDVEKPDEKSIMTYMA 264          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO41099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D1])

HSP 1 Score: 151.369 bits (381), Expect = 2.092e-37
Identity = 96/238 (40.34%), Postives = 143/238 (60.08%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVS 882
            DE +  QKKTFTKWIN  L +  +N+ V DLF D++DG +LI LLEVL+G  +++ERG NM +LH+L+NV  A+  L E  I+L+NI+ +DIV+G   + LGLIW +I  F            Q     Q   +   + + V   LL+W QN       +++T+F  SW  G+AF+A+I  + P+L     ++   P  N + AF +A   LG+  LLD+EDV+ ++PD+KSI+ YV+
Sbjct:    2 DEHEGTQKKTFTKWINIQLSRAGNNVRVGDLFNDLKDGTILIALLEVLTGKKIKRERG-NM-RLHHLNNVNNAMMILEENDIRLINISNNDIVDGNHKMTLGLIWSVIAHF------------QLNFALQFLMDEEGTPEEV---LLSWCQNTTKGYKGVSVTNFTTSWRDGLAFNAVIHRYRPDLFSYDALVGSSPMSNCEHAFKVARDSLGVDSLLDAEDVVRDRPDKKSIIMYVT 222          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 139.428 bits (350), Expect = 9.023e-35
Identity = 90/248 (36.29%), Postives = 141/248 (56.85%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMR-KERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLE 894
            I+  K+E+ F QKKTFTKW+N +L K  S L V DLF D+ DG +LI LLE++SG  +    RG    ++H + NV  AL +L ++ +KL +I   D+V+G        + L +++  I   ++   S Q         + S   K  K  LL W Q +     ++ I +F  SW +G+AF+AL+    P+L+D   +     + NL++AF +AE  LGI +LLD+EDV   +PD++S+MTYV+ + +
Sbjct:   14 IKTLKNERIFSQKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKF--RVHNIQNVNKALEFL-QKSVKLESIGAEDVVDGN-----ERLILGLIWMIILRFQIADISYQD--------DMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQ 245          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 146.362 bits (368), Expect = 4.605e-34
Identity = 98/245 (40.00%), Postives = 153/245 (62.45%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQF 888
            I+   DE++ +QKKTFTKWIN +L++  +   V +L+ D++DG  LI LLEVLSG  + K     M+ +H L NV+ +L +L ++++ L N+   DIV+G   I LGLIW IIL FQIQ+  ++ ++ +  + + A              LL W Q+      ++TIT+F  SW  G+AF+A+I    P+L++ + + + D ++NL+ AF++AE  LGI  LLD+EDV  + PDEKSI+TYV+ +
Sbjct:   15 IKVLADERERVQKKTFTKWINSHLQRVGAR--VNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRMR-IHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITIEGETTEKRSAKDA--------------LLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFPDEKSILTYVAAY 242          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 134.035 bits (336), Expect = 7.653e-31
Identity = 95/248 (38.31%), Postives = 144/248 (58.06%), Query Frame = 1
Query:  154 IRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMR-KERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLE 894
            I+  K+E+ F QKKTFTKW+N +L K  S L V DLF D+ DG +LI LLE++SG  +    RG    ++H + NV  AL +L ++ +KL +I   D+V+G   ++LGLIW+IIL       ++   S Q         + S   K  K  LL W Q +      + I +F  SW +G+AF+AL+    P+L+D   +     + NL++AF +A   LGI +LLD+EDV   +PD++S+MTYV+ + +
Sbjct:   14 IKTLKNERIFSQKKTFTKWVNSFLDK--SGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKF--RVHNIQNVNKALEFL-QKSVKLESIGAEDVVDGNERLILGLIWMIIL-----RFQIADISYQD--------DMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQ 243          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: ENSORLT00000033742.1 (pep primary_assembly:ASM223467v1:24:9030654:9050235:-1 gene:ENSORLG00000028886.1 transcript:ENSORLT00000033742.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 2.451e-50
Identity = 123/262 (46.95%), Postives = 170/262 (64.89%), Query Frame = 1
Query:  175 QDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXE-----HELDKKSQQSGAVRQANANNSASDKGVKLK------------LLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITR 909
            Q+ +QK+TFTKWIN +L KH   L VKDLF DI+DG+ML+ LLEVLSG  +  E+G  +K++H+++N+  AL +L  RKIKLVNIN +DIV+G+P IVLGL+W IIL++QI+E      EL   S  + ++  + ++   +   VK K            LL W+Q    +   + + DFG SW +G+AF ALI    PNLVDM+ V +   ++NL  AF +AE  LGI +LLD EDV  +KPDEKS+MTYV+QFL+    R
Sbjct:   19 QEAVQKRTFTKWINSHLAKHAPPLEVKDLFEDIKDGVMLLALLEVLSGQKLPCEQGKKLKRIHWVANIGTALKFLEGRKIKLVNINSTDIVDGRPSIVLGLVWTIILYYQIEELTSSLPELPLLSSSTSSMDSSTSSTDTTSPPVKRKPLPPVQGGARKALLRWVQQTSTKCLRLEVKDFGPSWRTGLAFFALINALRPNLVDMERVRRRSNRENLQEAFLLAETELGIPQLLDPEDVDVDKPDEKSVMTYVAQFLKYPPQR 280          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: ENSORLT00000000374.2 (pep primary_assembly:ASM223467v1:22:316712:329038:1 gene:ENSORLG00000000306.2 transcript:ENSORLT00000000374.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 1.881e-46
Identity = 140/397 (35.26%), Postives = 219/397 (55.16%), Query Frame = 1
Query:  172 EQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQS----GAVRQANANNSASDKGVKLK------------LLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSN----ERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELI-----PEWDQTSSTGDLLLDQ-------DFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERIL 1266
            EQ+ +QK+TFTKWIN +L+K      + DLF DI+DG+ L+ LLEVLSG  +  E+G ++K++H++SN+  AL +L  RKIKLVNI+ +D+ +G+P IVLGLIW IIL+FQI+E   +  + Q+     +   +  ++      VK K            LL W+Q    + + + + DFG SW  G+AF +++    P+LVDM+ V +   ++NL+ AF +AE  LGI +LLD EDV  +KPDEKSIMTYV+QFL+     P  P    +  +  PA  N    ER +  ++K F+  +++  +       N +D +++  +   + E+      P        G L +DQ       D  +A+  +L     LD+S+     ++  WL  +E  L
Sbjct:    5 EQEAVQKRTFTKWINSHLEK------MNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRHLKRIHWVSNISTALKFLEGRKIKLVNIHATDVADGRPSIVLGLIWTIILYFQIEELTSNLPALQAFSNSSSSVDSLTSSETGSPPVKRKVLHKFQGNAKKVLLRWVQCTAAKHHGIEVKDFGPSWRDGVAFQSMVHAIRPDLVDMEEVRRRSNRENLEEAFSLAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLK-HYPNP-GPAAGQQEVLLWPADCNLTREERKMLRELKVFLDQLEKDVLRAQGSDGNLSDKYQVFKHFHVQFEMKKKQAEPLLQPVHPDGKLSVDQALVKQAWDHVSAR--LLDWHIHLDKSLPGPLGSIGAWLHRAEMAL 391          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 176.407 bits (446), Expect = 1.241e-42
Identity = 112/272 (41.18%), Postives = 150/272 (55.15%), Query Frame = 1
Query:  148 NIIRKYKDEQDFIQKKTFTKWINKYLKKH----------------DSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPE 915
            N+  KYKDE+D +QKKTFTKW+NK+L KH                +    + DL+ D+RDG  LI LLEVLSG T+ +E+G    + H L NV+IAL++L  R++KLVNI   DI +G P + LGLIW IIL FQ               +     N  + D   K +LL W Q ++     +   +F  SW  G  F A+I    P L+DM  V +   Q+NL+ AF +AER LG+ +LLD EDV    PDEKSI+TYVS   +     P+
Sbjct:   24 NVREKYKDERDRVQKKTFTKWVNKHLIKHWKAECFISLGVLRKQEEVQRHITDLYEDLRDGHNLISLLEVLSGETLPREKG--RMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQ---------------ISDIQVNGQSDDMTAKERLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFSAIIHKHRPALIDMNQVYRQTNQENLEQAFSVAERELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRVPD 278          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 172.94 bits (437), Expect = 1.129e-41
Identity = 108/252 (42.86%), Postives = 145/252 (57.54%), Query Frame = 1
Query:  169 DEQDFIQKKTFTKWINKYLKKH---DSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPE 915
            DE+D +QKKTFTKW+NK+L KH   +    + DL+ D+RDG  LI LLEVLSG T+ +E+G    + H L NV+IAL++L  R++KLVNI   DI +G P + LGLIW IIL FQ               +     N  + D   K +LL W Q ++     +   +F  SW  G  F A+I    P L+DM  V +   Q+NL+ AF +AER LG+ +LLD EDV    PDEKSI+TYVS   +     P+
Sbjct:   15 DERDRVQKKTFTKWVNKHLIKHWKAEVQRHITDLYEDLRDGHNLISLLEVLSGETLPREKG--RMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQ---------------ISDIQVNGQSDDMTAKERLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFSAIIHKHRPALIDMNQVYRQTNQENLEQAFSVAERELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRVPD 249          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 172.17 bits (435), Expect = 2.149e-41
Identity = 112/255 (43.92%), Postives = 149/255 (58.43%), Query Frame = 1
Query:  133 IMQIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLEL 897
            I    N+  KYKDE+D +QKKTFTKW+NK+L K   +  V DL+ D+RDG  LI LLEVLSG T+ +E+G    + H L NV+IAL++L  R++KLVNI   DI +G P + LGLIW IIL FQ               +     N  + D   K KLL W Q +      +   +F  SW  G  F+A+I    P L+DM  V Q    +NL+ AF++AE+ LG+ +LLD EDV    PDEKSI+TYVS   ++
Sbjct:   19 IQAYENVREKYKDERDRVQKKTFTKWVNKHLIKAQRH--VTDLYEDLRDGHNLISLLEVLSGDTLPREKG--RMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQ---------------ISDIQVNGQSEDMSAKEKLLFWSQRMTEGYPGIRCDNFTTSWRDGKLFNAVIHKHYPRLIDMGKVYQQSNLENLEHAFNVAEKDLGVTRLLDPEDVDVPHPDEKSIITYVSSLYDV 254          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 12377.6 bits (32121), Expect = 0.000e+0
Identity = 6584/6646 (99.07%), Postives = 6595/6646 (99.23%), Query Frame = 1
Query:  136 MQIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIXXXXXXXXXXXXXQDLQAKLRLFNSITXXXXXXXXXXXXXXXXXXXXXXXXXKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGXXXXXXXXXXXXXQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSXXXXXXXXXXXXXXSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDXXXXXXXXXXXXXXEIETEKQMIFXXXXXXXXXXSEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNXXXXXXXXXXXXXXKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDXXXXXXXXXXXXXXDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRXXXXXXXXXXXDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFXXXXXXXXXXXXTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDXXXXXXXXXXXXXXXXVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQXXXXXXXXXXXXINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMXXXXXXXXXXXXVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNXXXXXXXXXXXXXRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETXXXXXXXXXXKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQXXXXXXXXXXXXXSISQLRDXXXXXXXXXXXXXXXXXXXDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLKNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYXXXXXXXXXXXXKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESAXXXXXXXXXXXXXXXXXXXXXXXYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIKIF*MTFLVSMNI*VRLMRLAKNR*W*LSLK*AMN*LS*KVRPVKYLIIYPNPLKI----KKHTIQSREILKAIAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTXXXXXXXXXXXXXNYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRXXXXXXXXXXXXXXXXXXXEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEKK 20061
            MQIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQERVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQELNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLINISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSELSEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIENINNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLELKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLKNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYVLLPLAPELVEEKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESALNSKLELLLNLKNLIDQQQNNIKYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIK   +  + S +  +     +      ++L    N L+  V   K   I+ N  K     K +      I   IAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTEEIIELDIKEKLENYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRDVDLMSDMSLHSSLSDTDHEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEK+
Sbjct:    1 MQIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQERVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQELNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLINISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSELSEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIENINNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLELKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLKNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYVLLPLAPELVEEKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESALNSKLELLLNLKNLIDQQQNNIKYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIKDL-LNDISSFHEYLSSFDASGKESLMVALTEVSNELT--VLEGKTGEIFNNISKSLENQKTYNSIKGNIEGKIAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTEEIIELDIKEKLENYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRDVDLMSDMSLHSSLSDTDHEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEKE 6643          

HSP 2 Score: 2159.41 bits (5594), Expect = 0.000e+0
Identity = 1104/1118 (98.75%), Postives = 1110/1118 (99.28%), Query Frame = 3
Query: 20022 KDEEIEQVYHGKENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILXXXXXXXXXXXXXXXXXYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHXXXXXXXXXXXXDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELKTNEEL 23375
            K  ++ +    KENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILSDFEKDKDKDSFMKDQKYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHEGTNEGTENENNDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELK+ +E+
Sbjct: 6631 KTRKLNRCIMEKENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILSDFEKDKDKDSFMKDQKYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHEGTNEGTENENNDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELKSLDEI 7748          

HSP 3 Score: 136.346 bits (342), Expect = 1.107e-30
Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 3
Query: 17412 DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG 17615
            DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG
Sbjct: 5760 DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG 5827          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 12353.3 bits (32058), Expect = 0.000e+0
Identity = 6573/6645 (98.92%), Postives = 6589/6645 (99.16%), Query Frame = 1
Query:  139 QIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIXXXXXXXXXXXXXQDLQAKLRLFNSITXXXXXXXXXXXXXXXXXXXXXXXXXKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGXXXXXXXXXXXXXQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSXXXXXXXXXXXXXXSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDXXXXXXXXXXXXXXEIETEKQMIFXXXXXXXXXXSEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNXXXXXXXXXXXXXXKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDXXXXXXXXXXXXXXDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRXXXXXXXXXXXDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFXXXXXXXXXXXXTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDXXXXXXXXXXXXXXXXVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQXXXXXXXXXXXXINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMXXXXXXXXXXXXVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNXXXXXXXXXXXXXRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETXXXXXXXXXXKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQXXXXXXXXXXXXXSISQLRDXXXXXXXXXXXXXXXXXXXDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLKNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYXXXXXXXXXXXXKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESAXXXXXXXXXXXXXXXXXXXXXXXYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIKIF*MTFLVSMNI*VRLMRLAKNR*W*LSLK*AMN*LS*KVRPVKYLIIYPNPLKI----KKHTIQSREILKAIAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTXXXXXXXXXXXXXNYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRXXXXXXXXXXXXXXXXXXXEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEKK 20061
            ++   + K ++EQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQERVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQELNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLINISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSELSEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIENINNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLELKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLKNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYVLLPLAPELVEEKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESALNSKLELLLNLKNLIDQQQNNIKYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIK   +  + S +  +     +      ++L    N L+  V   K   I+ N  K     K +      I   IAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTEEIIELDIKEKLENYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRDVDLMSDMSLHSSLSDTDHEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEK+
Sbjct:   43 RLSKTMAKRRNEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQERVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQELNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLINISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSELSEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIENINNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLELKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLKNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYVLLPLAPELVEEKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESALNSKLELLLNLKNLIDQQQNNIKYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIKDL-LNDISSFHEYLSSFDASGKESLMVALTEVSNELT--VLEGKTGEIFNNISKSLENQKTYNSIKGNIEGKIAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTEEIIELDIKEKLENYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRDVDLMSDMSLHSSLSDTDHEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEKE 6684          

HSP 2 Score: 2159.41 bits (5594), Expect = 0.000e+0
Identity = 1104/1118 (98.75%), Postives = 1110/1118 (99.28%), Query Frame = 3
Query: 20022 KDEEIEQVYHGKENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILXXXXXXXXXXXXXXXXXYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHXXXXXXXXXXXXDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELKTNEEL 23375
            K  ++ +    KENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILSDFEKDKDKDSFMKDQKYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHEGTNEGTENENNDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELK+ +E+
Sbjct: 6672 KTRKLNRCIMEKENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILSDFEKDKDKDSFMKDQKYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHEGTNEGTENENNDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELKSLDEI 7789          

HSP 3 Score: 136.346 bits (342), Expect = 1.135e-30
Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 3
Query: 17412 DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG 17615
            DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG
Sbjct: 5801 DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG 5868          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 10007.5 bits (25968), Expect = 0.000e+0
Identity = 5324/5334 (99.81%), Postives = 5329/5334 (99.91%), Query Frame = 1
Query:  139 QIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIXXXXXXXXXXXXXQDLQAKLRLFNSITXXXXXXXXXXXXXXXXXXXXXXXXXKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGXXXXXXXXXXXXXQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSXXXXXXXXXXXXXXSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDXXXXXXXXXXXXXXEIETEKQMIFXXXXXXXXXXSEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNXXXXXXXXXXXXXXKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDXXXXXXXXXXXXXXDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRXXXXXXXXXXXDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFXXXXXXXXXXXXTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDXXXXXXXXXXXXXXXXVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQXXXXXXXXXXXXINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMXXXXXXXXXXXXVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNXXXXXXXXXXXXXRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETXXXXXXXXXXKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQXXXXXXXXXXXXXSISQLRDXXXXXXXXXXXXXXXXXXXDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLK 16140
            ++   + K ++EQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQERVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQELNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLINISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSELSEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIENINNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLELKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLK
Sbjct:   43 RLSKTMAKRRNEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQERVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQELNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLINISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSELSEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIENINNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLELKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLK 5376          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 9981.28 bits (25900), Expect = 0.000e+0
Identity = 5324/5334 (99.81%), Postives = 5329/5334 (99.91%), Query Frame = 1
Query:  139 QIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIXXXXXXXXXXXXXQDLQAKLRLFNSITXXXXXXXXXXXXXXXXXXXXXXXXXKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGXXXXXXXXXXXXXQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSXXXXXXXXXXXXXXSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDXXXXXXXXXXXXXXEIETEKQMIFXXXXXXXXXXSEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNXXXXXXXXXXXXXXKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDXXXXXXXXXXXXXXDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRXXXXXXXXXXXDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFXXXXXXXXXXXXTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDXXXXXXXXXXXXXXXXVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQXXXXXXXXXXXXINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMXXXXXXXXXXXXVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNXXXXXXXXXXXXXRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETXXXXXXXXXXKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQXXXXXXXXXXXXXSISQLRDXXXXXXXXXXXXXXXXXXXDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLK 16140
            ++   + K ++EQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQERVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQELNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLINISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSELSEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIENINNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLELKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLK
Sbjct:   43 RLSKTMAKRRNEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLSCQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREIKYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAEMEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYKIKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFKDLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLCEILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVALESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSFALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENSLAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESYRKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEECDFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSDLSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNKFCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRRGSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQERVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAESQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHPTILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAARKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICENAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQSNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNPSLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSIVSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELVVNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDARETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKDCMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKITEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIETILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMSIEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLANNNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTHDKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHNSLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEKIMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMSQYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIYDQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQLETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDLLKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNRVNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGNYFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILIAKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLYIQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYRRLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEIEVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVELITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNETKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQELNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIYPNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLINISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLHKLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCREDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNLKPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLIFQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIIDNIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDSEYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLELKTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSRLRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKINEINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSELSEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIENINNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLSNEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFNHYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKNQLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKLNEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRAQELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKPIENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINETITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKREIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTFEEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISKLTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLEREAAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNLQTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQFNNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIHCREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETWLKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELEEQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALEIANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMKDKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIYDELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKLLDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERIDEIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKIENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNLLQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLKLNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKKLIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDEMKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQNDIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSLNLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERFEPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTTSSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLELKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDLDNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQMTKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDLYNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENRMKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIRHAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKERDLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTATFSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFHKSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLK 5376          

HSP 2 Score: 2371.27 bits (6144), Expect = 0.000e+0
Identity = 1250/1312 (95.27%), Postives = 1261/1312 (96.11%), Query Frame = 1
Query: 16138 KNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYXXXXXXXXXXXXKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESAXXXXXXXXXXXXXXXXXXXXXXXYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIKIF*MTFLVSMNI*VRLMRLAKNR*W*LSLK*AMN*LS*KVRPVKYLIIYPNPLKI----KKHTIQSREILKAIAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTXXXXXXXXXXXXXNYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRXXXXXXXXXXXXXXXXXXXEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEKK 20061
            KNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYVLLPLAPELVEEKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESALNSKLELLLNLKNLIDQQQNNIKYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIK   +  + S +  +     +      ++L    N L+  V   K   I+ N  K     K +      I   IAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTEEIIELDIKEKLENYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRDVDLMSDMSLHSSLSDTDHEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEK+
Sbjct: 5525 KNVELALNRIWAKFEYYRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMNNYADLLYQIDENLSALEHLRNKLKNYVLLPLAPELVEEKQIEFQQLTSDIVDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENTRVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESALNSKLELLLNLKNLIDQQQNNIKYLDEYWHDISISTINEDRDMLENNIRDWNTSNQDLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNINSYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKSRLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCENNEIILVDIKDL-LNDISSFHEYLSSFDASGKESLMVALTEVSNELT--VLEGKTGEIFNNISKSLENQKTYNSIKGNIEGKIAEIKNHLDITEIPGVSLAARNYRYESDGQSLGNINENFDQLCSLSQKLTENGDDNYKEKIVGELLMIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVSTPEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTEEIIELDIKEKLENYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWIESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNMIFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGELKIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVDSEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVIIDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSASGAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHNLNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQLSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNSAILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKTTTQIRDVDLMSDMSLHSSLSDTDHEAIVTDWLVSARRILKETYFEDVNDLVLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSLNDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEKE 6833          

HSP 3 Score: 2157.87 bits (5590), Expect = 0.000e+0
Identity = 1104/1118 (98.75%), Postives = 1110/1118 (99.28%), Query Frame = 3
Query: 20022 KDEEIEQVYHGKENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILXXXXXXXXXXXXXXXXXYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHXXXXXXXXXXXXDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELKTNEEL 23375
            K  ++ +    KENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILSDFEKDKDKDSFMKDQKYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHEGTNEGTENENNDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELK+ +E+
Sbjct: 6821 KTRKLNRCIMEKENIEQLLLDLQDGDHFRAKPAIIVNVLSNLSAEIERLCEESLTNTKTFDCEESSFPNAIKKPTTSLDINDDTYEEYLQKNYDNQGDSGSKDFSDIPFKKLKTNELSLSESMLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLSSIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQANDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEGNEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKCLETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYSEDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLAARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQDSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKDIQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQDKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMSLILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGTGDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKAPEDQNDDLDINKNETLILSDFEKDKDKDSFMKDQKYLTAKGDLSEIPLVSTSERNALPMDELKPFDPSKEIINLQEIESRFHEGTNEGTENENNDMATVISDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFSDISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPVDQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMVESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGEMSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLSESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELKSLDEI 7938          

HSP 4 Score: 136.346 bits (342), Expect = 1.136e-30
Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 3
Query: 17412 DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG 17615
            DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG
Sbjct: 5950 DLLNDISSFHEYLSSFDASGKESLMVALTEVSNELTVLEGKTGEIFNNISKSLENQKTYNSIKGNIEG 6017          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000077685.1 (SMESG000077685.1)

HSP 1 Score: 215.312 bits (547), Expect = 1.677e-54
Identity = 190/552 (34.42%), Postives = 302/552 (54.71%), Query Frame = 1
Query:  166 KDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYL-SERKIKLVNINPSDIVEGKPXXXXXXXXXXXXXXXXXEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTI--TRPESPRKKLK-------LSMPEPAKSNE----RGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQ--------DFKAAKRLVLSCQWLLDESVNNGWKN-LCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQ-IKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGN----FVAIVTEMINDIEKLLSADPTFKE 1737
            KDEQ+ +QKKTFTKW+N YL +    +I+KDL  D+ DGL+L+ LLE+L+ +T++KE+  NM+K+H LSN++ AL ++ +++KIKLVNINPSD+V+GKP IVLGL+W  IL FQI+E E         A+  AN  N+      K  L+ W  N +  +Y + I DFG+SW  G AF+AL+   +P LV+M+ + +G  ++ L++AF+IAE  LGI KLLDSEDV  EKPDEKSIMTYV+QFL+      +PE+  +++        +SM +P   NE    +  NDK+ +          E L    N+ D+F  + + +++++L+   D+ S+   L LD         DF   +  +   QW LD+ +     + +  WL  +E  L       ++    +  +  +D  +Q +KE+E+ F      +  LA+ +  + N   N  +      +++ R++ V K E  +R+KL +    A+LK K ++    L  W     S  +  D++  F  +M NG     F + + E++    K    +P   E
Sbjct:   15 KDEQEKMQKKTFTKWMNSYLCQKKPPIIIKDLMKDLSDGLLLLDLLEILTKTTLKKEKPKNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAILHFQIEEQE----EFLLQALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPP--NELDIVKDFNDKVDK--------NFENLNSKNNY-DIFADLMSQRDDMKLL--LDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESL-------MEPFPNVHDKTFNDKVLQKLKEHESIFNKK---NDVLAKFREVLQNPPAN--ISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDE 537          
The following BLAST results are available for this feature:
BLAST of Nesprin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNE17.480e-5445.86spectrin repeat containing nuclear envelope protei... [more]
SYNE13.316e-5245.86spectrin repeat containing nuclear envelope protei... [more]
SYNE14.926e-5145.49spectrin repeat containing nuclear envelope protei... [more]
SYNE14.979e-5145.86spectrin repeat containing nuclear envelope protei... [more]
SYNE12.865e-5044.24spectrin repeat containing nuclear envelope protei... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-107.133e-3736.70VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-107.139e-3736.70VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-107.349e-3738.20VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-107.504e-3736.70VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-108.685e-3736.70VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msp3007.954e-6227.67gene:FBgn0261836 transcript:FBtr0332405[more]
Msp3008.227e-6227.67gene:FBgn0261836 transcript:FBtr0303385[more]
Msp3001.113e-6127.54gene:FBgn0261836 transcript:FBtr0303383[more]
Msp3002.410e-6127.72gene:FBgn0261836 transcript:FBtr0332404[more]
Msp3002.493e-6127.72gene:FBgn0261836 transcript:FBtr0303388[more]
back to top
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syne1a1.659e-4545.49spectrin repeat containing, nuclear envelope 1a [S... [more]
pleca3.107e-4243.75plectin a [Source:ZFIN;Acc:ZDB-GENE-030131-8984][more]
plecb1.751e-4142.44plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
plecb4.947e-4144.31plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
plecb1.568e-4042.54plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
back to top
BLAST of Nesprin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNE12.416e-4640.53spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE16.904e-4142.40spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE11.774e-4042.40spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE12.193e-4042.40spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE12.339e-4042.40spectrin repeat containing, nuclear envelope 1 [So... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syne12.497e-5345.49spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne15.468e-4944.32spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne15.963e-4944.32spectrin repeat containing, nuclear envelope 1 [So... [more]
Macf11.555e-4344.49microtubule-actin crosslinking factor 1 [Source:MG... [more]
Plec2.557e-4242.44plectin [Source:MGI Symbol;Acc:MGI:1277961][more]
back to top
BLAST of Nesprin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZWR6|SYNE1_MOUSE3.832e-5045.49Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 S... [more]
sp|Q6ZWQ0|SYNE2_MOUSE3.671e-3935.47Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 S... [more]
sp|D3ZHV2|MACF1_RAT6.641e-3942.58Microtubule-actin cross-linking factor 1 OS=Rattus... [more]
sp|Q9QXS1|PLEC_MOUSE6.688e-3943.13Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3[more]
sp|Q9UPN3|MACF1_HUMAN8.334e-3942.25Microtubule-actin cross-linking factor 1, isoforms... [more]
back to top
BLAST of Nesprin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EWS22.418e-6426.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
R7T5N25.209e-6426.04Uncharacterized protein (Fragment) OS=Capitella te... [more]
A0A1I8GMD08.785e-6328.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EZS91.461e-6227.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F5242.063e-6128.78Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036923.12.832e-5239.94pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
ENSAMXT00000039764.13.929e-5240.65pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
ENSAMXT00000045503.18.638e-4943.91pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
MACF12.960e-4141.80microtubule actin crosslinking factor 1 [Source:HG... [more]
plecb2.135e-4045.00plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
back to top
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009426.16.086e-4641.92pep scaffold:Pmarinus_7.0:GL476614:383620:553344:1... [more]
ENSPMAT00000002838.12.126e-4043.25pep scaffold:Pmarinus_7.0:GL477168:22072:87306:1 g... [more]
ENSPMAT00000006515.14.277e-3739.17pep scaffold:Pmarinus_7.0:GL476558:286719:335794:-... [more]
ENSPMAT00000006506.17.590e-3739.58pep scaffold:Pmarinus_7.0:GL476558:286440:335800:-... [more]
ENSPMAT00000004049.11.269e-3641.25pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nesprin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO374065.330e-4441.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410992.092e-3740.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291019.023e-3536.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424314.605e-3440.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495767.653e-3138.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033742.12.451e-5046.95pep primary_assembly:ASM223467v1:24:9030654:905023... [more]
ENSORLT00000000374.21.881e-4635.26pep primary_assembly:ASM223467v1:22:316712:329038:... [more]
pleca1.241e-4241.18plectin [Source:NCBI gene;Acc:101160251][more]
pleca1.129e-4142.86plectin [Source:NCBI gene;Acc:101160251][more]
plecb2.149e-4143.92plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2][more]
back to top
BLAST of Nesprin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016745.11.107e-3099.07SMESG000016745.1[more]
SMESG000016745.11.135e-3098.92SMESG000016745.1[more]
SMESG000016745.10.000e+099.81SMESG000016745.1[more]
SMESG000016745.11.136e-3099.81SMESG000016745.1[more]
SMESG000077685.11.677e-5434.42SMESG000077685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015584 ID=SMED30015584|Name=Nesprin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=23779bp
AACTTGGTATTTAATCATTAGGAATTTCAAAGCTAAATATTTGCGCTGAT
AATTGAAAATTCTCGTTTTAATTTCAATTATTATTTGGATTAATATATTA
CAATTGATTATCTGCCAACAGTCGTTGGAAATATAATGCAAATCGGCAAT
ATAATCAGGAAATATAAAGATGAACAAGATTTTATTCAAAAGAAAACCTT
CACCAAATGGATAAATAAATATTTGAAAAAGCATGATTCGAATTTGATTG
TGAAAGACCTCTTTGTTGACATTCGCGATGGGTTGATGCTGATTTATTTG
TTAGAAGTTCTATCCGGGAGCACCATGAGAAAAGAGCGTGGTCCAAACAT
GAAAAAGTTGCATTATCTAAGCAATGTGAAAATCGCTCTCAATTATTTAT
CGGAGAGAAAGATAAAATTGGTTAATATAAACCCATCAGATATCGTAGAA
GGGAAACCGGTTATTGTACTTGGCTTAATATGGCTGATCATTCTTTTCTT
TCAAATTCAAGAACACGAGTTAGACAAAAAGTCTCAGCAATCTGGTGCTG
TCCGTCAAGCGAATGCTAATAATAGTGCCAGTGACAAAGGTGTGAAACTG
AAACTGTTGACCTGGATTCAAAATATTATACCGCGAGAATACAATATGAC
GATTACGGATTTCGGAAAGTCTTGGAGTAGTGGGATAGCATTTCATGCAC
TGATAGAAGTTTTCAATCCCAATCTAGTCGACATGAAAATAGTTCTCCAA
GGTGACCCTCAGAAAAACCTGGATAGTGCTTTTGATATCGCTGAAAGGCA
TTTGGGAATTGCCAAATTATTGGACTCTGAGGATGTAATTGCTGAAAAGC
CGGATGAAAAATCCATCATGACTTATGTGTCACAATTCCTTGAATTGACC
ATTACCAGGCCCGAATCGCCGAGAAAGAAACTCAAATTATCAATGCCAGA
ACCCGCAAAATCTAATGAAAGAGGTGTCAATGATAAGATTAAACGTTTCA
TTATCAATGTCAAAGAATCTCGGATCGAAAAATTAAAACAAATCGAGAAC
TTTAACGATGTATTTAAGTTGATCTCGAATTTGAAAAACGAGTTAGAACT
CATTCCTGAATGGGACCAAACCTCCTCAACTGGTGACTTACTTTTAGACC
AAGATTTCAAGGCTGCCAAACGTCTGGTTTTGTCATGTCAGTGGTTATTG
GATGAATCTGTCAATAACGGATGGAAAAATTTATGTAAATGGCTCATTTC
ATCTGAAAGGATTTTAGAGTTTCACAAAAATAATCAAATTGATGTCTCAA
AAGAAATCTCGCCAGAATTGCTTGATGATTTAACTGTGCAAATAAAAGAA
TATGAGACTCATTTCAAAAACAGTCCGTTTCACAGTCCGACATTGGCAGA
ACTGAAGCGCTGCATGATTAACACTGATAAAAATAATAAAGTATTTATAT
CTTATACTATCTCAGTTGAAAGGAGAATTCAAAAAGTCGTTAAAGAGGAA
TTTAGTATAAGACAAAAGCTTTTGCTATTACACAAAATAGCCAGTTTAAA
AATGAAAGAAAAGGAAATAAATTATAAGCTACAGTATTGGAAAAGAGAAT
TTGATTCATTGGCAAATGCTGAAGATCGGCTATTAGATTTTGAAAGTGCA
ATGGCCAATGGAAATTTTGTTGCTATTGTTACAGAAATGATAAATGATAT
TGAAAAGCTGTTATCTGCTGACCCTACGTTTAAGGAATGGGCTCAAGAAT
TTAAATATCATATATCGGACATTGAAAGGGAAATCAAGTACATTGAAACG
TCTTTACGGACATATATCGAGGAATGGCATAAGATGGAAGAGTTGTACAA
CGAAACTGTTGATTGGATGAATTCGACCGATGATTTTTCAATTTCTCCCC
AGGAATATATTTCCCGAAAGCATAAAATAGCGGAAATGGAGAAAAATATC
GCTTTCCTATCAGAACAATCCAGCGATTCTGGAAAGGAAACTCTTTCACG
AAAACTTGAATATATCAATTTGAATTTCAGTCGATTTCACGAAAATAAAT
CTTTACACGTTGACAATTTAAGGAAGGAATACAAAATAAAAGTGGAAAAT
ATTAAAAAGTGGCTAGAAAAATCAGAAGCTCTCGAATCTTTAGATATAAA
TTTCTCTACGGATAGTGTAAATGAATATGTGCAAATTCTAGTAGAATCGA
ACAAGACTTCAGAGAATGTCAAAGAGGATTTTAAAGACTTATCGAAAATC
GGACAAGTGATTTCAAGAACTTGCAGCAAAGAGGAAACTGAAAGAATGTT
GGGAGAATTGAAAATTCAAAAAATCCGCTTGCTAACATTGATAGAAGACC
GGCCAAAACTAATAAAAAAGTTGTCAAGTCTCTGTGAAATACTCAATAAA
TGCGACAGTTTATTATCCAATGTTGACCAAGCAGTTGGAGAAATTGAGAG
AGAACTTGCAGAAATGCTCACGAATTTTCAAAGCAAAGCAAATCAGCAAC
AGGAAATGTTTCTTGGAGAAATAAATGTGGCTCTGGAATCTATCAAATCC
AAAGAACAATTGCTAACAAATCTCAAAGTTTATATCGCAGAAATCGAGTC
TTTGAAAGTGTCCAACTTTCCCTTAAAGCCAATTTATGCACGAGAAAATG
AAACCATTGAAAAATTAAACAACCTTCGATCATTTGCCCTTCTTGTCTCC
AAAAAGATACAGGAATCTTCATGGCTTACACCATTTAAAAGTCGATTGGA
AACCTGGATTGAAGAAACCACGTCAAACTTAGCCATTTTAAAAAATCTCG
AAACAGATTCAGTTAATTCTCTATTAGAAAACAGTTTGGCGATGAAAGAC
TCAATGAGAATAGCTCTAGACGAGATTTTATTAAAGATTCAAGAGTCTGA
TGATGATGAATTAAAGGATGAAGGAAATAACCTACAAAGCGAATTCAATA
AAATTTCTTCACAATTATCCGAGGCTGAAAGTTATCGGAAATTTAGAATC
CTGGAAAATAAATGCATCGAGTTTATTAAAAACATAGAAACGCAACTAGA
CGAGGAAGAAATGCTTGTTAAACATGCAAATTTGGATAAAATTCAGGAAA
TTATTTACAAGCATAATGTATATTTTGAAGAATGTGATTTCAAAGTTACC
AGCCTGTCATATCTGTCGGAAATGAAAACTTTATTAGAAAACTTCCCTAA
AAATCAGGCTATTCTTAGTAAGGCTGAAATGTTAGAACGACAATGTGAGG
ATTTAAGTAAAAGAATCGATACTGTTGGAAGTGATTTATCAAATTCGGAG
AATTCGTTACGAGAGAAGAAAGAAAAGATATCAAAACTCAACGAATTAGT
TATTAATTTCACAAATGTTTCTTCAAATCTCGACTTGAGCGATCTAAATG
TCACATCGGATCAGTATGACATGGTGCTGAATAAATTTTGCAGTCTCATT
CCGGATGTGGATAACATGAAGGAGGTCGCATTGGAACTGAGAAATGATGG
AATTTTATCTCAAGAAGATATCTTTGAAGAGACAATTTCAAATTTTGAAT
CTATTGCACCGTCCGTTGAATCTCTGAAGAGAAGAGGATCGAACATATCT
GATGCCATAAAACTTAAAGAGGAAGCAGAAAATGAAGCGGAAAAACTCCA
AGATCTACAAGCTAAATTAAGACTGTTCAATAGTATAACAATTGGAGAGG
AATTAATTCTATTGGGAGAATTGAGGCAGCAAGAAAGAGTCGTTGAACAA
ATACAAGAACTACGCAAAGAAATCATTGAAAATACCGGAATGAAATTTAC
TGAATTGGAATTGAAAGACCCAACTGTTGCATTAATGGTGCTGCCAACAA
TAGAAAATCTTCAATTGTTATGTGAATTAGCCGAGTCCCAATCAGTTGAG
TTATTGTCCCATAACAGTCATATAGTTAACACAAAGCTATCAATAAAAAA
AGAAATGGATACTTTGGAAGCCAAAATAATGAATCTCCAAGAAGCAATCG
TTCCCAGCACCTTTGAAAATGAGCAGATACACCCAACCATTCTAGAAGCG
CAAATGTCAATTGATTTTATAAATGAATCCCAATCTCAATTCGAGTCCCA
GTTGAGCAAAGATTATACAGATTTTCTATCAAATTTTTGCAAAGAAAAAT
CAGAAGAACTCGAGCAAATTCAACAAGATGCCGCTCGAAAATCGAACAGA
AAAAACGTTGAGAAGATCCTGAGGAATTGCATATCTCACATTGAATTGGA
TTTAACAAATTTCGATAAATTCATTTACAAAATTCCCCTTGAAAAAGCAA
AGACTATTCTCATTGAAGAAAAAAGAATTTGTGAAAATGCAATAAAAAGT
AACGTTGACAGGCTTGATCACGATTTAGGGGAAATTGTCATTTCCCATGG
GGATTTGAATGGTGAAGTACGAGGGATTGATTTAAGTGAAGATGCGAGCA
AAGTTCTTGTAAAGGTTCAAACCTTTTCAGAACAAAGTAATTCCTTACAA
AAACGTCTATTGGATATCCAAACAGTCGAAGACGTCCGTGCATGGAAAGA
TGCTTGGTGTGAACTTGGAAACAATATCCATTCTCTCTGTCAATCTATCG
ACAATATTCAGAGTTTATTAAATTATAGTAATCCTTCATTAAAGGCTGAA
TTGTCACTGGAAAAAATTGATGAAATTTTTACAAAGATTGAGTTGCTTGA
ATCTAATTTCGACAAACAAAATGTCAAGATCCAATCTCAATTGTCACGGA
TAAATGAATTTGAAAGCAGCATTGAAGGAAGCATTGTGAGCGATATGAAT
CAGTTATTAGAATACAAGGAAGCTCTTTCTAAATACTCGGAAGTGATAAA
TGAGATTAAACAGGAAGAGATTATCCCTTTTGAATTGAAAGAATTTGTCA
CCAATCTCAACGAGAATCCTGGAATTGAATTAGTAGTGAATCAAATTAGC
AAAATCCGCCACAATATAGAATCCAAAGTCGGAATGATATTGGATCAGGA
AAATGAAAAGAATAGTCAGATTGTCAATGAAGTCAGCTTGCAATTATATG
ATGAATTCACTGAAACTGATAACCAACTAGACGCTAGAGAAACGATATCC
GTTTTGGAGTCTTCTCGGATAAGATTAGAAACTCTAAAAACCAACACTGA
GGCATTAAAATCCCTATCGGAAAAGTTTGGGCATTACTTATCATATGAGA
AAACCAATAAACAAATTAATAAAACACTTAAAGACTGTATGGAGATATTG
GATTTATGTGGTGCTAAAATCGATGTGATGGAACACTGTAGATCATTTGT
TGATCAACTAAATGAGCTAGAGGAACGCGTAAATCGAATTTCAGAGCCTT
TAAATGACAAAGAGGAAATAATTTTGGATAAAATTACCGAAATTAATGCA
TTAAAACAAAATATTATGTTATTAGGTGAATCATTGGTCAATTTAAGAGA
AAGATTTTCAACCAATCAAATCGTCATTTGTTCGGCAATTGAAGAAAGAT
ATGAAAACTTAAAAAGTCAATCGCAATCTATCGAAACAATTCTTGACAAG
AAAATAAAATTATTAAATGAAGATAAAAAGCGACTTGATTTGCTACTAAA
CCAAAGAATCGAAGTCAGCAATAATGTCGAAGAATTAATAAAAAGTCTAG
ATCAAATTCAATGGAATAGCAGTGACCAAATGAGCATTGAGCATAATTAC
ACAGTGATCCAACAATTATCGGATCAATTTAATGATCAAATAACCATAAT
TAACTATTGCAAGCAGAATTTACCCGGTGAAAACTTTACAGAAATTGAGA
ATGAAATCGAAATATTTCAACTGAAATTGGCAAACAATAACAAGAAATAT
GAAGAGCAAATAGATTTGATTTCGAATGTCGTTGAAAAATCGAAATGTGC
TTCACTTTGCTTCACTTTGCACTCTGATCCAAACTCAGAAGTAGACGTTT
CGAATTTGATCAAGAATACAATGGAGAACACTCATGACAAATTGAAATCC
ATAGAACTTTTGAAAAGGAAAGTCGACGAACAATTTGAAAGTGACGATGG
CGAATTGTTGCAATTATTAGACCGGAAACAATCACAATTAGCCAATGATC
TGGAACTGATCCGGTCTGTGTCAGAAAATCACAATAGCCTAATTGATTTG
TCCGGTGAAGTGAATTCAATTTCAAATAAAATCGATAAGTCGATTGGCAC
TCTAAAATCAATTCTCAAATCTCCGGAAAAATCAATAATTGACGTCGAAG
GGATTTTAGAGCACACTAATTGTAATTTAGAAAAAATAATGAAAATCCAA
ACCCGACAACCAATTTTGGAGACGCCGGTTTCTAAAGAAATATTATCTAA
GATCCAAGAGAAATTATCCAAAGATATTAATGAAGTCATCCATGTTACGC
AATCATCACTAGATCCAATACATAGTTTAATGAGTCAATATCAGAGATTG
AAAACTGACGGAGATAAATGCTCTGATGAAGTCCACTACCTTGAACAGAT
GGTTACTGACAATATGGGCATGCCAATGATCCAGGAGCAACTGGAACATA
TAGATCACATTACGACTACGCTGTGTAGCATATACGATCAAGTAGAAACC
AACAAACAGGTATTTGGAATCCGTGAAATCTGTGAACTATCCGATCACTG
TATCAGTAATAAAGACAAACTTAATCAGATAAAGTACAAAATTCTAAAAC
AACAAGAACAAATAATGAAGGATCAAGAACAACTGGAAACCTTAACAAAT
CAATTCAATAACATCAAAGCTGACACTTTAAAGAAGTTGTCGGATTTTGG
TTCCGAACTTCATTTGAAAGAAACTGTTTTGAGTTTGGATTCATTAGAAA
ATACTTTATGTTTTGGAAAAGAAAAAATAGATCTCCTGAAAGGTATTGCA
ATGAATATCAAAAACTTCAACAGTGAAATATCAATGGATTGTGCCAAGCA
AGTGGAGGAAATGGAAATTCTATTGGTTGATTTGGATAAAAGTTTTATGG
AGATTGGTGAAGTTATAAAAGTCGGAAATAATAGAGTAAATGAAATAAAG
GAAAAGTATGAAAATTTATTAGCAAGACTCGATTTAGAATCGGAAAATGT
TGACTTTGATTTTGATGAAATTACCGGAGCCATTGAAAACTGTCATGTTT
TAAAAACTGAGCTAATTGAAACAATAAATGGAAACTATTTCAAGTTTGAG
GAAGTTAATGACTTATTGAACCGCACAGTGCCAATCAATAACGATATAGA
TAGCTTGATTTCTCGTTTGGAATTAAAATTAAATGTGGAACAAGAGAATC
AAAACCAATTTATTAATACAAAGGATATTTTGATTGCCAAATCTGAAGAC
ATTCGGTCAATCATTGAAAGAATTAATCAACTCGTCACAGAGCTGTCGAA
GGATTTGCAGAGTTCCAACTTAGAAATCAAAAATGTAGTAAATGTTCTTG
ATATTATACAAAAGGACGTTGAGAGGTTATTATACATCCAGTCGAATGAG
CTGAACCTTTCTTCTCCAGTATTAAACAATGAAATTGTAAATTTGCAAAC
CTCTATTTCACATGAAATTGCGGAGTGCACCCAGTCGACACAATCCTTCT
ATAATTCCATAGACAATGCCCTGGGTAAATATCGAAGATTGAAACAACAA
TGCGACCAGTATTCCGATGAAATCGACTTTTTGCAACATGAATTTCTAGC
GGAAATGGATTTGGAAGTGCTTTCCAAGAGACTTGATGAAGTAAACAATT
TGGTGCAAAATGAAAATCATCTCAAAGATGAAATAGAAGTGTGTAAAAAA
GTTTTAAATATCCTCGAAACTGTTGGATTGCATGACGAATGTGAAGGCCA
GATCAAGGCATTGAATGGGTTGCATCAGAATATTGAAGCGCAAATAAAAA
TCATTAACACTGACAAACAGCGGCTTGTGGAATTAATAACATATTTCACC
GAAATTAGGAACTGTGCCGAAGAAAGTTTAACTGATTTTATGGTAAAAGT
AAATAATAAAAAAGAACTGTTAAGCCTTGAAAAAATGAGCACCATTACAA
TGAAGGCAATAGATAGTCTGGATATTTTAAACGAAACTAAAGAAAAGATT
AAAGAATATGATTTACCGGAGAGCATCAATAAGGAAATTGATATAAAAAA
TCTCTCAGAATCTTTATCCGAATTTAAAGTAAATTTTAATAATATCACAA
AAATTGTTGAGGATGGCAATAAAAGTCTCCAGGAACTCAACGAAGAATAC
CAAGAGTTATTAATCCAATCTGATGTCGAAAAAGCGGAAAAGAACAAAAA
TGATTTTTTGGAGATTTTAAAATCCAAAAAAGACCGAATCGAAAACCTAG
ACAAACGATTGGGATTTATTATCAACAAAATTTATCCGAATTTCGAAGAG
GTGAATGAAGTCATTCGCAAAACAAAACTATTGGACAGCAACATCAGCCA
GCTCAGCCAATCAATTAATTCACAGCTGGAAATCGAAACGGAAAAACAAA
TGATTTTCAATAATTTGAAAAATAAGCTTATCAACATTTCCGAAGAAGTG
AAATTGATTTATCAAAAAATTTTGAAAACTCTAAATTTGATCCATAAATC
ATCTCATTCATCAATGGAGGAAATTGAATTATTGATCGACAACATTGAAC
AAGACGTTGCACAATTAATCTCCATTCAATTACATAAATTAAATATCACT
TCTCCCGTCTTTTTCGACAATCAAATATCTCAAATCCAACAGACGATTTC
GAGTGAAATCACCAAATATGTTGATGACACAAAAACATCGATTAATCACA
TTCGGGAATCAATTCGTCAATTTCTCTCCTGTCGAGAAGACTTAACTAAG
CTTTCCGACGAATCCCACTTTCTGCAACTCGAATCTCTATCAGACTCGAA
TATGGCATCTTTCGATAACAGACTGAAAGAAATAGAAAATCTACTCGAAA
ATCTTGAGGATATCTGTGACAGAGTTGACAACTTAAAACCTAATTTCAAT
TGTTCTGAAATCGAAGATTTATACAATAAAATCACAGATCTGAAATTAAA
ACTCCAGGAGTTGAGTACAAAAACTAAAGATCTACAAGAAACGAATAGAA
TCAATGAAGAAAAATTAAAGAATTTACTATTAATTTTCCAAGAAAATGCA
GAAAAAATATCAGCACAATTACAAATGATTCTCGACAAATCGATTGATGA
AAGTGCTTGTTTGAATTTAAAAGATACAGAAAATTGTTTGTGTGAATTCA
ATAATGCAGCTGATACATTGAACGGAATCATCGATAATATTGGCCAATTA
AATAATTCCTCAGCGGACAAATGTCGATTGCGATTGGACAGTTTGAAACT
GTTAAACGCCGACCTAACCAATCTATATAACAATGTGGACAATATAGTAA
AAGAAAAATCCACCGAATTAAATAAAATCGATAGTGAATATGAAGCCTTA
ATTAAAATTGATGATTTTGGAATGTTAAAGAATCTCGAACTGAAGCGAGA
TCAATTGAAAGAATTAAAAGACCAGATGTCAATGTTTAATCGAATAGATC
AGTTGAATTTCAAGGAGATTCGTCATTTGGAATTGAAAACGACGAACATT
ATCGACAAAATCGACTCGTCCATTGAATATTTAAATGGGAAAATTGAAAC
CGAACAAAGCAAAGAGGAATTATTGAGTCAAATCGACTCGGAACTCGATG
AAAATTTAAAAATGATCACTATATTATTCTCGAGATTGCGTTCAACAGAA
TCAACGATAACAATAGAAGAAATCGATGAAATGCTCCACAATATATCAGA
AAACATGAAAATCGTTATTGAAGAAATCAATGACGAGATTCTAAACCAAT
GCCCAGTGCCTGATGAAATTTCTAAGAAAATTAATGAAATAAACGATAAA
CGTGTTCAACTCAGTGGAATATCTCTGGAAATTAAAGAAAACTTGAAGAA
TAATATACAAACTCTTAATTTTTACAAGCCATTGATTGATTGTCACAATT
CGACACTGATCAAGTTTAGCGAGAGTTCAGAATTATCAGAAGATAATTCG
TCTACGATAGAGGATATTAGTAGGCAATTAATACAATCCAAGGATTCATT
ATTAGCTTTATCTGAAAGTCCCAGTGAATATATTTGCAAGGATAAAGCAG
ATTTTGATGAGTCGAAATCAATCGAAATTGAAAATATTAATAATTTATTA
AATAAAGTGCAAATGTTATCGGACAAATTCCAATTTGAAAAATCGAAAAA
AGAATTTCTTGATGAATTAGGAAAAGTGAAATGTGAAAATGATTCTCTAA
AAGAACTCATTGAATCCGGCGATCCAAATCTGTCAAATGAGGAAATTCTC
AATAGGATTGATAGAAACATTTTCGCTATAAGTGATCTTGAAATAAACTA
TCAAGACAATCCAATTGTTGCGGAATACTTGCAACGGATGATTGATTACA
AGCACATCGCGGAAGGCATTAAAAATCAATTCAATCATTATCTCTCTGTA
TTGGGGAACCATGGAACTTTCATAGACAATATAGATCAAGTCCTTCGACA
GGTCAAAGAACAATTGAATACCGATGATTTGCAGTCCGCCGATGATCCAA
CTGCGAGAATGGAAAAACTAACCGATCTAAAAAATCAGCTGAAATATCCC
GAGTTGCCAATTGAAAACAAATCGAAAGAAAGTGAAATTTTACTAGTAAA
ACTGCAAAATATCAATGAAAATATTCAACAATTGTCAAAAGAAATATCGA
AAAAAGAACAACATGAAAAGATCAAAGGAAAATTGAACGAAATTCATCGA
ATATTGAAAGTTTTTATTGAGAATAATATCGAAAATCCATTGAAAGATAT
TAATAATTATTTCTCCCAATCCAATTCTTTGATGGAATCGGTTTTGAGAG
ACGTCAGTGAAATAGATCCAGAAACCGATCGCGCTCAAGAATTAATTTCG
GAAATAAATTCCCAAAAGTGCCTGATCAGTCAAGTAGAGGAGAGCATTGG
TGATTTATATGGTCAAATGAAAACTGGGGCAGCAATCTATGGTGAACATT
GTCAAAAAATCAAAGATTGGACAGCGAGGAAACCGATTGAAAATTTCAAC
GATATAATAAATTTTAAATCACTCTTTAAAGAACACTTGAAAAATTTGAT
TTGTTGGAAAAAAAACTTGGAACCAAAAATCCGCTGCCAGGATTTGAGTG
ATTTAGTGAAAAAATTGGACGACTCAATTAATGAAACGATTACAATATTA
GAAAATCTTGAATGCGAAGAAAAGAAAATGCGGATAGAAAGCGAAATGTT
GACAGTTCTGGAAGCAATTAATACCGATATCACTCAGTTGGAGCAAGGGG
GAAAGGGTGAAAATAAGGCGAGTTTTTCTAAAAGGGAAATCGATGAAAAT
TTGAGTGCGATAAAAAACAATTTATCAATAATTCAAACCCAAATTGACGA
GAACGAGGCGAATATGATTGACGAGAAATTGAAATCGAGTTTTTTGTGCA
CATCAAATCGAGTTGTGCAATTGGATAAAACGTTTGAAGAAAAGTTGCAA
ATATTGTCTCAATTAGACATTGAAAAGGAATCTATTATTCAAAATCTGCC
GACTTATGAAGGTGTAATTGATGATACCAATGAAATAAGAGACTTACTAA
CTCATTTGGATAATGTAACGGATATTATCTCGAAACTGACTGACATCGGC
ATTAGGTACCAGGAGGAAGGATTGCAGTGCATTGAACGGACCGATAGTAT
GTCCAATGTCCACGCAGAACTAGCCAACATCAATCACGCAAAGCTTTTAT
TGGAAGCTAAAATAAAATCCAAATTGGAAAGAGAAGCTGCTTTCAGTGAC
ATCAAAGTGTTCTTAGGAGAAATCGAAAAGAGGTTGGATAATTTTAAAAT
ATCTTTACAAATGGATAATCAAGATGTTCCATTGGCAAACATTGAACAGA
CATTGGGGGATATTGAAAAGGATTTTTTGAATTTACAAACCCCAGAACTA
CTAGATGAGACGGAATTTGAGGAGGTGATTAGAGACATTGGACAGAACAT
AAATACAAATAAAGAATATTTATTAACTCTATCCCAGGAGATAACTGATA
AAGAAAACGTACAGAAAGATCTAGAGAATCAATTCAATAATTGCACAAAT
CTAAAACAATTTATACCGATCGACTTGGTCACTCAATACAAAAATCATCA
ATCGAATTTCAATCAATACGAAAGATGGAGACTTTTGAATTGTGAGTTGT
GTAAAGAAGTGAAAGATTTGGAAACAGAAATCCATTGCCGAGAAGTTCAC
AATTTAAAGGAAGATATTGACAGACTAGGTAATAATATCAAAACGATAAT
GACTTCTGAAGAAGGCAAGATCAAAGAAACGATTGAAAAATTGCAAGAGA
ATCTCGAGCGAGCAAAAATTGAACAGGAGACCTGGCTGAAAGAGATGATA
AAAACTCTACAAAACTCAACACAAAGTTCCAATCTTGTGCCGACGATAAT
CCAATCAAAAAAGGAGGCATTAGAAAGTTTAATAGGAAGCTTAGAAACCG
GGCATGGATTGATTGATAAAATCTTTGAGTTGGAAGAGCAAATGAAAGAG
ATCAATAGTGAGTTCAGTGACAATCAGTGCACTCATCGTGACAGAAAGGC
TAGTGTGATCCAATATATGGAACTGATCCAGGAATCACAACGACGATTTG
CTGATATTGCCGATAAATACTCACAAGCTTTGGAGATTGCAAACTCTTTG
GAAAGTTTTCTTAAAAACATACAAATCCAATTAACAAATATTCCAAAAGA
AAATATAAATGCTGAGAAAATTAATCAAATTATATCTGATTTACAGAGCT
ATCGAAATTCTGTAGAGAGTAAATTGCCTATGAAAGACAAACTATTGCTA
TTGGAGAAAGCTTTGATATCGGAGAGCGTTTCCACTAACGATTTGAATAC
AATAGATATCGAGAATTTATATGTTAAAACCGTGGAAGATGTCGACGACT
TCATTGGAATGATCAGTGAAATTGTCAAAATATACGACGAATTGAATGTA
AGATTAATGGAAGAAAATAGAATTTCAGAAGAAATTATAAATTCTGTCAC
TGTTTTACTGGACAAGGAAGTCACGAGAGAGCAATCATTATTATCAGAAA
GACCTGAAACTTTGAAGGCACTGAGACAGAAACTACTCGACCAGCATGTG
ACAGTAAAAGAATTGAGAAATGAAATAGAAAATGTGCACAGTGAAAAGTC
TCTGATCAGCGAAATGATCCCGACAGTACGGAAAATGGAATCTGATCTGG
AAACCAATTTGAAATTCGTCACGGAAAGAATCGATGAAATCAAATCCAAA
ATGGAAATAATGGATCAAGTGAATGTGCAAGCACAGGAATTGTCTAATAA
TCTCGATGGGATTGAAAAGGATATCCAATGTTTGAGGTCAGACAATAATT
TATCCCAGGAATTAATGTTTTGGGAGAGTAAAATTGAAAACCTCCAGGAT
ATCTCTCTGAACTTATCCGAGTGTGAGGGGAAACTGAATAGACTAATCGA
GGAGGTCAAAGGGAATGAAGTGGAAATTAATCCTACTGACCTCAAAGGTC
GAATACGCGAGAATGAAAGAACGATAAACAACCTCCTTCAAAACTGGCAA
CACATTCAAGCTATTTCAATGGAAAAGGAAAACATTTTAAATTTAATTAA
TTTCCTGGACAATAGAATAAAATTTGCTGAAATCTGTGAAAATGAAATCG
ACTTGCTGCAAAATGCTTTGAGAGATTTGCTAAAACTCAATGAAGATATT
CATTCACTGGATAATAAAATTCATACGATAAACTGTATAAAAATGACTGG
TCTATCCGTTGATGAGCAGTCGTACATCAATTTCATTGTTGGAGACTTAG
AAAGGAAATTGCTAGATTCCTCAACAAAAAAGAAACTAATTGGCGACAAT
CTTGATGAAAAGTTGAAACAGTTAACCCTGTTGAATGATATTCACATGGA
TGTTTTGAAAATCACCGGCGGGATATTCACGAATAGTTTGAGCAGCGCTG
ATGACTGTGACTCTCTTTTGTTGAGATTCGATGAAATGAAACTCAGACTC
GAGGATTTGAAACATCCGGAAGTCATTCGCGACAAAAAACCAATGATTGA
TCATCTTACTCAAGTTTTTCATGAAACCCACAACATCATTGAAGAGATAA
AAAATAGAATCACTTTGTTTGAATGTATTCAAAACGATATCGAGAGTTCC
GCGTTACAAATTCAAAATACCCAACAATTACTTCTTGATCCTCATTCAAT
TGCAGTTGACCAAATCGAAGACGACCTAGCAAACATAGAGAATCAACTAG
AAACCATACAAAGGAACCTTCAACGGAATTCGTTAAATTTAGACTTTTTT
CACAACGATTTACTCCATTTCATGTCAAACAATTTGCAAGAAAATCTTTC
TAGTCAAATTCAACGGCTCGATGACATAAAATTCGAGTTGAATGAACACG
TGAAATCATTGGAATCCCAACCGGAAGAGCGATTTGAACCGACCTTCATT
GAGAACCTTAATCGGGAAAGTAACTTTTCCTTTTTAATTGAAAACGATGA
AACTGAACTTCTCTCATCAGAAGCCGAAGCCTCGAAAAACCCATCAAATG
ATCTGGGGCTTGATGAGAATAGTATTAATACGACTTCGAGTTCGCATTTG
ACTCACAAGGAGGAATTGAATGAACTTTCCGGGTGGATTTCCACTGAAAT
GGATTCATTGAATAACATCGAGAAATCTTTAACCTTTCATAACCCTTCTA
TTTCTCTGATAAAGCCGCTTATTGAACAATTGGAATTGAAGAAAAATGAT
TTAAATTTGTTGGAGAATTCTATTTCCCAGTTGCGTGATAAGGAGTCGTT
TGCCAGTGAATTGCTACTGTTAAAGTCCAAACTGGCAGCATATGAAGATT
ATCTTTTGAATACTCTCGAATCAACAACAGACCTTGACAATCATCTTTCG
AATTTCCGACTACTCGCCGATTCGCTATTCGATTGGATGAGAAGAAGCCG
GGAAATGCTGGAGGGAGAGCTGACTCCCTTGCAACAGAAATCAACAGTGG
ACAAATTAAAAATCGAGTCTGATGAAATACAAATGACGAAAATTAAAAAA
TTAAAATCATTATTATGTGAAATTGACAAATTTGAAATAATTCAAGACAA
CGCAAACATTCAGACTTCTGTAAAAGCCTTGTTTGAGGAGGTCTTAGGAA
AATATGACGACTTAAACACTCAAATTATGGATCTCTACAACGACTCACCA
ATGAAAGAATTGGAGAATCTCATTGATGTCTGTGAAGAGTTTGTCTACGC
AATTTTCCCTAAATGGTACAAGGACCAACTCAGAAACACCATTGTCAGTG
GCAAGGAATGTATAATTCGCATTACAGAAAATCGAATGAAATTGGCATTT
ATTGAGGAAAATGCAGAGAAACTCAACAAATTAATAGAAAGATGTAAAGT
TCCTTGGTATAAAATCCAACTGGACCGTGATGTGAATATTCCTCCTCATG
ATATCAATGCAACGAATAATATTCTTCAAATTCGCCATGCAAAAGTTGTT
GCAAAAATGTTTGAAATATTTAAATCGTTGGAAAAGTGGATGATTATCTT
GGAAGATCTCAAAATAAAATGGCAGGAGCTAAATGCTAATCAAGATCAAT
TTCAGTATTGGTTAATTGAAATCGAAAAAGAGAGAGATTTGAGAGAAGGA
AAACCTCTTCATTTGAATGATAATTCTTTGAAAGAAAAAATAAATTTTTT
GAAGAACTTGAAAATAGAAATAGATAAAAATTCATCGGAATTAGTGAAAA
TGATGATGATTGATGATGAAGTAACGACAGCGACATTCTCTCCTCAATTG
AATAATGGAGAAAACCTTCGATCAACAAATACGCTAAGTGACAGAATCAA
CAATCAGTACACCCTTCTCACAAACAAGGTGCTGAACCAAATCGAAAAGT
GGCACAATATATTCGATAAAGTAGAAGTGTTCCATAAATCTGCCGATGAT
TTGAAAGAGGATTTCGTTCATCTGAAAGAACGAGTCCAGAAATTAGAAAC
ACAAGGTCCATTAACCAAAGACAAATTGAATTCTTTAAAAAACGTAGAGT
TGGCGTTGAATAGGATTTGGGCCAAATTTGAGTATTATCGTCAAGCAGCG
CATTCTTTATTCTTGCACCTAAGCGAGGCGGATAAGTTAATTTTAATTGA
AGATATCAGGCAATGGGAACAGAATATCAACGACCTAAAGGAATCTCTAT
ACACGAAAAATTCTTTCTTGATTCATTCAATGAACAATTATGCAGATTTG
TTGTATCAAATTGATGAAAATTTGTCAGCATTGGAACACTTGAGGAACAA
GTTGAAGAATTACGTTTTGCTACCCCTAGCACCGGAGTTGGTGGAAGAGA
AACAAATTGAATTCCAGCAACTCACGTCTGATATTGTTGATCAGGAACAA
CGAAATGAAATTATCAAAATTTCACTGGAGTGTTGCGTTGAAAATCTCAC
GAAACCAGAAATATTGAGGCTTCAAAGTGACTTGGATCGGTTGTTGAATA
TATTCTCGGCGGTGAAATCAGACGTGGAAAATACGCGTGTTTATATCGAC
CAAGTCTACAACCTGCGAAAGAATATTCATGAAATTCTTCACAAAATTGA
AATCAACCGCATTGAGAATTCGAGATTATCCGCATGTTTTCAACATCCAA
CCAATGACGAGTCGGCTCTAAATTCGAAATTGGAACTTTTGCTGAATTTG
AAAAACCTAATTGACCAACAGCAGAACAATATCAAGTATTTGGACGAATA
TTGGCATGATATTAGTATCAGCACGATAAATGAAGATCGAGACATGCTAG
AAAACAATATTAGAGATTGGAATACGTCCAACCAAGATCTGTTAACTCGA
ACGCGTCGAGAGGTGCAAACTACAGAAAAAATGATCAAGTATTACCAATC
ATGTTCCAACGACTTCAAAATAGTAAAAGCCTACGTCAATGAGCTCGATG
ATCATTTTCAACAAAATCATCCATTCAACATTAATTCATATTATTTCTTA
AAGAAAAAACAAAATCGTCTTGGTGAAACATTTACCGCTTTGAATCGAAT
TTTTGAAACTCTGGTTGAAAATGAGCGCTCTATTCCTGTTGAGTGCTACC
AGTCAATGTTTGATGATGCCATTCAATTGAAATCCCGCTTAATAAATCTG
GAAGAAAAGTTAGGTAGCGAAATTGAAATAAACGAGCAATCGTCTTTACC
TGTAGAAATAATAAATTGGAATGGAAAGCTTACTGATTTGATAGACCGTT
TTAATTATTTCAATCAACCGTTTCTCTGCGAAAATAACGAGATTATACTC
GTTGATATTAAGATCTTTTGAATGACATTTCTAGTTTCCATGAATATCTG
AGTTCGTTTGATGCGTCTGGCAAAGAATCGTTAATGGTAGCTCTCACTGA
AGTGAGCAATGAATTAACTGTCTTAGAAGGTAAGACCGGTGAAATATTTA
ATAATATATCCAAATCCCTTGAAAATCAAAAAACATACAATTCAATCAAG
GGAAATATTGAAGGCAATTGCTGAAATCAAAAATCACTTGGATATTACTG
AAATCCCTGGTGTATCGCTGGCGGCTAGAAATTACCGATACGAGTCGGAT
GGGCAATCACTGGGTAATATAAATGAAAATTTTGACCAACTATGTTCACT
TAGTCAAAAATTGACGGAAAATGGGGATGATAATTATAAAGAAAAGATTG
TTGGAGAATTGTTGATGATACGATCAAGTATTAACGAATTAACACAACAT
ATAGCAACAGCTAGTTTGCAAACAAAATCATCTATTAAAGAAAGAAAAAA
CTTGTTAGAAATGATTATGAAAGCATTAGAAAAACTAAAGTTGATGTCAG
ATTCGGTTTCAACTCCTGAAAAGGTCGGATTGGAAGTAAAAGATGTTGAT
CAAAGAATACAATTTTATCAATTGATGAAAACTCAATTTCTGGATCTGAT
TGAGCAATCGTCTGAATGGGTCGAATCTCTCAATGATGATTATAAATCAA
CGGAAGAAATTATTGAACTTGATATCAAGGAAAAATTAGAAAATTATTCC
GAATTCAAAGAAATTTTTCAAGAATATCATCCGAAAAAGGTTGCAGCTTT
ATATGGAGCACGAGAGACGAGAATAAGGATGAGTCGATTCAGGAAAGCGA
TTTCGGATTGGATTGAATCCGCAACTATTTTACGCAACAGAACAGAAGTT
CAAAGTGCCACAATCGACCGAAACCAGGGCATTCTAAAAAATCTGGACAT
TGTCGATAATTTAATGAATCTCGATTTGGGTAATTTGGAGGGAGAAAGAA
GCCAATTGAACATGATTTTTGGTGATGGGACATTTTGTCCTTGTGATGAA
GCTTACGAAAGTTACATTTCTCTTTGTGAGAATTTGATTCCTTATGTCGC
GGAAAATGATTCACTTTCATTAAAAAGTGATTTGACAAACTTATCAAGCT
CCATTGGTGAATTAAAGATATTTAACTCTAAAAGTTTGGAGAAAATTGGA
TTTTTGCAAGATCTATTGGAAACATTTAAAACTGATTGTGAACATTTGGA
TACACAAATGGACTCGATTGAAATATGCGTTATGAATATCAGCAAGAACT
TGAATGCAGTTGACTCTGAAGGTGAATTGACTCATCAAAACTTTGCTGCT
CTTACAATGACCGTGGACTATATCAGAGATAATCTGACACCAAGGTTGGA
CAGAATGTTCGGATCCTGCCAAAAGATGTATACGATTTGTAACCCTGCCA
GCCTTCAGGTAATCATAGACGATTATCAACATCGTAAAATCCGACTGAAA
GACACGGAGTCCAATTGCTGTCAGTTGACCGCTTTCATTGATAACCAATT
AAAATCTAAAACCACTGAAGATCTTCTGAATAATCGAGTGAAGGTCGAAT
TAACTAGCGCATCAGGAGCGATTTGGTCGGATGAATTTATAGAAAAAGAG
TCATCTAAACATATTTTGAACAACATTGAGGATATAAAAAGCCACCAAAG
AATTCTAACAGATCTGGAAGAAACAATAACTCTGAGTTGCAATGGCGCGG
ATTGCCTTCATAATCTCAATTCTTCTCAAACCGGCCATCAACAGTTGATG
TTTGAGCAAATTGAAAAGGTGAAAAACAGTTTGAATTTGTGCTTGTTGAA
GTGCGAAGACGAGGTCGATTTCAGAAATCAAATTAATCTATTTAAACAAC
AAATTTCACCGCAATTATCTGAACTCAACCAATCATTCGATTATCCAATT
GACATCAAGCAATTGGCGGAAATAGCTGACAACTTTCGCAATGTATTTCT
AAAGGTTTGTCGATTTCAAGACGAAGTAAGACAGCATTACCAATACGGGA
GCGACCGAAATTCTGCAATTCTATTCGATGTTATTCAGTCGTGTCAAAGT
GTGAAATCAAAAATCAAAAGCGTTCTGGAAGTCACTGATATGAATAATGT
CGATTCTGATGTGCTTTTGAACATTACTGAGCTGATTGGTGAATTTGATG
AGGATGAAAAGACGACTACTCAGATCAGGGACGTTGATCTCATGTCTGAT
ATGTCTCTTCATTCGAGCCTGTCTGATACGGATCATGAGGCCATTGTCAC
AGATTGGCTGGTTTCAGCTCGTCGGATTTTGAAAGAAACGTATTTTGAAG
ATGTCAATGATTTAGTATTGAAAATCGAAGAATCAAATCAATTATTGGAG
TGGGATGTCAATAAAAACATTGAAAAAATTCTTCAATCTTCTGAAAGTTC
AGATAGATCTACAGAAGTCATTGGTGAATATCGGAATACTCGTGAACATT
TGCACCGGAGTCTGAATGATTTTATGTTGAAATCTATGAAGTACAACGAA
TGCGTATTGGCAGCTCATAAATGTTTCCAGTGGTTGGATATCAGTGATAT
TCAAATGGCAGATGCCGATGAAAAGACGAGGAAATTGAACAGGTGTATCA
TGGAAAAGAAAATATCGAACAGTTGCTATTGGACCTCCAAGACGGTGATC
ATTTCAGAGCAAAACCGGCAATTATTGTAAACGTTTTATCGAATTTGAGT
GCCGAGATCGAAAGATTATGTGAAGAATCGTTGACGAACACAAAAACATT
TGATTGTGAGGAAAGTAGTTTTCCGAATGCAATAAAGAAGCCAACCACAT
CACTTGATATTAACGATGACACGTACGAAGAATATTTACAAAAAAATTAT
GATAATCAAGGAGATTCTGGCTCGAAAGATTTTAGTGATATTCCTTTTAA
AAAGCTGAAGACAAACGAGTTAAGCCTTTCCGAGTCAATGTTGACAGAAG
ATACGTCTATTAAATTCAATCAAGATTCTTCGACGGGGGTCAATTTTGCA
GACTCCAAATACAATTCCAATGAATATGGCAGTGAAAATAACGGCCAGTT
ATCAAACGGGATAGATGACAATGAATCAAGGCTCTCGTCTATCGGTGACT
ATTCGAGCACTGAGACTGAGTCCATTTGCATAGATTCAAATGAATCCGGC
AATGACGACGCAAATGAAAATAGGATAATTACAAATTTGAAATCTTCTTC
CAATGTTAATGATCTTTACTTCACTCCATTTCAAGCAAATGATGACTTTT
CCACTGATATTAAACAAGAAAATGAAGATGCTGCGAACCAAAAGGCTCTA
AACTCGAACAATAATGCTGTTGAAAGTAAAAATGAAAATCCGGCAATCGA
ACTGGAAATTTACGAAAATGTTCCGGGAATTGAAGGAAATGAAAAAAAAT
CTGTTTTCGATACTTTGTCTGTGGATGTCAATCCAGCTGAACTGTTGAAT
GCTGGAGGTCACTTGCAGAGTGGAAATGCTTATAATCAGGAATTTGAAAT
TTCACACCGGGATAATCTATCAAAAGAATCAAAGTGTTTGGAAACAAATC
TTAACAAAGAACCTACCGATTCCATAAATGAGAAATCAGGATTTCAAAAT
AATTTTAGTAAAATCTCCGATAATAATTATGCAAATGAGGAATTTACTGA
TGAGATGTTGACAGAAAGAGACAATTTGTTTTATTCTGAAGACGAAGACG
ATTTTATTTCAACCGAAGAACGAATAGAATGTGAAATTATTCCTTTGACC
AAAACGTCAGTGGGATTTAACTTCGAAATTGAAACTACGGCGGATGGAAT
TATAAATAAAGAAGTTTATAACGAAGAAGATTTAGCCGCTCGCTTTAAAG
ATCTGGATATCTATAGAAAGGAAATTGGGAATGAAAATTTCGACCGCTCA
AATAAGAAAGAACTTAATGATAATCAGGAAATAGATTCGCTTCTCATAGA
CAAAAGCGTGGATTTGGACATTGAATCCATTAAACAAGATTCAGTAGAAC
TAATTGAAAACGACAGTCCTTTGGTTGTTGAACTCGCGCATCCACTGGAA
ATGATGTTAGAAAGGAAAATATCGTTGCCTGATATCAAGACTCATTTCGA
CAATTTGGAAAATTCGGATGGCAATATTGAGAAAGATATTCAAATTAATT
TCAAAGTGGAAAATAATGATAGTAAAGAAAATATGGAATTCATTGAGAAA
GATCAGAAATCTTTGGATGAAAATCTTTTGATGGAAAATGACAATTCATC
TGAAAGGAAGCCAGATGGTTCAGAGGATGGAATTCAAGATAAGGATTCTG
AATTGAGCAATACTGACAACTTAGTTGAAATTGGTAAATCTCCTGTGGAA
ATCCCAAAACTTTTGATAAAAAAAGTTGATGTTATTATGAAAGATCAGAA
ATCCGTTATCACAATGGAAGATTCACCCGAAATGTCATTGATATTATCAC
CTGAAAGGAATAGTTTAGAAAAGGATGAAATAGATCCTTCTAAATTGAAG
GATGCTGACATTTTAGTAACAGGTCTCGGTTTGGATATGGTCTCAGTGAT
GAGTGATTCTGACTATTATACCGCTACAACAGGCACTGGCGATCCTTTGA
ATACTTACAATATGTTACTTTCGTGTTCATCAAACGTTGATGAAAGTGAA
AAAGTAGATTCCTATAGTAAACTTAAACCTCCTGTAGAGATTGATGAAAC
TATAGTGAAAGATTTTGATTATGTGATCTCTAAGGCACCAGAGGATCAAA
ATGATGATTTGGATATTAACAAGAATGAAACTTTAATTCTTAGTGATTTT
GAGAAAGACAAAGATAAAGATTCATTTATGAAAGATCAGAAGTATTTGAC
GGCAAAAGGCGATTTGTCTGAAATTCCATTGGTATCTACCTCTGAAAGGA
ATGCATTGCCAATGGATGAATTGAAGCCATTCGATCCATCAAAAGAAATT
ATAAATCTCCAGGAAATAGAAAGCCGATTTCATGAAGGTACAAATGAAGG
AACTGAAAATGAAAACAATGATATGGCCACAGTTATAAGTGATCCAATAA
ATGTTAATTATAAGTCAGTGAACAGCGAATGCGGAGATCCTGACTATAAT
ACCGCAACAGCCGCTGTTGATCCTTTGAATACTGGCAACACATCATATTT
TTGTTCATCAAACGCAGGTGACAGTGGTTCATTTTCTGATATATCTAAGA
CGGCTTTAAAAGAAGATAATGTTACATTTATGGCAGAGGATGAAGTAGAA
AAACAATATGAGATTAAATATTCTGAGACTACATTGCTCCTTGAACCTGA
AAGGAAAACTTTAGGAAGTATAGAAGAGAATCCAGTCGATCAGTTGAATG
AGAATGGAAATATATTTTTAGAAGGAATAGATACATTTACAGAACGAGAT
CTAAATATCAAAGGCAGCGCTGCTCAAACTGATAACACAGAATATGCTGT
GGATTGTGAATCAGCAGAAACAGAAAATCGAATGGTAGAAAGTCCTGATA
ATACTCGAAAACCAGATTTAGAGAATAAAGAAAAGGACAATATTGTTAAT
TCCAATTACATAAATGATAGCTTCCACTTAACAATGGAAAGTTCAATTCA
CGACAAAGATCCATTAATGCAAAATATTGAAGGTGAGATGAGTTCTTTAG
CCCCAAAATTAAGTGATAGTGCTTTCTCTCGTTGTCACCGTTCATCAAGT
GGAGGAGATTTAGACTATGTTAGTAATCCGGAATTTGACATTCATGAAGG
TTCTCAGAATGTAGGAGATACAAAATTAAACTTATCAGAATCTACAGGTG
ATGACAGTTATCGAAGTAGGAGCCCATTGTTTGAAATTGAATCTGAAATA
ATTCCAACAGAAGTTGGAATTCAAAGAATTCAAAGGGATAATAAATCAAA
AGAATTAAAAACTAATGAAGAGTTAAGTCAAGGGAACTTTGATGAAGATT
CTGAAATTTCAATTAGAAACGAGAAAACTTACTTTAAAAAAGTGGATTAT
GAAAATATCAAGCACGGTCAAAGAATCTCAGAAAATTTTACATTTTCTTA
TTTTATTCCAATGAAAATTGATCCAAACGAAAGACAATACAAACCACCCC
CCTCTACCGATGAAGATTCTGTGGAAGAAGTCAAGCAAAGTACATGCAAG
CTCAATTATAAACGAATATTAGCTAATAATCCATTATTGAAGAAAAAGAA
AAGACTTAATAAATGTCGATTTAAAAAATACCCTTCATAATTTGATTAAA
AATATTCCAATTAATATAATTTAGGAACCTTTTGATGCCCATTTATTATG
AAATTTATTGTATGAAATATTTAGTAGTG
back to top

protein sequence of SMED30015584-orf-1

>SMED30015584-orf-1 ID=SMED30015584-orf-1|Name=SMED30015584-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=772bp
MIRSSINELTQHIATASLQTKSSIKERKNLLEMIMKALEKLKLMSDSVST
PEKVGLEVKDVDQRIQFYQLMKTQFLDLIEQSSEWVESLNDDYKSTEEII
ELDIKEKLENYSEFKEIFQEYHPKKVAALYGARETRIRMSRFRKAISDWI
ESATILRNRTEVQSATIDRNQGILKNLDIVDNLMNLDLGNLEGERSQLNM
IFGDGTFCPCDEAYESYISLCENLIPYVAENDSLSLKSDLTNLSSSIGEL
KIFNSKSLEKIGFLQDLLETFKTDCEHLDTQMDSIEICVMNISKNLNAVD
SEGELTHQNFAALTMTVDYIRDNLTPRLDRMFGSCQKMYTICNPASLQVI
IDDYQHRKIRLKDTESNCCQLTAFIDNQLKSKTTEDLLNNRVKVELTSAS
GAIWSDEFIEKESSKHILNNIEDIKSHQRILTDLEETITLSCNGADCLHN
LNSSQTGHQQLMFEQIEKVKNSLNLCLLKCEDEVDFRNQINLFKQQISPQ
LSELNQSFDYPIDIKQLAEIADNFRNVFLKVCRFQDEVRQHYQYGSDRNS
AILFDVIQSCQSVKSKIKSVLEVTDMNNVDSDVLLNITELIGEFDEDEKT
TTQIRDVDLMSDMSLHSSLSDTDHEAIVTDWLVSARRILKETYFEDVNDL
VLKIEESNQLLEWDVNKNIEKILQSSESSDRSTEVIGEYRNTREHLHRSL
NDFMLKSMKYNECVLAAHKCFQWLDISDIQMADADEKTRKLNRCIMEKKI
SNSCYWTSKTVIISEQNRQLL*
back to top

protein sequence of SMED30015584-orf-2

>SMED30015584-orf-2 ID=SMED30015584-orf-2|Name=SMED30015584-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1101bp
MLTEDTSIKFNQDSSTGVNFADSKYNSNEYGSENNGQLSNGIDDNESRLS
SIGDYSSTETESICIDSNESGNDDANENRIITNLKSSSNVNDLYFTPFQA
NDDFSTDIKQENEDAANQKALNSNNNAVESKNENPAIELEIYENVPGIEG
NEKKSVFDTLSVDVNPAELLNAGGHLQSGNAYNQEFEISHRDNLSKESKC
LETNLNKEPTDSINEKSGFQNNFSKISDNNYANEEFTDEMLTERDNLFYS
EDEDDFISTEERIECEIIPLTKTSVGFNFEIETTADGIINKEVYNEEDLA
ARFKDLDIYRKEIGNENFDRSNKKELNDNQEIDSLLIDKSVDLDIESIKQ
DSVELIENDSPLVVELAHPLEMMLERKISLPDIKTHFDNLENSDGNIEKD
IQINFKVENNDSKENMEFIEKDQKSLDENLLMENDNSSERKPDGSEDGIQ
DKDSELSNTDNLVEIGKSPVEIPKLLIKKVDVIMKDQKSVITMEDSPEMS
LILSPERNSLEKDEIDPSKLKDADILVTGLGLDMVSVMSDSDYYTATTGT
GDPLNTYNMLLSCSSNVDESEKVDSYSKLKPPVEIDETIVKDFDYVISKA
PEDQNDDLDINKNETLILSDFEKDKDKDSFMKDQKYLTAKGDLSEIPLVS
TSERNALPMDELKPFDPSKEIINLQEIESRFHEGTNEGTENENNDMATVI
SDPINVNYKSVNSECGDPDYNTATAAVDPLNTGNTSYFCSSNAGDSGSFS
DISKTALKEDNVTFMAEDEVEKQYEIKYSETTLLLEPERKTLGSIEENPV
DQLNENGNIFLEGIDTFTERDLNIKGSAAQTDNTEYAVDCESAETENRMV
ESPDNTRKPDLENKEKDNIVNSNYINDSFHLTMESSIHDKDPLMQNIEGE
MSSLAPKLSDSAFSRCHRSSSGGDLDYVSNPEFDIHEGSQNVGDTKLNLS
ESTGDDSYRSRSPLFEIESEIIPTEVGIQRIQRDNKSKELKTNEELSQGN
FDEDSEISIRNEKTYFKKVDYENIKHGQRISENFTFSYFIPMKIDPNERQ
YKPPPSTDEDSVEEVKQSTCKLNYKRILANNPLLKKKKRLNKCRFKKYPS
*
back to top

protein sequence of SMED30015584-orf-3

>SMED30015584-orf-3 ID=SMED30015584-orf-3|Name=SMED30015584-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=5762bp
MQIGNIIRKYKDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGL
MLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYLSERKIKLVNINP
SDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASD
KGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDM
KIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQ
FLELTITRPESPRKKLKLSMPEPAKSNERGVNDKIKRFIINVKESRIEKL
KQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQDFKAAKRLVLS
CQWLLDESVNNGWKNLCKWLISSERILEFHKNNQIDVSKEISPELLDDLT
VQIKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQK
VVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLL
DFESAMANGNFVAIVTEMINDIEKLLSADPTFKEWAQEFKYHISDIEREI
KYIETSLRTYIEEWHKMEELYNETVDWMNSTDDFSISPQEYISRKHKIAE
MEKNIAFLSEQSSDSGKETLSRKLEYINLNFSRFHENKSLHVDNLRKEYK
IKVENIKKWLEKSEALESLDINFSTDSVNEYVQILVESNKTSENVKEDFK
DLSKIGQVISRTCSKEETERMLGELKIQKIRLLTLIEDRPKLIKKLSSLC
EILNKCDSLLSNVDQAVGEIERELAEMLTNFQSKANQQQEMFLGEINVAL
ESIKSKEQLLTNLKVYIAEIESLKVSNFPLKPIYARENETIEKLNNLRSF
ALLVSKKIQESSWLTPFKSRLETWIEETTSNLAILKNLETDSVNSLLENS
LAMKDSMRIALDEILLKIQESDDDELKDEGNNLQSEFNKISSQLSEAESY
RKFRILENKCIEFIKNIETQLDEEEMLVKHANLDKIQEIIYKHNVYFEEC
DFKVTSLSYLSEMKTLLENFPKNQAILSKAEMLERQCEDLSKRIDTVGSD
LSNSENSLREKKEKISKLNELVINFTNVSSNLDLSDLNVTSDQYDMVLNK
FCSLIPDVDNMKEVALELRNDGILSQEDIFEETISNFESIAPSVESLKRR
GSNISDAIKLKEEAENEAEKLQDLQAKLRLFNSITIGEELILLGELRQQE
RVVEQIQELRKEIIENTGMKFTELELKDPTVALMVLPTIENLQLLCELAE
SQSVELLSHNSHIVNTKLSIKKEMDTLEAKIMNLQEAIVPSTFENEQIHP
TILEAQMSIDFINESQSQFESQLSKDYTDFLSNFCKEKSEELEQIQQDAA
RKSNRKNVEKILRNCISHIELDLTNFDKFIYKIPLEKAKTILIEEKRICE
NAIKSNVDRLDHDLGEIVISHGDLNGEVRGIDLSEDASKVLVKVQTFSEQ
SNSLQKRLLDIQTVEDVRAWKDAWCELGNNIHSLCQSIDNIQSLLNYSNP
SLKAELSLEKIDEIFTKIELLESNFDKQNVKIQSQLSRINEFESSIEGSI
VSDMNQLLEYKEALSKYSEVINEIKQEEIIPFELKEFVTNLNENPGIELV
VNQISKIRHNIESKVGMILDQENEKNSQIVNEVSLQLYDEFTETDNQLDA
RETISVLESSRIRLETLKTNTEALKSLSEKFGHYLSYEKTNKQINKTLKD
CMEILDLCGAKIDVMEHCRSFVDQLNELEERVNRISEPLNDKEEIILDKI
TEINALKQNIMLLGESLVNLRERFSTNQIVICSAIEERYENLKSQSQSIE
TILDKKIKLLNEDKKRLDLLLNQRIEVSNNVEELIKSLDQIQWNSSDQMS
IEHNYTVIQQLSDQFNDQITIINYCKQNLPGENFTEIENEIEIFQLKLAN
NNKKYEEQIDLISNVVEKSKCASLCFTLHSDPNSEVDVSNLIKNTMENTH
DKLKSIELLKRKVDEQFESDDGELLQLLDRKQSQLANDLELIRSVSENHN
SLIDLSGEVNSISNKIDKSIGTLKSILKSPEKSIIDVEGILEHTNCNLEK
IMKIQTRQPILETPVSKEILSKIQEKLSKDINEVIHVTQSSLDPIHSLMS
QYQRLKTDGDKCSDEVHYLEQMVTDNMGMPMIQEQLEHIDHITTTLCSIY
DQVETNKQVFGIREICELSDHCISNKDKLNQIKYKILKQQEQIMKDQEQL
ETLTNQFNNIKADTLKKLSDFGSELHLKETVLSLDSLENTLCFGKEKIDL
LKGIAMNIKNFNSEISMDCAKQVEEMEILLVDLDKSFMEIGEVIKVGNNR
VNEIKEKYENLLARLDLESENVDFDFDEITGAIENCHVLKTELIETINGN
YFKFEEVNDLLNRTVPINNDIDSLISRLELKLNVEQENQNQFINTKDILI
AKSEDIRSIIERINQLVTELSKDLQSSNLEIKNVVNVLDIIQKDVERLLY
IQSNELNLSSPVLNNEIVNLQTSISHEIAECTQSTQSFYNSIDNALGKYR
RLKQQCDQYSDEIDFLQHEFLAEMDLEVLSKRLDEVNNLVQNENHLKDEI
EVCKKVLNILETVGLHDECEGQIKALNGLHQNIEAQIKIINTDKQRLVEL
ITYFTEIRNCAEESLTDFMVKVNNKKELLSLEKMSTITMKAIDSLDILNE
TKEKIKEYDLPESINKEIDIKNLSESLSEFKVNFNNITKIVEDGNKSLQE
LNEEYQELLIQSDVEKAEKNKNDFLEILKSKKDRIENLDKRLGFIINKIY
PNFEEVNEVIRKTKLLDSNISQLSQSINSQLEIETEKQMIFNNLKNKLIN
ISEEVKLIYQKILKTLNLIHKSSHSSMEEIELLIDNIEQDVAQLISIQLH
KLNITSPVFFDNQISQIQQTISSEITKYVDDTKTSINHIRESIRQFLSCR
EDLTKLSDESHFLQLESLSDSNMASFDNRLKEIENLLENLEDICDRVDNL
KPNFNCSEIEDLYNKITDLKLKLQELSTKTKDLQETNRINEEKLKNLLLI
FQENAEKISAQLQMILDKSIDESACLNLKDTENCLCEFNNAADTLNGIID
NIGQLNNSSADKCRLRLDSLKLLNADLTNLYNNVDNIVKEKSTELNKIDS
EYEALIKIDDFGMLKNLELKRDQLKELKDQMSMFNRIDQLNFKEIRHLEL
KTTNIIDKIDSSIEYLNGKIETEQSKEELLSQIDSELDENLKMITILFSR
LRSTESTITIEEIDEMLHNISENMKIVIEEINDEILNQCPVPDEISKKIN
EINDKRVQLSGISLEIKENLKNNIQTLNFYKPLIDCHNSTLIKFSESSEL
SEDNSSTIEDISRQLIQSKDSLLALSESPSEYICKDKADFDESKSIEIEN
INNLLNKVQMLSDKFQFEKSKKEFLDELGKVKCENDSLKELIESGDPNLS
NEEILNRIDRNIFAISDLEINYQDNPIVAEYLQRMIDYKHIAEGIKNQFN
HYLSVLGNHGTFIDNIDQVLRQVKEQLNTDDLQSADDPTARMEKLTDLKN
QLKYPELPIENKSKESEILLVKLQNINENIQQLSKEISKKEQHEKIKGKL
NEIHRILKVFIENNIENPLKDINNYFSQSNSLMESVLRDVSEIDPETDRA
QELISEINSQKCLISQVEESIGDLYGQMKTGAAIYGEHCQKIKDWTARKP
IENFNDIINFKSLFKEHLKNLICWKKNLEPKIRCQDLSDLVKKLDDSINE
TITILENLECEEKKMRIESEMLTVLEAINTDITQLEQGGKGENKASFSKR
EIDENLSAIKNNLSIIQTQIDENEANMIDEKLKSSFLCTSNRVVQLDKTF
EEKLQILSQLDIEKESIIQNLPTYEGVIDDTNEIRDLLTHLDNVTDIISK
LTDIGIRYQEEGLQCIERTDSMSNVHAELANINHAKLLLEAKIKSKLERE
AAFSDIKVFLGEIEKRLDNFKISLQMDNQDVPLANIEQTLGDIEKDFLNL
QTPELLDETEFEEVIRDIGQNINTNKEYLLTLSQEITDKENVQKDLENQF
NNCTNLKQFIPIDLVTQYKNHQSNFNQYERWRLLNCELCKEVKDLETEIH
CREVHNLKEDIDRLGNNIKTIMTSEEGKIKETIEKLQENLERAKIEQETW
LKEMIKTLQNSTQSSNLVPTIIQSKKEALESLIGSLETGHGLIDKIFELE
EQMKEINSEFSDNQCTHRDRKASVIQYMELIQESQRRFADIADKYSQALE
IANSLESFLKNIQIQLTNIPKENINAEKINQIISDLQSYRNSVESKLPMK
DKLLLLEKALISESVSTNDLNTIDIENLYVKTVEDVDDFIGMISEIVKIY
DELNVRLMEENRISEEIINSVTVLLDKEVTREQSLLSERPETLKALRQKL
LDQHVTVKELRNEIENVHSEKSLISEMIPTVRKMESDLETNLKFVTERID
EIKSKMEIMDQVNVQAQELSNNLDGIEKDIQCLRSDNNLSQELMFWESKI
ENLQDISLNLSECEGKLNRLIEEVKGNEVEINPTDLKGRIRENERTINNL
LQNWQHIQAISMEKENILNLINFLDNRIKFAEICENEIDLLQNALRDLLK
LNEDIHSLDNKIHTINCIKMTGLSVDEQSYINFIVGDLERKLLDSSTKKK
LIGDNLDEKLKQLTLLNDIHMDVLKITGGIFTNSLSSADDCDSLLLRFDE
MKLRLEDLKHPEVIRDKKPMIDHLTQVFHETHNIIEEIKNRITLFECIQN
DIESSALQIQNTQQLLLDPHSIAVDQIEDDLANIENQLETIQRNLQRNSL
NLDFFHNDLLHFMSNNLQENLSSQIQRLDDIKFELNEHVKSLESQPEERF
EPTFIENLNRESNFSFLIENDETELLSSEAEASKNPSNDLGLDENSINTT
SSSHLTHKEELNELSGWISTEMDSLNNIEKSLTFHNPSISLIKPLIEQLE
LKKNDLNLLENSISQLRDKESFASELLLLKSKLAAYEDYLLNTLESTTDL
DNHLSNFRLLADSLFDWMRRSREMLEGELTPLQQKSTVDKLKIESDEIQM
TKIKKLKSLLCEIDKFEIIQDNANIQTSVKALFEEVLGKYDDLNTQIMDL
YNDSPMKELENLIDVCEEFVYAIFPKWYKDQLRNTIVSGKECIIRITENR
MKLAFIEENAEKLNKLIERCKVPWYKIQLDRDVNIPPHDINATNNILQIR
HAKVVAKMFEIFKSLEKWMIILEDLKIKWQELNANQDQFQYWLIEIEKER
DLREGKPLHLNDNSLKEKINFLKNLKIEIDKNSSELVKMMMIDDEVTTAT
FSPQLNNGENLRSTNTLSDRINNQYTLLTNKVLNQIEKWHNIFDKVEVFH
KSADDLKEDFVHLKERVQKLETQGPLTKDKLNSLKNVELALNRIWAKFEY
YRQAAHSLFLHLSEADKLILIEDIRQWEQNINDLKESLYTKNSFLIHSMN
NYADLLYQIDENLSALEHLRNKLKNYVLLPLAPELVEEKQIEFQQLTSDI
VDQEQRNEIIKISLECCVENLTKPEILRLQSDLDRLLNIFSAVKSDVENT
RVYIDQVYNLRKNIHEILHKIEINRIENSRLSACFQHPTNDESALNSKLE
LLLNLKNLIDQQQNNIKYLDEYWHDISISTINEDRDMLENNIRDWNTSNQ
DLLTRTRREVQTTEKMIKYYQSCSNDFKIVKAYVNELDDHFQQNHPFNIN
SYYFLKKKQNRLGETFTALNRIFETLVENERSIPVECYQSMFDDAIQLKS
RLINLEEKLGSEIEINEQSSLPVEIINWNGKLTDLIDRFNYFNQPFLCEN
NEIILVDIKIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR001715CH-domain
IPR001589Actinin_actin-bd_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0005200structural constituent of cytoskeleton
GO:0030506ankyrin binding
GO:0046982protein heterodimerization activity
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005938cell cortex
GO:0008091spectrin
GO:0009986cell surface
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0030863cortical cytoskeleton
GO:0043234protein complex
Vocabulary: biological process
TermDefinition
GO:0006779porphyrin-containing compound biosynthetic process
GO:0007009plasma membrane organization
GO:0007010cytoskeleton organization
GO:0030097hemopoiesis
GO:0051693actin filament capping
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 4385..4405
NoneNo IPR availableCOILSCoilCoilcoord: 2294..2321
NoneNo IPR availableCOILSCoilCoilcoord: 5545..5565
NoneNo IPR availableCOILSCoilCoilcoord: 964..984
NoneNo IPR availableCOILSCoilCoilcoord: 3117..3137
NoneNo IPR availableCOILSCoilCoilcoord: 1335..1355
NoneNo IPR availableCOILSCoilCoilcoord: 5436..5456
NoneNo IPR availableCOILSCoilCoilcoord: 1557..1577
NoneNo IPR availableCOILSCoilCoilcoord: 1023..1071
NoneNo IPR availableCOILSCoilCoilcoord: 2526..2546
NoneNo IPR availableCOILSCoilCoilcoord: 3509..3543
NoneNo IPR availableCOILSCoilCoilcoord: 2492..2519
NoneNo IPR availableCOILSCoilCoilcoord: 1753..1773
NoneNo IPR availableCOILSCoilCoilcoord: 2827..2847
NoneNo IPR availableCOILSCoilCoilcoord: 1267..1287
NoneNo IPR availableCOILSCoilCoilcoord: 2410..2430
NoneNo IPR availableCOILSCoilCoilcoord: 1196..1216
NoneNo IPR availableCOILSCoilCoilcoord: 3070..3090
NoneNo IPR availableCOILSCoilCoilcoord: 2923..2950
NoneNo IPR availableCOILSCoilCoilcoord: 2959..2993
NoneNo IPR availableCOILSCoilCoilcoord: 4531..4561
NoneNo IPR availableCOILSCoilCoilcoord: 5367..5387
NoneNo IPR availableCOILSCoilCoilcoord: 4343..4377
NoneNo IPR availableCOILSCoilCoilcoord: 5303..5323
NoneNo IPR availableCOILSCoilCoilcoord: 4724..4751
NoneNo IPR availableCOILSCoilCoilcoord: 3691..3711
NoneNo IPR availableCOILSCoilCoilcoord: 2186..2213
NoneNo IPR availableCOILSCoilCoilcoord: 3756..3776
NoneNo IPR availableCOILSCoilCoilcoord: 4899..4919
NoneNo IPR availableCOILSCoilCoilcoord: 4409..4436
NoneNo IPR availableCOILSCoilCoilcoord: 3979..3999
NoneNo IPR availableCOILSCoilCoilcoord: 1154..1181
NoneNo IPR availableCOILSCoilCoilcoord: 4076..4103
NoneNo IPR availableCOILSCoilCoilcoord: 2691..2741
NoneNo IPR availableCOILSCoilCoilcoord: 4453..4480
NoneNo IPR availableCOILSCoilCoilcoord: 642..662
NoneNo IPR availablePANTHERPTHR23167:SF28CALMINcoord: 8..343
NoneNo IPR availablePANTHERPTHR23167FAMILY NOT NAMEDcoord: 8..343
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 153..251
e-value: 2.2E-17
score: 73.8
coord: 18..121
e-value: 5.8E-18
score: 75.7
IPR001715Calponin homology domainPFAMPF00307CHcoord: 155..252
e-value: 1.6E-15
score: 57.2
coord: 18..123
e-value: 5.7E-19
score: 68.3
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 151..256
score: 19.957
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 16..123
score: 22.783
IPR001715Calponin homology domainCDDcd00014CHcoord: 17..123
e-value: 7.58476E-14
score: 68.8767
IPR001715Calponin homology domainCDDcd00014CHcoord: 154..251
e-value: 1.07641E-13
score: 68.4915
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 141..261
e-value: 9.0E-33
score: 114.6
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 1..128
e-value: 2.7E-38
score: 132.6
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 6..252
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00019ACTININ_1coord: 18..27
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00020ACTININ_2coord: 95..119