F-box and WD-40 domain-containing protein 1/11

Overview
NameF-box and WD-40 domain-containing protein 1/11
Smed IDSMED30015580
Length (bp)2418
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-box and WD-40 domain-containing protein 1/11 (SMED30015580) t-SNE clustered cells

Violin plots show distribution of expression levels for F-box and WD-40 domain-containing protein 1/11 (SMED30015580) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-box and WD-40 domain-containing protein 1/11 (SMED30015580) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-box and WD-40 domain-containing protein 1/11 (SMED30015580) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015580

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015580h1SMcG0018869 SmedASXL_011954SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015580h1SMcG0018869 dd_Smed_v4_14791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015580h1SMcG0018869 dd_Smed_v4_14791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015580h1SMcG0018869 dd_Smed_v4_14791_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015580h1SMcG0018869 dd_Smed_v6_14791_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Human
Match: FBXW11 (F-box and WD repeat domain containing 11 [Source:HGNC Symbol;Acc:HGNC:13607])

HSP 1 Score: 59.6918 bits (143), Expect = 3.864e-13
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L FS+ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  309 AVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 504          

HSP 2 Score: 36.1946 bits (82), Expect = 3.864e-13
Identity = 22/84 (26.19%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    ++E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  223 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH 306          

HSP 3 Score: 51.9878 bits (123), Expect = 3.809e-6
Identity = 60/256 (23.44%), Postives = 113/256 (44.14%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  + +   +K+L GH GS+  L+  +        S D T+R+  +  G  L+ L+           ++ +R   +  L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  226 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KTSLECLKVLTGHTGSVLCLQYDERVIVT--GSSDSTVRVWDVNTGEVLNTLI------HHNEAVLHLRF--SNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 460          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Human
Match: FBXW11 (F-box and WD repeat domain containing 11 [Source:HGNC Symbol;Acc:HGNC:13607])

HSP 1 Score: 59.3066 bits (142), Expect = 5.023e-13
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L FS+ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  288 AVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 483          

HSP 2 Score: 35.8094 bits (81), Expect = 5.023e-13
Identity = 22/84 (26.19%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    ++E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  202 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH 285          

HSP 3 Score: 51.9878 bits (123), Expect = 4.337e-6
Identity = 60/256 (23.44%), Postives = 113/256 (44.14%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  + +   +K+L GH GS+  L+  +        S D T+R+  +  G  L+ L+           ++ +R   +  L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  205 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KTSLECLKVLTGHTGSVLCLQYDERVIVT--GSSDSTVRVWDVNTGEVLNTLI------HHNEAVLHLRF--SNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 439          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Human
Match: FBXW11 (F-box and WD repeat domain containing 11 [Source:HGNC Symbol;Acc:HGNC:13607])

HSP 1 Score: 59.3066 bits (142), Expect = 5.950e-13
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L FS+ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  322 AVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 517          

HSP 2 Score: 35.8094 bits (81), Expect = 5.950e-13
Identity = 22/84 (26.19%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    ++E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  236 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH 319          

HSP 3 Score: 51.6026 bits (122), Expect = 5.134e-6
Identity = 60/256 (23.44%), Postives = 113/256 (44.14%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  + +   +K+L GH GS+  L+  +        S D T+R+  +  G  L+ L+           ++ +R   +  L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  239 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KTSLECLKVLTGHTGSVLCLQYDERVIVT--GSSDSTVRVWDVNTGEVLNTLI------HHNEAVLHLRF--SNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 473          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Human
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 53.1434 bits (126), Expect = 2.383e-11
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  349 AVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 496          

HSP 2 Score: 36.5798 bits (83), Expect = 2.383e-11
Identity = 23/84 (27.38%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  263 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHH 346          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Human
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 52.7582 bits (125), Expect = 3.137e-11
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  385 AVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 532          

HSP 2 Score: 36.5798 bits (83), Expect = 3.137e-11
Identity = 23/84 (27.38%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  299 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHH 382          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 55.8398 bits (133), Expect = 1.226e-12
Identity = 42/171 (24.56%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEI 2121
            AV  L F++ I+V+   D SI VW +   ++ ++ ++L GH  ++  +           AS D T+++ SM     D L  ++++     GI  ++      L+ +G  D TIRL D+    C+  +   +++++C+ F    ++SG + G ++ W+   ++   A  +EI
Sbjct:  304 AVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVS--ASGDRTIKVWSM-----DTLEFVRTLAGHRRGIACLQYRG--RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEI 465          

HSP 2 Score: 36.965 bits (84), Expect = 1.226e-12
Identity = 15/44 (34.09%), Postives = 25/44 (56.82%), Query Frame = 2
Query: 1436 LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            L+GH   V  +++D   + S S D ++R+WD  +G  I+ L  H
Sbjct:  258 LSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHH 301          

HSP 3 Score: 50.447 bits (119), Expect = 5.602e-6
Identity = 60/255 (23.53%), Postives = 113/255 (44.31%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDM--DRLDCIYNI--GYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    +VSG  D +I +W   +++S  +IL GH GS+  L+           S D T+R+     + ++    IK++      ++ +R      ++ T   D++I + DM   R   I  +  G++   +  + F    ++S      ++ W+ +   F         V T       I  L Y  R + +  +D +I+ W + S  C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  221 NSKGVYCLQYDDDKIVSGLRDNTIKIWD-RKDYSCSRILSGHTGSVLCLQYDNRVIIS--GSSDATVRV-----WDVETGECIKTLIHHCEAVLHLRF--ANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRA-AVNVVDFDDRYIVSASGDRTIKVWSMDTLEF---------VRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAA 455          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 55.8398 bits (133), Expect = 1.226e-12
Identity = 42/171 (24.56%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEI 2121
            AV  L F++ I+V+   D SI VW +   ++ ++ ++L GH  ++  +           AS D T+++ SM     D L  ++++     GI  ++      L+ +G  D TIRL D+    C+  +   +++++C+ F    ++SG + G ++ W+   ++   A  +EI
Sbjct:  304 AVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVS--ASGDRTIKVWSM-----DTLEFVRTLAGHRRGIACLQYRG--RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEI 465          

HSP 2 Score: 36.965 bits (84), Expect = 1.226e-12
Identity = 15/44 (34.09%), Postives = 25/44 (56.82%), Query Frame = 2
Query: 1436 LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            L+GH   V  +++D   + S S D ++R+WD  +G  I+ L  H
Sbjct:  258 LSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHH 301          

HSP 3 Score: 50.447 bits (119), Expect = 5.602e-6
Identity = 60/255 (23.53%), Postives = 113/255 (44.31%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDM--DRLDCIYNI--GYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    +VSG  D +I +W   +++S  +IL GH GS+  L+           S D T+R+     + ++    IK++      ++ +R      ++ T   D++I + DM   R   I  +  G++   +  + F    ++S      ++ W+ +   F         V T       I  L Y  R + +  +D +I+ W + S  C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  221 NSKGVYCLQYDDDKIVSGLRDNTIKIWD-RKDYSCSRILSGHTGSVLCLQYDNRVIIS--GSSDATVRV-----WDVETGECIKTLIHHCEAVLHLRF--ANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRA-AVNVVDFDDRYIVSASGDRTIKVWSMDTLEF---------VRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAA 455          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 55.8398 bits (133), Expect = 1.301e-12
Identity = 42/171 (24.56%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEI 2121
            AV  L F++ I+V+   D SI VW +   ++ ++ ++L GH  ++  +           AS D T+++ SM     D L  ++++     GI  ++      L+ +G  D TIRL D+    C+  +   +++++C+ F    ++SG + G ++ W+   ++   A  +EI
Sbjct:  249 AVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVS--ASGDRTIKVWSM-----DTLEFVRTLAGHRRGIACLQYRG--RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEI 410          

HSP 2 Score: 36.965 bits (84), Expect = 1.301e-12
Identity = 15/44 (34.09%), Postives = 25/44 (56.82%), Query Frame = 2
Query: 1436 LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            L+GH   V  +++D   + S S D ++R+WD  +G  I+ L  H
Sbjct:  203 LSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHH 246          

HSP 3 Score: 49.6766 bits (117), Expect = 7.739e-6
Identity = 60/255 (23.53%), Postives = 113/255 (44.31%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDM--DRLDCIYNI--GYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    +VSG  D +I +W   +++S  +IL GH GS+  L+           S D T+R+     + ++    IK++      ++ +R      ++ T   D++I + DM   R   I  +  G++   +  + F    ++S      ++ W+ +   F         V T       I  L Y  R + +  +D +I+ W + S  C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  166 NSKGVYCLQYDDDKIVSGLRDNTIKIWD-RKDYSCSRILSGHTGSVLCLQYDNRVIIS--GSSDATVRV-----WDVETGECIKTLIHHCEAVLHLRF--ANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRA-AVNVVDFDDRYIVSASGDRTIKVWSMDTLEF---------VRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAA 400          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 55.8398 bits (133), Expect = 1.334e-12
Identity = 42/171 (24.56%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEI 2121
            AV  L F++ I+V+   D SI VW +   ++ ++ ++L GH  ++  +           AS D T+++ SM     D L  ++++     GI  ++      L+ +G  D TIRL D+    C+  +   +++++C+ F    ++SG + G ++ W+   ++   A  +EI
Sbjct:  249 AVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVS--ASGDRTIKVWSM-----DTLEFVRTLAGHRRGIACLQYRG--RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEI 410          

HSP 2 Score: 36.965 bits (84), Expect = 1.334e-12
Identity = 15/44 (34.09%), Postives = 25/44 (56.82%), Query Frame = 2
Query: 1436 LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            L+GH   V  +++D   + S S D ++R+WD  +G  I+ L  H
Sbjct:  203 LSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHH 246          

HSP 3 Score: 49.6766 bits (117), Expect = 7.862e-6
Identity = 60/255 (23.53%), Postives = 113/255 (44.31%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDM--DRLDCIYNI--GYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    +VSG  D +I +W   +++S  +IL GH GS+  L+           S D T+R+     + ++    IK++      ++ +R      ++ T   D++I + DM   R   I  +  G++   +  + F    ++S      ++ W+ +   F         V T       I  L Y  R + +  +D +I+ W + S  C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  166 NSKGVYCLQYDDDKIVSGLRDNTIKIWD-RKDYSCSRILSGHTGSVLCLQYDNRVIIS--GSSDATVRV-----WDVETGECIKTLIHHCEAVLHLRF--ANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRA-AVNVVDFDDRYIVSASGDRTIKVWSMDTLEF---------VRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAA 400          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 55.8398 bits (133), Expect = 1.341e-12
Identity = 42/171 (24.56%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEI 2121
            AV  L F++ I+V+   D SI VW +   ++ ++ ++L GH  ++  +           AS D T+++ SM     D L  ++++     GI  ++      L+ +G  D TIRL D+    C+  +   +++++C+ F    ++SG + G ++ W+   ++   A  +EI
Sbjct:  304 AVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVS--ASGDRTIKVWSM-----DTLEFVRTLAGHRRGIACLQYRG--RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEI 465          

HSP 2 Score: 36.965 bits (84), Expect = 1.341e-12
Identity = 15/44 (34.09%), Postives = 25/44 (56.82%), Query Frame = 2
Query: 1436 LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            L+GH   V  +++D   + S S D ++R+WD  +G  I+ L  H
Sbjct:  258 LSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHH 301          

HSP 3 Score: 50.0618 bits (118), Expect = 6.254e-6
Identity = 60/255 (23.53%), Postives = 113/255 (44.31%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDM--DRLDCIYNI--GYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    +VSG  D +I +W   +++S  +IL GH GS+  L+           S D T+R+     + ++    IK++      ++ +R      ++ T   D++I + DM   R   I  +  G++   +  + F    ++S      ++ W+ +   F         V T       I  L Y  R + +  +D +I+ W + S  C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  221 NSKGVYCLQYDDDKIVSGLRDNTIKIWD-RKDYSCSRILSGHTGSVLCLQYDNRVIIS--GSSDATVRV-----WDVETGECIKTLIHHCEAVLHLRF--ANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRA-AVNVVDFDDRYIVSASGDRTIKVWSMDTLEF---------VRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAA 455          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0084032)

HSP 1 Score: 53.1434 bits (126), Expect = 8.661e-11
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +      +L ++L GH  ++  +   +       AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D +IRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  292 AVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVS--ASGDRTIKVWSTSSCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWD 439          

HSP 2 Score: 33.8834 bits (76), Expect = 8.661e-11
Identity = 16/49 (32.65%), Postives = 25/49 (51.02%), Query Frame = 2
Query: 1424 NCYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
             C K L GH   V  +++D   + S S D ++R+WD  +G  +  L  H
Sbjct:  241 QCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHH 289          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0333931)

HSP 1 Score: 53.1434 bits (126), Expect = 8.661e-11
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +      +L ++L GH  ++  +   +       AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D +IRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  292 AVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVS--ASGDRTIKVWSTSSCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWD 439          

HSP 2 Score: 33.8834 bits (76), Expect = 8.661e-11
Identity = 16/49 (32.65%), Postives = 25/49 (51.02%), Query Frame = 2
Query: 1424 NCYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
             C K L GH   V  +++D   + S S D ++R+WD  +G  +  L  H
Sbjct:  241 QCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHH 289          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0330049)

HSP 1 Score: 52.7582 bits (125), Expect = 1.118e-10
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +      +L ++L GH  ++  +   +       AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D +IRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  292 AVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVS--ASGDRTIKVWSTSSCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWD 439          

HSP 2 Score: 33.8834 bits (76), Expect = 1.118e-10
Identity = 16/48 (33.33%), Postives = 25/48 (52.08%), Query Frame = 2
Query: 1427 CYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            C K L GH   V  +++D   + S S D ++R+WD  +G  +  L  H
Sbjct:  242 CVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHH 289          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087241)

HSP 1 Score: 48.521 bits (114), Expect = 1.920e-10
Identity = 48/238 (20.17%), Postives = 104/238 (43.70%), Query Frame = 1
Query: 1627 LDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCL----------------------YFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHM--RSLWTAHNDGSIKEWYLASMTCIRTLYGHK 2268
             D   ++L S   D+SI +W  +Q++  IK ++GH  +++S+  +   + ++SAS D T+++     +++     +K+       +  +R+    ++ AT   D+TIR+   +  DC   +   +  ++C+                      + Q   L SG     ++ W+ +  +          + T       +  L +H   + L +A +D +I+ W L +  C++TLY H+
Sbjct:  158 FDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKM-----WEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLC---------LLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQ 381          

HSP 2 Score: 36.965 bits (84), Expect = 1.920e-10
Identity = 20/48 (41.67%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1430 YKLTGHLDGVTMVKFDK--SRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            + LTGH   +T V F    + M S+S D ++RIWD  +G   R L GH
Sbjct:  102 FSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGH 149          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0304747)

HSP 1 Score: 48.521 bits (114), Expect = 1.920e-10
Identity = 48/238 (20.17%), Postives = 104/238 (43.70%), Query Frame = 1
Query: 1627 LDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCL----------------------YFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHM--RSLWTAHNDGSIKEWYLASMTCIRTLYGHK 2268
             D   ++L S   D+SI +W  +Q++  IK ++GH  +++S+  +   + ++SAS D T+++     +++     +K+       +  +R+    ++ AT   D+TIR+   +  DC   +   +  ++C+                      + Q   L SG     ++ W+ +  +          + T       +  L +H   + L +A +D +I+ W L +  C++TLY H+
Sbjct:  158 FDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKM-----WEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLC---------LLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQ 381          

HSP 2 Score: 36.965 bits (84), Expect = 1.920e-10
Identity = 20/48 (41.67%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1430 YKLTGHLDGVTMVKFDK--SRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            + LTGH   +T V F    + M S+S D ++RIWD  +G   R L GH
Sbjct:  102 FSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGH 149          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 58.9214 bits (141), Expect = 1.567e-13
Identity = 62/261 (23.75%), Postives = 112/261 (42.91%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWR-LKKSHSRETHDEKP 2388
            AV  L F + ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW  L  S + +T    P
Sbjct:  304 AVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSP 515          

HSP 2 Score: 37.7354 bits (86), Expect = 1.567e-13
Identity = 24/84 (28.57%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  SG  +  L  H
Sbjct:  218 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHH 301          

HSP 3 Score: 53.5286 bits (127), Expect = 7.333e-7
Identity = 62/256 (24.22%), Postives = 114/256 (44.53%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  +Q    +KIL GH G  + L L   +  +++ S D T+R+  +  G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  221 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KQTLECLKILTGHTG--SVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLI------HHNEAVLHLRF--CNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 455          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 58.9214 bits (141), Expect = 1.714e-13
Identity = 62/261 (23.75%), Postives = 112/261 (42.91%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWR-LKKSHSRETHDEKP 2388
            AV  L F + ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW  L  S + +T    P
Sbjct:  311 AVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSP 522          

HSP 2 Score: 37.7354 bits (86), Expect = 1.714e-13
Identity = 24/84 (28.57%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  SG  +  L  H
Sbjct:  225 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHH 308          

HSP 3 Score: 53.5286 bits (127), Expect = 7.856e-7
Identity = 62/256 (24.22%), Postives = 114/256 (44.53%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  +Q    +KIL GH G  + L L   +  +++ S D T+R+  +  G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G+ +  +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  228 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KQTLECLKILTGHTG--SVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLI------HHNEAVLHLRF--CNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGH-RAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 462          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 58.9214 bits (141), Expect = 1.743e-13
Identity = 62/261 (23.75%), Postives = 112/261 (42.91%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWR-LKKSHSRETHDEKP 2388
            AV  L F + ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW  L  S + +T    P
Sbjct:  307 AVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSP 518          

HSP 2 Score: 37.7354 bits (86), Expect = 1.743e-13
Identity = 24/84 (28.57%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  SG  +  L  H
Sbjct:  221 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHH 304          

HSP 3 Score: 53.5286 bits (127), Expect = 9.209e-7
Identity = 62/256 (24.22%), Postives = 114/256 (44.53%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  +Q    +KIL GH G  + L L   +  +++ S D T+R+  +  G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G+ +  +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  224 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KQTLECLKILTGHTG--SVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLI------HHNEAVLHLRF--CNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGH-RAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 458          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 58.9214 bits (141), Expect = 1.743e-13
Identity = 62/261 (23.75%), Postives = 112/261 (42.91%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWR-LKKSHSRETHDEKP 2388
            AV  L F + ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW  L  S + +T    P
Sbjct:  307 AVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSP 518          

HSP 2 Score: 37.7354 bits (86), Expect = 1.743e-13
Identity = 24/84 (28.57%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  SG  +  L  H
Sbjct:  221 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHH 304          

HSP 3 Score: 53.5286 bits (127), Expect = 9.209e-7
Identity = 62/256 (24.22%), Postives = 114/256 (44.53%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  +Q    +KIL GH G  + L L   +  +++ S D T+R+  +  G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G+ +  +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  224 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KQTLECLKILTGHTG--SVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLI------HHNEAVLHLRF--CNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGH-RAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 458          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Zebrafish
Match: fbxw11b (F-box and WD repeat domain containing 11b [Source:ZFIN;Acc:ZDB-GENE-040426-2903])

HSP 1 Score: 58.5362 bits (140), Expect = 1.815e-13
Identity = 62/261 (23.75%), Postives = 112/261 (42.91%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWR-LKKSHSRETHDEKP 2388
            AV  L F + ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW  L  S + +T    P
Sbjct:  314 AVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSP 525          

HSP 2 Score: 37.7354 bits (86), Expect = 1.815e-13
Identity = 24/84 (28.57%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  SG  +  L  H
Sbjct:  228 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHH 311          

HSP 3 Score: 53.1434 bits (126), Expect = 1.048e-6
Identity = 62/256 (24.22%), Postives = 114/256 (44.53%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  +Q    +KIL GH G  + L L   +  +++ S D T+R+  +  G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G+ +  +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  231 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KQTLECLKILTGHTG--SVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLI------HHNEAVLHLRF--CNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGH-RAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 465          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 53.1434 bits (126), Expect = 1.243e-10
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  266 AVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 413          

HSP 2 Score: 34.2686 bits (77), Expect = 1.243e-10
Identity = 22/84 (26.19%), Postives = 40/84 (47.62%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    L GH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  180 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHH 263          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 53.1434 bits (126), Expect = 1.288e-10
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  347 AVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 494          

HSP 2 Score: 34.2686 bits (77), Expect = 1.288e-10
Identity = 22/84 (26.19%), Postives = 40/84 (47.62%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    L GH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  261 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHH 344          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 53.1434 bits (126), Expect = 1.309e-10
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  344 AVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 491          

HSP 2 Score: 34.2686 bits (77), Expect = 1.309e-10
Identity = 22/84 (26.19%), Postives = 40/84 (47.62%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    L GH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  258 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHH 341          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 52.7582 bits (125), Expect = 1.320e-10
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  350 AVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 497          

HSP 2 Score: 34.2686 bits (77), Expect = 1.320e-10
Identity = 22/84 (26.19%), Postives = 40/84 (47.62%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    L GH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  264 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHH 347          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Xenopus
Match: btrc (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:NCBI gene;Acc:549140])

HSP 1 Score: 53.1434 bits (126), Expect = 1.353e-10
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  339 AVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 486          

HSP 2 Score: 34.2686 bits (77), Expect = 1.353e-10
Identity = 22/84 (26.19%), Postives = 40/84 (47.62%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    L GH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  253 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHH 336          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Mouse
Match: Fbxw11 (F-box and WD-40 domain protein 11 [Source:MGI Symbol;Acc:MGI:2144023])

HSP 1 Score: 59.6918 bits (143), Expect = 5.813e-13
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L FS+ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  309 AVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 504          

HSP 2 Score: 35.039 bits (79), Expect = 5.813e-13
Identity = 16/48 (33.33%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1427 CYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            C K LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  259 CLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH 306          

HSP 3 Score: 51.2174 bits (121), Expect = 4.657e-6
Identity = 60/256 (23.44%), Postives = 112/256 (43.75%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    ++SG  D SI +W  + +   +K+L GH GS+  L+  +        S D T+R+  +  G  L+ L+           ++ +R   +  L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  226 NSKGVYCLQYDDDKIISGLRDNSIKIWD-KSSLECLKVLTGHTGSVLCLQYDERVIVT--GSSDSTVRVWDVNTGEVLNTLI------HHNEAVLHLRF--SNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 460          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Mouse
Match: Fbxw11 (F-box and WD-40 domain protein 11 [Source:MGI Symbol;Acc:MGI:2144023])

HSP 1 Score: 59.3066 bits (142), Expect = 6.452e-13
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L FS+ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  343 AVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 538          

HSP 2 Score: 35.039 bits (79), Expect = 6.452e-13
Identity = 16/48 (33.33%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1427 CYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            C K LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  293 CLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH 340          

HSP 3 Score: 51.2174 bits (121), Expect = 5.347e-6
Identity = 60/256 (23.44%), Postives = 112/256 (43.75%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    ++SG  D SI +W  + +   +K+L GH GS+  L+  +        S D T+R+  +  G  L+ L+           ++ +R   +  L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  260 NSKGVYCLQYDDDKIISGLRDNSIKIWD-KSSLECLKVLTGHTGSVLCLQYDERVIVT--GSSDSTVRVWDVNTGEVLNTLI------HHNEAVLHLRF--SNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 494          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Mouse
Match: Fbxw11 (F-box and WD-40 domain protein 11 [Source:MGI Symbol;Acc:MGI:2144023])

HSP 1 Score: 59.3066 bits (142), Expect = 8.734e-13
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L FS+ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  322 AVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 517          

HSP 2 Score: 35.039 bits (79), Expect = 8.734e-13
Identity = 16/48 (33.33%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1427 CYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            C K LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  272 CLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH 319          

HSP 3 Score: 50.8322 bits (120), Expect = 6.061e-6
Identity = 60/256 (23.44%), Postives = 112/256 (43.75%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    ++SG  D SI +W  + +   +K+L GH GS+  L+  +        S D T+R+  +  G  L+ L+           ++ +R   +  L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  239 NSKGVYCLQYDDDKIISGLRDNSIKIWD-KSSLECLKVLTGHTGSVLCLQYDERVIVT--GSSDSTVRVWDVNTGEVLNTLI------HHNEAVLHLRF--SNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 473          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Mouse
Match: Btrc (beta-transducin repeat containing protein [Source:MGI Symbol;Acc:MGI:1338871])

HSP 1 Score: 53.9138 bits (128), Expect = 7.621e-12
Identity = 57/261 (21.84%), Postives = 110/261 (42.15%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRETHDEKPQ 2391
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++    D + P                           A   C+RTL  H G +  L F +  + SSS D +I IW      +   H E P+
Sbjct:  349 AVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLMAALDPRAP---------------------------AGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPA--AHAEPPR 558          

HSP 2 Score: 36.965 bits (84), Expect = 7.621e-12
Identity = 23/84 (27.38%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  263 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHH 346          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Mouse
Match: Btrc (beta-transducin repeat containing protein [Source:MGI Symbol;Acc:MGI:1338871])

HSP 1 Score: 53.5286 bits (127), Expect = 1.059e-11
Identity = 57/261 (21.84%), Postives = 110/261 (42.15%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRETHDEKPQ 2391
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++    D + P                           A   C+RTL  H G +  L F +  + SSS D +I IW      +   H E P+
Sbjct:  286 AVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLMAALDPRAP---------------------------AGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPA--AHAEPPR 495          

HSP 2 Score: 36.5798 bits (83), Expect = 1.059e-11
Identity = 23/84 (27.38%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  200 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHH 283          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. UniProt/SwissProt
Match: sp|Q9UKB1|FBW1B_HUMAN (F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.638e-12
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L FS+ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  322 AVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 517          

HSP 2 Score: 35.8094 bits (81), Expect = 2.638e-12
Identity = 22/84 (26.19%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    ++E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  236 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH 319          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. UniProt/SwissProt
Match: sp|Q5SRY7|FBW1B_MOUSE (F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 5.321e-12
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L FS+ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  322 AVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 517          

HSP 2 Score: 35.039 bits (79), Expect = 5.321e-12
Identity = 16/48 (33.33%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1427 CYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            C K LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  272 CLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH 319          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. UniProt/SwissProt
Match: sp|Q09990|LIN23_CAEEL (F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans OX=6239 GN=lin-23 PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 1.407e-11
Identity = 42/171 (24.56%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEI 2121
            AV  L F++ I+V+   D SI VW +   ++ ++ ++L GH  ++  +           AS D T+++ SM     D L  ++++     GI  ++      L+ +G  D TIRL D+    C+  +   +++++C+ F    ++SG + G ++ W+   ++   A  +EI
Sbjct:  304 AVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVS--ASGDRTIKVWSM-----DTLEFVRTLAGHRRGIACLQYRG--RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEI 465          

HSP 2 Score: 36.965 bits (84), Expect = 1.407e-11
Identity = 15/44 (34.09%), Postives = 25/44 (56.82%), Query Frame = 2
Query: 1436 LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            L+GH   V  +++D   + S S D ++R+WD  +G  I+ L  H
Sbjct:  258 LSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHH 301          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. UniProt/SwissProt
Match: sp|Q3ULA2|FBW1A_MOUSE (F-box/WD repeat-containing protein 1A OS=Mus musculus OX=10090 GN=Btrc PE=1 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 6.631e-11
Identity = 57/261 (21.84%), Postives = 110/261 (42.15%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRETHDEKPQ 2391
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++    D + P                           A   C+RTL  H G +  L F +  + SSS D +I IW      +   H E P+
Sbjct:  385 AVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLMAALDPRAP---------------------------AGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPA--AHAEPPR 594          

HSP 2 Score: 36.965 bits (84), Expect = 6.631e-11
Identity = 23/84 (27.38%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  299 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHH 382          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. UniProt/SwissProt
Match: sp|Q9Y297|FBW1A_HUMAN (F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.391e-10
Identity = 36/157 (22.93%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW +    + +L ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  385 AVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 532          

HSP 2 Score: 36.5798 bits (83), Expect = 1.391e-10
Identity = 23/84 (27.38%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + +   S     T++I    T+E    LTGH   V  +++D+  + + S D ++R+WD  +G  +  L  H
Sbjct:  299 RSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHH 382          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. TrEMBL
Match: A0A267GEN7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002741g3 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 6.551e-50
Identity = 74/249 (29.72%), Postives = 123/249 (49.40%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLK 2352
            ++G V CL     +L +G WDMS+ +WSLE +F  +++L  H  S+  + +L     L++A+ D T R++    ++   L         P+ +    +   + L AT   D+ +RL D+     +   G  +D + CL+    LL++G   G L FW+        A  A+       +  L++  L     SLW  H+DG+I+EW++ASMTC+R+L GHK ++  L      + S S D   RIW  +
Sbjct:  760 HKGGVTCLHMRDNVLATGSWDMSVMLWSLEPDFRRLRMLTDHEDSVCYVHILPGSRNLVTAAFDATARVYEPPTYRQVALARF------PSPVTQAAVAGEQQL-ATAHADRQLRLTDLATGRLLRQFGAHRDAVTCLHASGDLLVTGTRRGRLHFWDARTGQCEAAVQAD-----PGRAALTV--LRLRRGSLWAGHSDGTIREWHVASMTCVRSLAGHKAAVRDLQATAKRVASVSEDAFARIWEFR 994          

HSP 2 Score: 104.76 bits (260), Expect = 6.551e-50
Identity = 59/125 (47.20%), Postives = 78/125 (62.40%), Query Frame = 2
Query: 1199 DTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWL-DSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHK 1570
            D R LMKPI+G+LKQFQ+SE++A+D +   LV   D  ++SESK  L +  D      + A  G+      +L I  C  L GHLD V  ++FD+ R+ + S D S+RIWD  SGRSIRKLYGHK
Sbjct:  644 DRRPLMKPILGRLKQFQDSEDVALDIRP-RLVEATDLTEKSESKERLIYKKDLEKLGQRGAFVGD------ILPILQCRLLQGHLDAVQCLQFDERRLVTGSRDMSVRIWDVRSGRSIRKLYGHK 761          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. TrEMBL
Match: A0A267DQU3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002741g2 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 6.661e-50
Identity = 74/249 (29.72%), Postives = 123/249 (49.40%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLK 2352
            ++G V CL     +L +G WDMS+ +WSLE +F  +++L  H  S+  + +L     L++A+ D T R++    ++   L         P+ +    +   + L AT   D+ +RL D+     +   G  +D + CL+    LL++G   G L FW+        A  A+       +  L++  L     SLW  H+DG+I+EW++ASMTC+R+L GHK ++  L      + S S D   RIW  +
Sbjct:  758 HKGGVTCLHMRDNVLATGSWDMSVMLWSLEPDFRRLRMLTDHEDSVCYVHILPGSRNLVTAAFDATARVYEPPTYRQVALARF------PSPVTQAAVAGEQQL-ATAHADRQLRLTDLATGRLLRQFGAHRDAVTCLHASGDLLVTGTRRGRLHFWDARTGQCEAAVQAD-----PGRAALTV--LRLRRGSLWAGHSDGTIREWHVASMTCVRSLAGHKAAVRDLQATAKRVASVSEDAFARIWEFR 992          

HSP 2 Score: 104.76 bits (260), Expect = 6.661e-50
Identity = 59/125 (47.20%), Postives = 78/125 (62.40%), Query Frame = 2
Query: 1199 DTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWL-DSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHK 1570
            D R LMKPI+G+LKQFQ+SE++A+D +   LV   D  ++SESK  L +  D      + A  G+      +L I  C  L GHLD V  ++FD+ R+ + S D S+RIWD  SGRSIRKLYGHK
Sbjct:  642 DRRPLMKPILGRLKQFQDSEDVALDIRP-RLVEATDLTEKSESKERLIYKKDLEKLGQRGAFVGD------ILPILQCRLLQGHLDAVQCLQFDERRLVTGSRDMSVRIWDVRSGRSIRKLYGHK 759          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. TrEMBL
Match: A0A267GQQ0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002741g1 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 6.942e-50
Identity = 74/249 (29.72%), Postives = 123/249 (49.40%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLK 2352
            ++G V CL     +L +G WDMS+ +WSLE +F  +++L  H  S+  + +L     L++A+ D T R++    ++   L         P+ +    +   + L AT   D+ +RL D+     +   G  +D + CL+    LL++G   G L FW+        A  A+       +  L++  L     SLW  H+DG+I+EW++ASMTC+R+L GHK ++  L      + S S D   RIW  +
Sbjct:  761 HKGGVTCLHMRDNVLATGSWDMSVMLWSLEPDFRRLRMLTDHEDSVCFVHILPGSRNLVTAAFDATARVYEPPTYRQLALARF------PSPVTQAAVAGEQQL-ATAHADRQLRLTDLATGRLLRQFGAHRDAVTCLHASGDLLVTGTRRGRLHFWDARTGQCEAAVQAD-----PGRAALTV--LRLRRGSLWAGHSDGTIREWHVASMTCVRSLAGHKAAVRDLQATAKRVASVSEDAFARIWEFR 995          

HSP 2 Score: 104.76 bits (260), Expect = 6.942e-50
Identity = 59/125 (47.20%), Postives = 78/125 (62.40%), Query Frame = 2
Query: 1199 DTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWL-DSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHK 1570
            D R LMKPI+G+LKQFQ+SE++A+D +   LV   D  ++SESK  L +  D      + A  G+      +L I  C  L GHLD V  ++FD+ R+ + S D S+RIWD  SGRSIRKLYGHK
Sbjct:  645 DRRPLMKPILGRLKQFQDSEDVALDIRP-RLVEATDLTEKSESKERLIYKKDLEKLGQRGAFVGD------ILPILQCRLLQGHLDAVQCLQFDERRLVTGSRDMSVRIWDVRSGRSIRKLYGHK 762          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. TrEMBL
Match: A0A1I8H7A0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.794e-32
Identity = 88/315 (27.94%), Postives = 148/315 (46.98%), Query Frame = 2
Query:  635 TKIDKYKILIEILCAENWDIQFHVYQCVKSRLLDRWSMDSIPTKILENIFYYFSPDELIKASLVNKQWLSVALNNGLWENHCATLGKSLGFTKFVEMMEENIADSARINWFEIYKAIRKLSRQNNSVIDVKNNIRKSKITFYEAAXXXXXXXXXXXFLXXXXXXXXXXXXXXKTSIKFNNVLDPDPEN--DTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWL-DSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHK 1570
             + ++  +L E++   +  +  ++  C+  R+ D   +  +P + L  IF      +L+  + V++ W  +A +  +W   C  +G   G      ++ + +     I+W   Y  + ++ RQ    + +  ++  +     EA                      + RR  +  +   +VLD       D R LMKPI+G+LKQFQ+SE++A+D +   LV   D  ++SESK  L +  D      + A  G+      +L I  C  L GHLD V  ++FD+ R+ + S D S+RIWD  SGRSIRKLYGHK
Sbjct:  239 PEFERINLLSELVTVCSQQLIAYLADCIMQRIHDCTDIGILPDRTLLKIFSMLPVRDLLSCAQVSRHWWVLASHESIWLRRCEQIGFENGLLNLAGVLRQRLG-LQHIDWKLTYGELERMLRQARQSLPLPRHLTHNAAVDGEA---------------------KAKRREQQQQLDGVSVLDRIHREYADRRPLMKPILGRLKQFQDSEDVALDIRP-RLVEATDLTEKSESKERLIYKKDLEKLGQRGAFVGD------ILPILQCRLLQGHLDAVQCLQFDERRLVTGSRDMSVRIWDVRSGRSIRKLYGHK 524          

HSP 2 Score: 47.3654 bits (111), Expect = 3.794e-32
Identity = 17/42 (40.48%), Postives = 27/42 (64.29%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGH 1731
            ++G V CL     +L +G WDMS+ +WSLE +F  +++L  H
Sbjct:  523 HKGGVTCLHMRDNVLATGSWDMSVMLWSLEPDFRRLRMLTDH 564          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. TrEMBL
Match: A0A1I8GRM3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.760e-31
Identity = 84/313 (26.84%), Postives = 144/313 (46.01%), Query Frame = 2
Query:  635 TKIDKYKILIEILCAENWDIQFHVYQCVKSRLLDRWSMDSIPTKILENIFYYFSPDELIKASLVNKQWLSVALNNGLWENHCATLGKSLGFTKFVEMMEENIADSARINWFEIYKAIRKLSRQNNSVIDVKNNIRKSKITFYEAAXXXXXXXXXXXFLXXXXXXXXXXXXXXKTSIKFNNVLDPDPENDTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWL-DSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHK 1570
             + ++  +L E++   +  +  ++  C+  R+ D   +  +P + L  IF      +L+  + V++ W  +A +  +W   C  +G   G      ++ + +     I+W   Y  + ++ RQ    + +  ++  +     EA    + + +    +S                             D R LMKPI+G+LKQFQ+SE++A+D +   LV   D  ++SESK  L +  D      + A  G+      +L I  C  L GHLD V  ++FD+ R+ + S D S+RIWD  SGRSIRKLYGHK
Sbjct:  301 PEFERINLLSELVTVCSQQLIAYLADCIMQRIHDCTDIGILPDRTLLKIFSLLPVRDLLSCAQVSRHWWVLASHESIWLRRCEQIGFENGLLNLAGVLRQRLG-LQHIDWKLTYGELERMLRQARQSLPLPRHLTHNAAVDGEAKAKRREQQQQLDGVSVLERIHREYA-------------------DRRPLMKPILGRLKQFQDSEDVALDIRP-RLVEATDLTEKSESKERLIYKKDLEKLGQRGAFVGD------ILPILQCRLLQGHLDAVQCLQFDERRLVTGSRDMSVRIWDVRSGRSIRKLYGHK 586          

HSP 2 Score: 46.9802 bits (110), Expect = 1.760e-31
Identity = 17/42 (40.48%), Postives = 27/42 (64.29%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGH 1731
            ++G V CL     +L +G WDMS+ +WSLE +F  +++L  H
Sbjct:  585 HKGGVTCLHMRDNVLATGSWDMSVMLWSLEPDFRRLRMLTDH 626          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Cavefish
Match: fbxw11a (F-box/WD repeat-containing protein 11 [Source:NCBI gene;Acc:103028966])

HSP 1 Score: 58.9214 bits (141), Expect = 2.554e-13
Identity = 58/245 (23.67%), Postives = 106/245 (43.27%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L F + ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  305 AVLHLRFCNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 500          

HSP 2 Score: 36.965 bits (84), Expect = 2.554e-13
Identity = 17/48 (35.42%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1427 CYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            C K LTGH   V  +++D   + + S D ++R+WD+ SG  +  L  H
Sbjct:  255 CLKILTGHTGSVLCLQYDDRVIVTGSSDSTVRVWDASSGEVLNTLIHH 302          

HSP 3 Score: 51.2174 bits (121), Expect = 3.609e-6
Identity = 61/256 (23.83%), Postives = 110/256 (42.97%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRI-HSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    ++SG  D SI +W  + +   +KIL GH GS+  L+           S D T+R+  +  G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  222 NSKGVYCLQYDDDKIISGLRDNSIKIWD-KHSLECLKILTGHTGSVLCLQYDDRVIVT--GSSDSTVRVWDASSGEVLNTLI------HHNEAVLHLRF--CNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 456          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Cavefish
Match: fbxw11a (F-box/WD repeat-containing protein 11 [Source:NCBI gene;Acc:103028966])

HSP 1 Score: 58.5362 bits (140), Expect = 2.699e-13
Identity = 58/245 (23.67%), Postives = 106/245 (43.27%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L F + ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  340 AVLHLRFCNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 535          

HSP 2 Score: 36.965 bits (84), Expect = 2.699e-13
Identity = 17/48 (35.42%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1427 CYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            C K LTGH   V  +++D   + + S D ++R+WD+ SG  +  L  H
Sbjct:  290 CLKILTGHTGSVLCLQYDDRVIVTGSSDSTVRVWDASSGEVLNTLIHH 337          

HSP 3 Score: 51.2174 bits (121), Expect = 4.259e-6
Identity = 61/256 (23.83%), Postives = 110/256 (42.97%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRI-HSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    ++SG  D SI +W  + +   +KIL GH GS+  L+           S D T+R+  +  G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  257 NSKGVYCLQYDDDKIISGLRDNSIKIWD-KHSLECLKILTGHTGSVLCLQYDDRVIVT--GSSDSTVRVWDASSGEVLNTLI------HHNEAVLHLRF--CNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 491          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Cavefish
Match: fbxw11b (F-box/WD repeat-containing protein 11-like [Source:NCBI gene;Acc:103029337])

HSP 1 Score: 58.5362 bits (140), Expect = 5.915e-13
Identity = 58/245 (23.67%), Postives = 106/245 (43.27%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L F + ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  313 AVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 508          

HSP 2 Score: 35.8094 bits (81), Expect = 5.915e-13
Identity = 17/48 (35.42%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1427 CYK-LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            C K LTGH   V  +++D+  + + S D ++R+WD  SG  +  L  H
Sbjct:  263 CLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHH 310          

HSP 3 Score: 52.7582 bits (125), Expect = 1.285e-6
Identity = 62/256 (24.22%), Postives = 114/256 (44.53%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    ++SG  D SI +W  +Q+   +KIL GH G  + L L   +  +++ S D T+R+  +  G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  230 NSKGVYCLQYDDDKIISGLRDNSIKIWD-KQSLECLKILTGHTG--SVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLI------HHNEAVLHLRF--CNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 464          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 43.5134 bits (101), Expect = 4.127e-10
Identity = 39/166 (23.49%), Postives = 74/166 (44.58%), Query Frame = 1
Query: 1612 GAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNI-GYQK--DVIKCLYFQSHLLISGGHSGFLQFWNTNPSVF 2097
             AV C+ +  + +VSG +D  + VW  E   + +  L GH        L      ++S SLD ++R+  ++ G  +  L   +S+ S         +E   N++ +G  D T+++ D+    C+  + G  K    + CL F  + +I+    G ++ W+     F
Sbjct:  585 AAVRCVQYDGRRVVSGAYDFMVKVWDPETE-TCLHTLQGHTN--RVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSG--------MELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEF 739          

HSP 2 Score: 41.2022 bits (95), Expect = 4.127e-10
Identity = 20/65 (30.77%), Postives = 33/65 (50.77%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            S +   TL++    T +  + L GH   V  +   + R+ S S D +LR+WD  +G+ +  L GH
Sbjct:  519 SGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 583          

HSP 3 Score: 59.3066 bits (142), Expect = 1.333e-8
Identity = 57/252 (22.62%), Postives = 114/252 (45.24%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRET 2373
            + CL F    +VSG  D ++ VWS      L + L GH G + S ++          S D TL++     +  +    I ++    + +  M + E R  + +G  D T+R+ D++   C++ +      ++C+ +    ++SG +   ++ W+       E  +  +Q  T++   L  + +     SL     D SI+ W + +  CI TL GH+   + +   D+++ S + D +++IW +K     +T
Sbjct:  467 ITCLQFCGNRIVSGSDDNTLKVWSAVTGKCL-RTLVGHTGGVWSSQMRDNIIIS--GSTDRTLKV-----WNAETGDCIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPET----ETCLHTLQGHTNRVYSLQFDGIHVVSGSL-----DTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQT 699          

HSP 4 Score: 39.6614 bits (91), Expect = 1.824e-6
Identity = 19/70 (27.14%), Postives = 36/70 (51.43%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHKVKSY 1582
            S +   TL++  + T +  + L GH+  V  V++D  R+ S + D  +++WD  +   +  L GH  + Y
Sbjct:  559 SGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVY 628          

HSP 5 Score: 32.3426 bits (72), Expect = 1.824e-6
Identity = 33/124 (26.61%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNI 1989
            VY L F    +VSG  D SI VW +E   + I  L GH    + ++L        +A  D T++I  +K  +   L T++  +   + +  ++    +N + T   D T++L D+   + I N+
Sbjct:  627 VYSLQFDGIHVVSGSLDTSIRVWDVETG-NCIHTLTGHQSLTSGMELKDNILVSGNA--DSTVKIWDIKTGQC--LQTLQGPHKHQSAVTCLQF--NKNFVITSSDDGTVKLWDLRTGEFIRNL 743          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 43.5134 bits (101), Expect = 5.371e-10
Identity = 37/166 (22.29%), Postives = 73/166 (43.98%), Query Frame = 1
Query: 1612 GAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIG---YQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVF 2097
             AV C+ +  + +VSG +D  + VW  E   + +  L GH        L      ++S SLD ++R+  ++ G  +  L   +S+ S         +E   N++ +G  D T+++ D+    C+  +      +  + CL F  + +I+    G ++ W+     F
Sbjct:  343 AAVRCVQYDGRRVVSGAYDFMVKVWDPETE-TCLHTLQGHTN--RVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSG--------MELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEF 497          

HSP 2 Score: 40.817 bits (94), Expect = 5.371e-10
Identity = 20/65 (30.77%), Postives = 33/65 (50.77%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            S +   TL++    T +  + L GH   V  +   + R+ S S D +LR+WD  +G+ +  L GH
Sbjct:  277 SGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 341          

HSP 3 Score: 59.6918 bits (143), Expect = 9.950e-9
Identity = 57/252 (22.62%), Postives = 114/252 (45.24%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRET 2373
            + CL F    +VSG  D ++ VWS      L + L GH G + S ++          S D TL++     +  +    I ++    + +  M + E R  + +G  D T+R+ D++   C++ +      ++C+ +    ++SG +   ++ W+       E  +  +Q  T++   L  + +     SL     D SI+ W + +  CI TL GH+   + +   D+++ S + D +++IW +K     +T
Sbjct:  225 ITCLQFCGNRIVSGSDDNTLKVWSAVTGKCL-RTLVGHTGGVWSSQMRDNIIIS--GSTDRTLKV-----WNAETGDCIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPET----ETCLHTLQGHTNRVYSLQFDGIHVVSGSL-----DTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQT 457          

HSP 4 Score: 39.6614 bits (91), Expect = 3.255e-6
Identity = 19/70 (27.14%), Postives = 36/70 (51.43%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHKVKSY 1582
            S +   TL++  + T +  + L GH+  V  V++D  R+ S + D  +++WD  +   +  L GH  + Y
Sbjct:  317 SGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVY 386          

HSP 5 Score: 31.5722 bits (70), Expect = 3.255e-6
Identity = 33/124 (26.61%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNI 1989
            VY L F    +VSG  D SI VW +E   + I  L GH    + ++L        +A  D T++I  +K  +   L T++  +   + +  ++    +N + T   D T++L D+   + I N+
Sbjct:  385 VYSLQFDGIHVVSGSLDTSIRVWDVETG-NCIHTLTGHQSLTSGMELKDNILVSGNA--DSTVKIWDIKTGQC--LQTLQGPHKHQSAVTCLQFN--KNFVITSSDDGTVKLWDLRTGEFIRNL 501          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Sea Lamprey
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 55.0694 bits (131), Expect = 7.008e-11
Identity = 38/157 (24.20%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F++ ++V+   D SI VW L    + SL ++L GH  ++  +           AS D T+++ +    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+
Sbjct:  351 AVLHLRFTNGLMVTCSKDRSIAVWDLASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWNTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD 498          

HSP 2 Score: 29.6462 bits (65), Expect = 7.008e-11
Identity = 28/128 (21.88%), Postives = 55/128 (42.97%), Query Frame = 2
Query: 1184 PDPENDTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            P   +  R L   IIG ++  +++          NL  +   + RSES   +  L  + E   S     T++++  + ++      GHL     + + +  +F+ S D ++R+WD  +G  +  L  H
Sbjct:  229 PQANSFYRALYPKIIGDIETIESNWRCG----RHNLQRI---QCRSESSKGVYCLQYDDEKIVSGLRDNTIKVKATIKVKATTH-HGHLIFFMFLLYVQLYVFTGSSDSTVRVWDVNTGEMVNTLIHH 348          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.881e-9
Identity = 56/252 (22.22%), Postives = 113/252 (44.84%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRET 2373
            + CL F    +VSG  D ++ VWS      L + L GH G + S ++          S D TL++     +  D    + ++    + +  M +   R  + +G  D T+R+ D++   C++ +      ++C+ +    ++SG +   ++ W+       E  +  +Q  T++   L  + +     SL     D SI+ W   + TC+ TL GH+   + +   D+++ S + D +++IW +K     +T
Sbjct:  237 ITCLQFCGNRIVSGSDDNTLKVWSAVTGKCL-RTLVGHTGGVWSSQMRGNIIVS--GSTDRTLKV-----WNADTGQCVHTLYGHTSTVRCMHLHGNR--VVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYDGRRVVSGAYDYTVKVWDPE----SETCLHTLQGHTNRVYSLQFDGVHIVSGSL-----DTSIRVWDAETGTCLHTLVGHQSLTSGMELRDNILVSGNADSTVKIWDIKTGQCLQT 469          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 46.2098 bits (108), Expect = 8.736e-10
Identity = 21/65 (32.31%), Postives = 37/65 (56.92%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            + +   T+ I  + T +   +L+GH DGV  + FD  ++ + SLD ++R+W+ I+G  I    GH
Sbjct:  317 TGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGH 381          

HSP 2 Score: 34.2686 bits (77), Expect = 8.736e-10
Identity = 55/235 (23.40%), Postives = 90/235 (38.30%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLID------MDRLDCIYNIGYQKDVI-KCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLW----------TAHNDGSIKEWYLASMTCIRTLYGHK 2268
            +V  +D   +++VSG  D ++ VW +E        L GH   +  +KL        S S D T+R+  ++      L   +    +   II + I++  NL      D +    D       D  D   N   Q+ V+ + + + +HLL S G    ++ W                   D K    I + F H+  +W          +  +DGSIK W L S  C+ T  G +
Sbjct:  384 SVLSVDSYQKVIVSGSADKTVKVWHVESRTCYT--LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSC--LKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSN--EQETVLDENIPYPTHLL-SCGLDNTIKLW-------------------DVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Yeast
Match: CAF4 (WD40 repeat-containing protein associated with the CCR4-NOT complex; interacts in a Ccr4p-dependent manner with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p and plays a role in mitochondrial fission; CAF4 has a paralog, MDV1, that arose from the whole genome duplication [Source:SGD;Acc:S000001744])

HSP 1 Score: 49.6766 bits (117), Expect = 1.486e-6
Identity = 49/184 (26.63%), Postives = 75/184 (40.76%), Query Frame = 1
Query: 1912 NLIATGLCDKTIRLIDMD-----RLD--------------CIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN-TNPSVFHEASMAEIQVFTDKKLPLS---------------IESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N++ TG  D T++L D++      LD              CI+N    KD I  L F S  L+SG     +  W+ T      +  +      +D K+P                 I +L  +  +L T   DG ++ W L     +R L GH   I  L F  + + + S+D S+RIW L+ S
Sbjct:  376 NMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTS 559          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Nematostella
Match: EDO44093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWV7])

HSP 1 Score: 91.2781 bits (225), Expect = 3.214e-28
Identity = 67/248 (27.02%), Postives = 120/248 (48.39%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRL 2349
            ++G V CL F ++ ++SG WDM+I VW + + F+ + +LYGH G ++ L+  +        S D T+R+  M+ ++   ++ ++      + +     E     + +G  DKTI+L +++  DC+  +    D +  +     L++SG   G + FW+ +      A  A             + SL Y     ++A  D  IKEW + + TC+RTL GH+G +  +      +     DGS+RIW L
Sbjct:  188 HKGGVRCLQFDNERIISGSWDMTIMVWHIVK-FTRLHVLYGHKGCVSCLRFDENTLVS--GSHDSTIRVWDMRTWEC--VLVLQGHEGAVSCL-----EFDAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAVTSVKVIGELILSGSADGMILFWDLDSGHCEAAIQAH---------EGPVHSLSYANDHFFSAGGDNMIKEWDVGTCTCLRTLQGHRGPVQDVMVGHHYILVEHYDGSVRIWDL 416          

HSP 2 Score: 53.1434 bits (126), Expect = 3.214e-28
Identity = 26/59 (44.07%), Postives = 39/59 (66.10%), Query Frame = 2
Query: 1394 LQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHK 1570
            L +R  L ++    L GH+D V  ++FD+ R+ + S D ++R+WD  SGRSIRK+ GHK
Sbjct:  132 LDVRPAL-VQAANVLKGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGHK 189          

HSP 3 Score: 55.4546 bits (132), Expect = 4.746e-8
Identity = 39/148 (26.35%), Postives = 71/148 (47.97%), Query Frame = 1
Query: 1909 RNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLK 2352
            R  + TG  D+TIR+ D+     I  +   K  ++CL F +  +ISG        W+    V+H      + V    K  +S   L +   +L +  +D +I+ W + +  C+  L GH+G+++ L F    + S S D +I++W ++
Sbjct:  159 RRRVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQFDNERIISGS-------WDMTIMVWHIVKFTRLHVLYGHKGCVS--CLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNVE 297          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Nematostella
Match: EDO48720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIJ5])

HSP 1 Score: 58.9214 bits (141), Expect = 1.051e-13
Identity = 60/256 (23.44%), Postives = 109/256 (42.58%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRETH 2376
            AV  L F   ++V+   D SI VW ++   + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W             ++Q   D + P                           A   C+RTL  H G +  L F D  + SSS D +I IW   K  +  T+
Sbjct:  246 AVLHLRFQEGMMVTCSKDRSIAVWDMQSPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHRRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-------------DLQAALDPRAP---------------------------AGTLCLRTLVEHTGRVFRLQFDDFQIVSSSHDDTILIWDFLKDATERTY 452          

HSP 2 Score: 36.1946 bits (82), Expect = 1.051e-13
Identity = 34/132 (25.76%), Postives = 62/132 (46.97%), Query Frame = 2
Query: 1184 PDPENDT--RLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWLDSNFETHK--SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            PDP N+   R L   II      Q+ E I  +++  N  +L     RSE+   +  L   ++ HK  S     T+++    ++     LTGH   V  +++D++ + + S D ++R+W+  +G  +  L  H
Sbjct:  121 PDPPNNDFFRKLYPKII------QDLETIETNWRCGNH-ALHKIPCRSENSKGVYCL--QYDDHKIVSGLRDNTIKVWDKKSLACVKVLTGHTGSVLCLQYDENVIVTGSSDSTVRVWNVHAGDMLNTLIHH 243          

HSP 3 Score: 54.299 bits (129), Expect = 1.324e-7
Identity = 61/256 (23.83%), Postives = 116/256 (45.31%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSM-KGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +    +VSG  D +I VW  +++ + +K+L GH GS+  L+  +        S D T+R+ ++  G  L+ L+           ++ +R +E   ++ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  163 NSKGVYCLQYDDHKIVSGLRDNTIKVWD-KKSLACVKVLTGHTGSVLCLQYDENVIVT--GSSDSTVRVWNVHAGDMLNTLI------HHCEAVLHLRFQE--GMMVTCSKDRSIAVWDMQSPTDISLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHRRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 397          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Nematostella
Match: EDO42306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1V2])

HSP 1 Score: 49.6766 bits (117), Expect = 3.790e-12
Identity = 43/166 (25.90%), Postives = 72/166 (43.37%), Query Frame = 1
Query: 1612 GAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRI-HSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIG---YQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVF 2097
             AV C+ +    +VSG +D  + VW  E     I  L GH   + SL+   T       SLD ++R+ H+  G  L  LV  +S+ S         +E   N + +G  D T+++ D+    C+  +      +  + CL F S  +I+    G ++ W+     F
Sbjct:  412 AAVRCVKYDGHRVVSGAYDFLVKVWDPETE-QCIHTLQGHTNRVYSLQFDGTYIVS--GSLDTSIRVWHAETGQCLHTLVGHQSLTSG--------MELRNNTLVSGNADSTVKIWDITTGQCLQTLAGPNKHQSAVTCLQFSSKFVITSSDDGTVKIWDLQTGEF 566          

HSP 2 Score: 40.0466 bits (92), Expect = 3.790e-12
Identity = 20/65 (30.77%), Postives = 32/65 (49.23%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            S +   TL++    T    + L GH   V  +   +  + S S DG+LR+WD+ +G  +  L GH
Sbjct:  346 SGSTDRTLKVWNAETGYCMHTLYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLHVLVGH 410          

HSP 3 Score: 52.373 bits (124), Expect = 5.826e-7
Identity = 51/254 (20.08%), Postives = 101/254 (39.76%), Query Frame = 1
Query: 1612 GAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRET 2373
            G V+    S  I+VSG  D ++ VW+ E  + +   LYGH                       T+R                         +DM  E    ++ +G  D T+R+ D    +C++ +      ++C+ +  H ++SG +   ++ W+       E  +  +Q  T++   L  +  +    SL     D SI+ W+  +  C+ TL GH+   + +   ++ + S + D +++IW +      +T
Sbjct:  332 GGVWSSQLSGHIIVSGSTDRTLKVWNAETGYCM-HTLYGHT---------------------STVR------------------------CMDMHEE----VVVSGSRDGTLRVWDTTTGNCLHVLVGHLAAVRCVKYDGHRVVSGAYDFLVKVWDPET----EQCIHTLQGHTNRVYSLQFDGTYIVSGSL-----DTSIRVWHAETGQCLHTLVGHQSLTSGMELRNNTLVSGNADSTVKIWDITTGQCLQT 526          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Nematostella
Match: EDO39072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB92])

HSP 1 Score: 48.521 bits (114), Expect = 3.164e-10
Identity = 66/262 (25.19%), Postives = 111/262 (42.37%), Query Frame = 1
Query: 1612 GAVYCLDFSSQILVSGGWDMSIFVWSLE-----QNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKC--LYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRETH 2376
            G V CL+ +   LVSG  D SI VW L         S    + GHM   T   L    EK++S S D TL++  +K       +T++  N+    ++ ++ +E++  I +G  D TI++  +    C+  +    D + C  L      +ISG     L+FW+          +  +     +     I  L      + +A +D ++K W L S   + TL  H   +  L F D  + S S D ++++W     H   +H
Sbjct:  197 GTVRCLNLNGNRLVSGSVDRSIKVWDLSFESYWSGASCKVTMVGHM--HTVRCLQVDDEKVVSGSYDKTLKVWDIKTGNCK--LTLRGHNA---AVLCVQFDESK--IVSGSYDNTIKVWSLVEGSCLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATG----KCIGTLDWIRSEGHTGVIRCLQSDSWRIVSAGDDKTLKMWSLESGQRLLTLRCHTDGVTCLQFNDYRIVSGSYDKTVKVWDFSPKHEFLSH 445          

HSP 2 Score: 35.039 bits (79), Expect = 3.164e-10
Identity = 12/29 (41.38%), Postives = 21/29 (72.41%), Query Frame = 2
Query: 1442 GHLDGVTMVKFDKSRMFSSSLDGSLRIWD 1528
            GH  G++ V+FD +R+ S S D ++++WD
Sbjct:  152 GHTQGISCVQFDDTRIVSGSSDKTIKVWD 180          

HSP 3 Score: 53.9138 bits (128), Expect = 1.890e-7
Identity = 48/168 (28.57%), Postives = 86/168 (51.19%), Query Frame = 1
Query: 1588 KLNYI*NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEP-TGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNP 2088
            KL    +  AV C+ F    +VSG +D +I VWSL +  S +  L GH  ++T L L   + K+IS SLD  L+   +   K   + T+  + SE  TG+I     ++  +++ G  DKT+++  ++    +  +    D + CL F  + ++SG +   ++ W+ +P
Sbjct:  275 KLTLRGHNAAVLCVQFDESKIVSGSYDNTIKVWSLVEG-SCLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATGKC--IGTLDWIRSEGHTGVIRCLQSDSWRIVSAGD-DKTLKMWSLESGQRLLTLRCHTDGVTCLQFNDYRIVSGSYDKTVKVWDFSP 438          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Nematostella
Match: EDO48004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK9])

HSP 1 Score: 57.3806 bits (137), Expect = 1.726e-8
Identity = 72/290 (24.83%), Postives = 122/290 (42.07%), Query Frame = 1
Query: 1588 KLNYI*NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXA----------SLDGTLRIH-------------------SMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCD--------KTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWR 2346
            K  ++ + G V+ L    ++L SG  D +I VW     +  +K L GH G + +L     K    SA          +L+    IH                   S+K  K+ NL T++ V  E TG+        R L+A   CD        +TI+L D+D L+C+  +      +  L      +I G +   +Q W+ N     E     +         L + S     R L++A  D S++ W L + TC++TL  H+GS++ L      + S ++D ++++W+
Sbjct:  392 KGTFVGHTGPVWALCVHGELLFSGSSDKTIKVWDTLTTYKCVKTLEGHTGIVLALCTHDKKLFSGSADCVINIWSIETLELLDSIHGHENPVCTLVTKRNILFSGSLKKIKVWNLDTLELVR-EMTGLNHW----VRALVA---CDSYLYSGSYQTIKLWDLDTLECVRVLQTSGGSVYSLAVTKEYIICGTYENCIQVWDVNTHKLIETLNGHVGTV----YALVVLSAPGQTR-LFSASYDRSLRVWNLETFTCLQTLLRHQGSVSTLALSKGRIFSGAVDSTVKVWQ 668          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Medaka
Match: fbxw11a (F-box and WD repeat domain containing 11 [Source:NCBI gene;Acc:101174029])

HSP 1 Score: 59.6918 bits (143), Expect = 2.287e-13
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L F++ ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+             +Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  307 AVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD-------------LQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 502          

HSP 2 Score: 36.1946 bits (82), Expect = 2.287e-13
Identity = 22/84 (26.19%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    T+E    LTGH   V  +++D+  + + S D ++R+W+  +G  +  L  H
Sbjct:  221 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHH 304          

HSP 3 Score: 53.9138 bits (128), Expect = 5.687e-7
Identity = 62/256 (24.22%), Postives = 111/256 (43.36%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRI-HSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  +Q    +KIL GH GS+  L+  +        S D T+R+     G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G++   +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  224 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KQTLECLKILTGHTGSVLCLQYDERVIVT--GSSDSTVRVWEVTTGEVLNTLI------HHNEAVLHLRF--ANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRA-AVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 458          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Medaka
Match: fbxw11a (F-box and WD repeat domain containing 11 [Source:NCBI gene;Acc:101174029])

HSP 1 Score: 59.6918 bits (143), Expect = 2.477e-13
Identity = 58/245 (23.67%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQ--NFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIW 2343
            AV  L F++ ++V+   D SI VW +    + SL ++L GH  ++  +           AS D T+++ S    +      ++++N    GI  ++  +   L+ +G  D TIRL D++   C+  +   +++++C+ F +  ++SG + G ++ W+             +Q   D + P                           AS  C+RTL  H G +  L F +  + SSS D +I IW
Sbjct:  342 AVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVS--ASGDRTIKVWSTSTCEF-----VRTLNGHKRGIACLQYRD--RLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD-------------LQAALDPRAP---------------------------ASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIW 537          

HSP 2 Score: 36.1946 bits (82), Expect = 2.477e-13
Identity = 22/84 (26.19%), Postives = 41/84 (48.81%), Query Frame = 2
Query: 1316 RSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            RSE+   +  L  + E   S     +++I    T+E    LTGH   V  +++D+  + + S D ++R+W+  +G  +  L  H
Sbjct:  256 RSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHH 339          

HSP 3 Score: 53.5286 bits (127), Expect = 6.395e-7
Identity = 62/256 (24.22%), Postives = 111/256 (43.36%), Query Frame = 1
Query: 1606 NQGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRI-HSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCI----YNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKS 2358
            N   VYCL +  + ++SG  D SI +W  +Q    +KIL GH GS+  L+  +        S D T+R+     G  L+ L+           ++ +R      L+ T   D++I + DM     I      +G+ +  +  + F    ++S      ++ W+T+   F         V T       I  L Y  R + +  +D +I+ W +    C+R L GH+  +  + F +  + S + DG I++W L+ +
Sbjct:  259 NSKGVYCLQYDDEKIISGLRDNSIKIWD-KQTLECLKILTGHTGSVLCLQYDERVIVT--GSSDSTVRVWEVTTGEVLNTLI------HHNEAVLHLRF--ANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGH-RAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEF---------VRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAA 493          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 43.5134 bits (101), Expect = 1.590e-10
Identity = 39/166 (23.49%), Postives = 74/166 (44.58%), Query Frame = 1
Query: 1612 GAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNI-GYQK--DVIKCLYFQSHLLISGGHSGFLQFWNTNPSVF 2097
             AV C+ +  + +VSG +D  + VW  E   + +  L GH        L      ++S SLD ++R+  ++ G  +  L   +S+ S         +E   N++ +G  D T+++ D+    C+  + G  K    + CL F  + +I+    G ++ W+     F
Sbjct:  573 AAVRCVQYDGRRVVSGAYDFMVKVWDPETE-TCLHTLQGHTN--RVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSG--------MELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEF 727          

HSP 2 Score: 42.743 bits (99), Expect = 1.590e-10
Identity = 21/65 (32.31%), Postives = 33/65 (50.77%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            S +   TL++    T E  + L GH   V  +   + R+ S S D +LR+WD  +G+ +  L GH
Sbjct:  507 SGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 571          

HSP 3 Score: 58.9214 bits (141), Expect = 2.001e-8
Identity = 57/252 (22.62%), Postives = 115/252 (45.63%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRET 2373
            + CL F    +VSG  D ++ VWS      L + L GH G + S ++ +        S D TL++     +  +    I ++    + +  M + E R  + +G  D T+R+ D++   C++ +      ++C+ +    ++SG +   ++ W+       E  +  +Q  T++   L  + +     SL     D SI+ W + +  CI TL GH+   + +   D+++ S + D +++IW +K     +T
Sbjct:  455 ITCLQFCGNRIVSGSDDNTLKVWSAVTGKCL-RTLVGHTGGVWSSQMRENIIIS--GSTDRTLKV-----WNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPE----TETCLHTLQGHTNRVYSLQFDGIHVVSGSL-----DTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQT 687          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 43.8986 bits (102), Expect = 1.815e-10
Identity = 39/166 (23.49%), Postives = 74/166 (44.58%), Query Frame = 1
Query: 1612 GAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMK-GFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNI-GYQK--DVIKCLYFQSHLLISGGHSGFLQFWNTNPSVF 2097
             AV C+ +  + +VSG +D  + VW  E   + +  L GH        L      ++S SLD ++R+  ++ G  +  L   +S+ S         +E   N++ +G  D T+++ D+    C+  + G  K    + CL F  + +I+    G ++ W+     F
Sbjct:  348 AAVRCVQYDGRRVVSGAYDFMVKVWDPETE-TCLHTLQGHTN--RVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSG--------MELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEF 502          

HSP 2 Score: 42.3578 bits (98), Expect = 1.815e-10
Identity = 21/65 (32.31%), Postives = 33/65 (50.77%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            S +   TL++    T E  + L GH   V  +   + R+ S S D +LR+WD  +G+ +  L GH
Sbjct:  282 SGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 346          

HSP 3 Score: 60.4622 bits (145), Expect = 5.634e-9
Identity = 57/252 (22.62%), Postives = 115/252 (45.63%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLKKSHSRET 2373
            + CL F    +VSG  D ++ VWS      L + L GH G + S ++ +        S D TL++     +  +    I ++    + +  M + E R  + +G  D T+R+ D++   C++ +      ++C+ +    ++SG +   ++ W+       E  +  +Q  T++   L  + +     SL     D SI+ W + +  CI TL GH+   + +   D+++ S + D +++IW +K     +T
Sbjct:  230 ITCLQFCGNRIVSGSDDNTLKVWSAVTGKCL-RTLVGHTGGVWSSQMRENIIIS--GSTDRTLKV-----WNAETGECIHTLYGHTSTVRCMHLHEKR--VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPET----ETCLHTLQGHTNRVYSLQFDGIHVVSGSL-----DTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQT 462          

HSP 4 Score: 39.6614 bits (91), Expect = 2.425e-6
Identity = 19/70 (27.14%), Postives = 36/70 (51.43%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHKVKSY 1582
            S +   TL++  + T +  + L GH+  V  V++D  R+ S + D  +++WD  +   +  L GH  + Y
Sbjct:  322 SGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVY 391          

HSP 5 Score: 31.9574 bits (71), Expect = 2.425e-6
Identity = 33/124 (26.61%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNI 1989
            VY L F    +VSG  D SI VW +E   + I  L GH    + ++L        +A  D T++I  +K  +   L T++  +   + +  ++    +N + T   D T++L D+   + I N+
Sbjct:  390 VYSLQFDGIHVVSGSLDTSIRVWDVETG-NCIHTLTGHQSLTSGMELKDNILVSGNA--DSTVKIWDIKTGQC--LQTLQGPHKHQSAVTCLQFN--KNFVITSSDDGTVKLWDLKTGEFIRNL 506          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Medaka
Match: ENSORLT00000003546.2 (F-box/WD repeat-containing protein 7 [Source:NCBI gene;Acc:101171440])

HSP 1 Score: 58.9214 bits (141), Expect = 1.330e-8
Identity = 54/245 (22.04%), Postives = 111/245 (45.31%), Query Frame = 1
Query: 1618 VYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRLK 2352
            + CL FS  ++VSG  D ++ VWS      L + L GH G +   ++          S D TLR+     +  ++   + ++    + +  M +   R  + +G  D T+R+ ++    C + +      ++C+ +    ++SGG+   ++ W+       E  +  +Q  T++   L  +  F    SL     D SI+ W   +  C+ TL GH+   + +   D+++ S + D ++R+W ++
Sbjct:  229 ITCLQFSGDLIVSGSDDNTLKVWSAVTGKCL-QTLTGHTGGVWCSQMAVATVIS--GSTDRTLRV-----WDAESGECVHTLYGHTSTVRCMHLHGNR--VVSGSRDTTLRVWNVTTGQCEHVLTGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPET----EVCLHTLQGHTNRVYSLQFDGAFVVSGSL-----DTSIRVWDAETGGCVHTLTGHQSLTSGMELRDNILVSGNADSTVRVWDIR 454          

HSP 2 Score: 52.373 bits (124), Expect = 1.878e-6
Identity = 33/116 (28.45%), Postives = 56/116 (48.28%), Query Frame = 2
Query: 1373 SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH----KVKSYLSN*IISKIREQFIVWISLLRFWFQVDGTCQYLYGLSSKISA 1708
            S +   TL++   +T +    LTGH  GV   +   + + S S D +LR+WD+ SG  +  LYGH    +      N ++S  R+      + LR W    G C+++  L+  ++A
Sbjct:  241 SGSDDNTLKVWSAVTGKCLQTLTGHTGGVWCSQMAVATVISGSTDRTLRVWDAESGECVHTLYGHTSTVRCMHLHGNRVVSGSRD------TTLRVWNVTTGQCEHV--LTGHVAA 348          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Planmine SMEST
Match: SMESG000025496.1 (SMESG000025496.1)

HSP 1 Score: 505.368 bits (1300), Expect = 0.000e+0
Identity = 276/279 (98.92%), Postives = 276/279 (98.92%), Query Frame = 2
Query:  746 MDSIPTKILENIFYYFSPDELIKASLVNKQWLSVALNNGLWENHCATLGKSLGFTKFVEMMEENIADSARINWFEIYKAIRKLSRQNNSVIDVKNNIRKSKITFYEAAXXXXXXXXXXXFLXXXXXXXXXXXXXXKTSIKFNNVLDPDPENDTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHKVKSY 1582
            MDSIPTKILENIFYYFSPDELIKASLVNKQWLSVALNNGLWENHCATLGKSLGFTKFVEMMEENIADSARINWFEIYKAIRKLSRQNNSVIDVKNNIRKSKITFYEAAKSVKIKSKVSKFLSNRSTSVNSSRRASKTSIKFNNVLDPDPENDTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHK   Y
Sbjct:    1 MDSIPTKILENIFYYFSPDELIKASLVNKQWLSVALNNGLWENHCATLGKSLGFTKFVEMMEENIADSARINWFEIYKAIRKLSRQNNSVIDVKNNIRKSKITFYEAAKSVKIKSKVSKFLSNRSTSVNSSRRASKTSIKFNNVLDPDPENDTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNLKWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHKGAVY 279          

HSP 2 Score: 351.288 bits (900), Expect = 0.000e+0
Identity = 186/187 (99.47%), Postives = 187/187 (100.00%), Query Frame = 1
Query: 1609 QGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLF 2169
            +GAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGSITSLKLLKTKEKLISASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLF
Sbjct:  275 KGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGSITSLKLLKTKEKLISASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLF 461          

HSP 3 Score: 28.8758 bits (63), Expect = 0.000e+0
Identity = 11/11 (100.00%), Postives = 11/11 (100.00%), Query Frame = 3
Query: 2166 FLSYEKFMDCP 2198
            FLSYEKFMDCP
Sbjct:  461 FLSYEKFMDCP 471          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Planmine SMEST
Match: SMESG000025494.1 (SMESG000025494.1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.668e-132
Identity = 196/196 (100.00%), Postives = 196/196 (100.00%), Query Frame = 2
Query:  140 MSEIFIKTVFKFQKLKIQEKKFVLCSFIGLIDRESLYSLKQTLEPFNLSKFQNQFGTIDLGNKNEDEDEIPNLQLISEKLVNEILSSSVRIVENEFLSSNSLEKFILNTNNSKLIDSFALPPIEHKHAVKLDRNLRGQSQRSKKQLKGFPDTIKLLIKNLATEFSTKIDKYKILIEILCAENWDIQFHVYQCVKSR 727
            MSEIFIKTVFKFQKLKIQEKKFVLCSFIGLIDRESLYSLKQTLEPFNLSKFQNQFGTIDLGNKNEDEDEIPNLQLISEKLVNEILSSSVRIVENEFLSSNSLEKFILNTNNSKLIDSFALPPIEHKHAVKLDRNLRGQSQRSKKQLKGFPDTIKLLIKNLATEFSTKIDKYKILIEILCAENWDIQFHVYQCVKSR
Sbjct:    1 MSEIFIKTVFKFQKLKIQEKKFVLCSFIGLIDRESLYSLKQTLEPFNLSKFQNQFGTIDLGNKNEDEDEIPNLQLISEKLVNEILSSSVRIVENEFLSSNSLEKFILNTNNSKLIDSFALPPIEHKHAVKLDRNLRGQSQRSKKQLKGFPDTIKLLIKNLATEFSTKIDKYKILIEILCAENWDIQFHVYQCVKSR 196          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Planmine SMEST
Match: SMESG000011456.1 (SMESG000011456.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.235e-14
Identity = 42/157 (26.75%), Postives = 77/157 (49.04%), Query Frame = 1
Query: 1609 QGAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            Q A+ C+ +   ++VSG  D +I +W    N   +  L+GH+  +  L L     ++IS S D TL+   ++  K   + TI  + SE    +   ++  R    +G  DKTI++ D++    ++     KD + CL F + +L+SG +   +  W+
Sbjct:  344 QDAILCVQYDDSVIVSGSLDKTIKIWLF--NGECLFTLHGHVDPVACLHLDYKHNRIISGSHDNTLKFWDIRNKKC--IRTIDWIESEGHKRVVRCLQADRYKFISGSDDKTIKVWDIENGTRLHTYQGHKDGVSCLQFNNEMLVSGSYDHSVILWD 496          

HSP 2 Score: 46.595 bits (109), Expect = 1.235e-14
Identity = 20/45 (44.44%), Postives = 29/45 (64.44%), Query Frame = 2
Query: 1436 LTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGHK 1570
            LTGHL+ V  ++ D  ++ S S DGSL++W   +G  IR L GH+
Sbjct:  300 LTGHLNSVRCLQADHDKIVSGSYDGSLKVWCMATGELIRTLRGHQ 344          

HSP 3 Score: 51.6026 bits (122), Expect = 2.037e-6
Identity = 54/222 (24.32%), Postives = 106/222 (47.75%), Query Frame = 1
Query: 1648 LVSGGWDMSIFVWSL--EQNFSLI---KILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLY--FQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHF 2292
            LVSG  D +I +W+L    ++S I     L GH+ S+  L+    K      S DG+L++  M   +L     I+++      I+ ++ +++  +I +G  DKTI++   +  +C++ +    D + CL+  ++ + +ISG H   L+FW+    + ++  +  I     +     +  L        +  +D +IK W + + T + T  GHK  ++ L F
Sbjct:  271 LVSGSNDKTIKIWALAARNDWSSIICRATLTGHLNSVRCLQADHDKIVS--GSYDGSLKVWCMATGEL-----IRTLRGHQDAILCVQYDDS--VIVSGSLDKTIKIWLFNG-ECLFTLHGHVDPVACLHLDYKHNRIISGSHDNTLKFWD----IRNKKCIRTIDWIESEGHKRVVRCLQADRYKFISGSDDKTIKVWDIENGTRLHTYQGHKDGVSCLQF 478          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Planmine SMEST
Match: SMESG000052999.1 (SMESG000052999.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.096e-12
Identity = 39/157 (24.84%), Postives = 78/157 (49.68%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSL--EQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWN 2079
            AV  L F+  ILV+   D SI VW +    +  L ++L GH  ++  +   +       AS D T+++ + +  +      + ++N    GI  ++     NL+ +G  D TIRL  ++   C+  +   +++++C+ F S  ++SG + G ++ W+
Sbjct:  342 AVLHLRFAHSILVTCSKDRSIAVWDMFAPSDIRLRRVLVGHRAAVNVVDFDQKNIVS--ASGDRTIKVWNTQSCEF-----LHTMNGHRRGIACLQYRN--NLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWD 489          

HSP 2 Score: 38.1206 bits (87), Expect = 1.096e-12
Identity = 23/93 (24.73%), Postives = 44/93 (47.31%), Query Frame = 2
Query: 1328 KFNLKWLDSNFETHK-------------SAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            K+NLK ++ + E+ K             S     ++++    T+E    LTGH+  V  +++D + + S S D ++R+W   S   +  +Y H
Sbjct:  247 KYNLKKIECHSESSKGVYCLQYDDKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQYDNNVIISGSSDSTVRVWSLSSWTCVNTIYHH 339          

HSP 3 Score: 53.9138 bits (128), Expect = 4.345e-7
Identity = 59/250 (23.60%), Postives = 111/250 (44.40%), Query Frame = 1
Query: 1615 AVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSMKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDM-----DRLDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAEIQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHKGSIAYLHFFXXXXXXXXXXXXIRIWRL 2349
             VYCL +  + +VSG  D SI VW   +    +++L GH+GS+  L+           S D T+R+ S+  +       + ++      ++ +R   +  ++ T   D++I + DM      RL  +  +G++   +  + F    ++S      ++ WNT    F         + T       I  L Y    + +  +D +I+ W + + TC+RTL GH+  +  + F    + S + DG I++W L
Sbjct:  262 GVYCLQYDDKKIVSGLRDNSIKVWD-ARTLECVRVLTGHVGSVLCLQYDNNVIIS--GSSDSTVRVWSLSSW-----TCVNTIYHHCEAVLHLRFAHS--ILVTCSKDRSIAVWDMFAPSDIRLRRVL-VGHRA-AVNVVDFDQKNIVSASGDRTIKVWNTQSCEF---------LHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRFDSKYIVSGAYDGKIKVWDL 490          
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Planmine SMEST
Match: SMESG000065201.1 (SMESG000065201.1)

HSP 1 Score: 44.669 bits (104), Expect = 9.936e-6
Identity = 46/167 (27.54%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 1612 GAVYCLDFSSQILVSGGWDMSIFVWSLEQNFSLIKILYGHMGXXXXXXXXXXXXXXXXASLDGTLRIHSM-KGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDRLDCIYN-IGYQKDVIKCLYFQ---SHLLISGGHSGFLQFWNTNPSVF 2097
            GA+ C+  SS  +VSG +D ++ VW +        +L GH        +      ++SASLD T+R+  +  G     LV  KS+ S       M +    +L+ +G  D TIR+  +   +CI   +G Q         Q      ++S   SG ++ WN +  VF
Sbjct:  220 GAIRCVQASSVCVVSGSYDCTVRVWDIITGICAF-VLNGHTD--RVYTIHLGATVILSASLDTTIRVWDIHTGICTHVLVGHKSLTS------GMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVF 377          

HSP 2 Score: 24.6386 bits (52), Expect = 9.936e-6
Identity = 10/28 (35.71%), Postives = 16/28 (57.14%), Query Frame = 2
Query: 1484 RMFSSSLDGSLRIWDSISGRSIRKLYGH 1567
            ++ S S D ++RIWD  + +    L GH
Sbjct:  191 KLISGSRDSTIRIWDVFTRKCDHLLEGH 218          
The following BLAST results are available for this feature:
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXW113.864e-1323.67F-box and WD repeat domain containing 11 [Source:H... [more]
FBXW115.023e-1323.67F-box and WD repeat domain containing 11 [Source:H... [more]
FBXW115.950e-1323.67F-box and WD repeat domain containing 11 [Source:H... [more]
BTRC2.383e-1122.93beta-transducin repeat containing E3 ubiquitin pro... [more]
BTRC3.137e-1122.93beta-transducin repeat containing E3 ubiquitin pro... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-231.226e-1224.56F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-231.226e-1224.56F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-231.301e-1224.56F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-231.334e-1224.56F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-231.341e-1224.56F-box/WD repeat-containing protein lin-23 [Source... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slmb8.661e-1122.93gene:FBgn0283468 transcript:FBtr0084032[more]
slmb8.661e-1122.93gene:FBgn0283468 transcript:FBtr0333931[more]
slmb1.118e-1022.93gene:FBgn0283468 transcript:FBtr0330049[more]
Lis-11.920e-1020.17gene:FBgn0015754 transcript:FBtr0087241[more]
Lis-11.920e-1020.17gene:FBgn0015754 transcript:FBtr0304747[more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw11b1.567e-1323.75F-box and WD repeat domain containing 11b [Source:... [more]
fbxw11b1.714e-1323.75F-box and WD repeat domain containing 11b [Source:... [more]
fbxw11b1.743e-1323.75F-box and WD repeat domain containing 11b [Source:... [more]
fbxw11b1.743e-1323.75F-box and WD repeat domain containing 11b [Source:... [more]
fbxw11b1.815e-1323.75F-box and WD repeat domain containing 11b [Source:... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btrc1.243e-1022.93beta-transducin repeat containing E3 ubiquitin pro... [more]
btrc1.288e-1022.93beta-transducin repeat containing E3 ubiquitin pro... [more]
btrc1.309e-1022.93beta-transducin repeat containing E3 ubiquitin pro... [more]
btrc1.320e-1022.93beta-transducin repeat containing E3 ubiquitin pro... [more]
btrc1.353e-1022.93beta-transducin repeat containing E3 ubiquitin pro... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxw115.813e-1323.67F-box and WD-40 domain protein 11 [Source:MGI Symb... [more]
Fbxw116.452e-1323.67F-box and WD-40 domain protein 11 [Source:MGI Symb... [more]
Fbxw118.734e-1323.67F-box and WD-40 domain protein 11 [Source:MGI Symb... [more]
Btrc7.621e-1221.84beta-transducin repeat containing protein [Source:... [more]
Btrc1.059e-1121.84beta-transducin repeat containing protein [Source:... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UKB1|FBW1B_HUMAN2.638e-1223.67F-box/WD repeat-containing protein 11 OS=Homo sapi... [more]
sp|Q5SRY7|FBW1B_MOUSE5.321e-1223.67F-box/WD repeat-containing protein 11 OS=Mus muscu... [more]
sp|Q09990|LIN23_CAEEL1.407e-1124.56F-box/WD repeat-containing protein lin-23 OS=Caeno... [more]
sp|Q3ULA2|FBW1A_MOUSE6.631e-1121.84F-box/WD repeat-containing protein 1A OS=Mus muscu... [more]
sp|Q9Y297|FBW1A_HUMAN1.391e-1022.93F-box/WD repeat-containing protein 1A OS=Homo sapi... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GEN76.551e-5029.72Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DQU36.661e-5029.72Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GQQ06.942e-5029.72Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8H7A03.794e-3227.94Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GRM31.760e-3126.84Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw11a2.554e-1323.67F-box/WD repeat-containing protein 11 [Source:NCBI... [more]
fbxw11a2.699e-1323.67F-box/WD repeat-containing protein 11 [Source:NCBI... [more]
fbxw11b5.915e-1323.67F-box/WD repeat-containing protein 11-like [Source... [more]
fbxw74.127e-1023.49F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw75.371e-1022.29F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
BTRC7.008e-1124.20beta-transducin repeat containing E3 ubiquitin pro... [more]
ENSPMAT00000008862.11.881e-922.22pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MET308.736e-1032.31F-box protein containing five copies of the WD40 m... [more]
CAF41.486e-626.63WD40 repeat-containing protein associated with the... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO440933.214e-2827.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487201.051e-1323.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423063.790e-1225.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390723.164e-1025.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480041.726e-824.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw11a2.287e-1323.67F-box and WD repeat domain containing 11 [Source:N... [more]
fbxw11a2.477e-1323.67F-box and WD repeat domain containing 11 [Source:N... [more]
fbxw71.590e-1023.49F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw71.815e-1023.49F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSORLT00000003546.21.330e-822.04F-box/WD repeat-containing protein 7 [Source:NCBI ... [more]
back to top
BLAST of F-box and WD-40 domain-containing protein 1/11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025496.10.000e+098.92SMESG000025496.1[more]
SMESG000025494.11.668e-132100.00SMESG000025494.1[more]
SMESG000011456.11.235e-1426.75SMESG000011456.1[more]
SMESG000052999.11.096e-1224.84SMESG000052999.1[more]
SMESG000065201.19.936e-627.54SMESG000065201.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015580 ID=SMED30015580|Name=F-box and WD-40 domain-containing protein 1/11|organism=Schmidtea mediterranea sexual|type=transcript|length=2418bp
ATTTATTAACTTTTTATTATTATTTAAAATGAATTTTAATGAGTTTTTAA
CTTTATAAAAATAAAATTTTATTTAATCTTAAAATAAAACGAACACTTAT
TATGTCTATAGCTCAAACTTAACAGTTCTGATAAAGCAAATGTCAGAAAT
ATTTATAAAAACCGTGTTCAAATTCCAAAAATTAAAAATCCAAGAAAAAA
AATTCGTTTTATGTAGCTTTATTGGATTGATTGATCGAGAATCGCTCTAT
TCATTGAAACAGACTTTGGAACCTTTTAACTTATCAAAGTTTCAAAATCA
ATTTGGCACCATTGATTTAGGAAATAAAAATGAAGATGAAGATGAAATTC
CAAATTTACAATTGATCAGTGAAAAATTAGTCAATGAAATTCTGTCATCA
TCCGTGCGGATTGTTGAAAATGAATTCCTCTCATCCAATTCATTGGAGAA
ATTTATATTAAATACCAATAATTCAAAACTTATAGATAGTTTTGCTTTGC
CACCAATTGAGCACAAGCACGCAGTGAAATTAGATAGAAATTTACGCGGA
CAGAGCCAGAGAAGTAAAAAACAGTTGAAAGGTTTTCCTGACACAATTAA
ACTACTAATCAAGAATTTAGCTACTGAATTTTCAACTAAAATTGATAAAT
ATAAAATTTTGATTGAAATTTTATGCGCAGAAAATTGGGATATTCAATTC
CATGTTTATCAATGCGTTAAAAGCAGATTACTTGATAGATGGTCTATGGA
TTCAATTCCGACAAAAATATTGGAAAATATATTTTATTATTTTTCTCCAG
ATGAACTAATCAAAGCTTCATTGGTAAATAAACAATGGTTATCAGTAGCT
CTGAATAATGGCTTATGGGAAAATCACTGTGCAACACTGGGAAAATCGCT
TGGTTTCACAAAATTTGTAGAAATGATGGAAGAAAACATTGCCGACTCAG
CTCGAATAAATTGGTTTGAAATTTATAAAGCCATCCGGAAGTTGTCGCGT
CAAAATAATTCCGTCATTGATGTGAAAAATAATATCCGTAAATCCAAAAT
TACATTTTATGAAGCAGCGAAATCTGTTAAAATAAAATCTAAGGTGTCAA
AATTTCTTTCAAATCGGAGTACTAGTGTAAACAGTTCTAGGAGAGCTTCT
AAAACTTCTATTAAATTTAATAATGTGCTTGATCCTGATCCAGAAAATGA
TACAAGGCTGCTCATGAAACCGATCATTGGCCAATTGAAGCAGTTCCAAA
ATTCCGAGGAAATTGCAATAGATTTCAAATCATCGAATCTCGTTTCACTA
GTGGATAGCAAGAAACGTTCGGAATCGAAATTTAATTTAAAGTGGTTGGA
CTCGAATTTCGAAACTCATAAATCAGCTGCCGCCGGTGAAACTCTCCAAA
TTCGAAAGGTTTTAACCATTGAGAATTGTTATAAATTGACTGGCCATCTT
GATGGGGTTACCATGGTGAAATTTGATAAGTCAAGAATGTTTTCATCAAG
TCTTGATGGTAGTCTAAGAATTTGGGACTCAATCAGTGGAAGAAGCATCA
GAAAATTATACGGTCACAAAGTGAAGTCATATTTATCAAATTGAATTATA
TCTAAAATCAGGGAGCAGTTTATTGTCTGGATTTCTCTTCTCAGATTTTG
GTTTCAGGTGGATGGGACATGTCAATATTTGTATGGTCTCTCGAGCAAAA
TTTCAGCCTGATTAAAATACTATATGGACACATGGGCTCGATTACGTCGC
TGAAACTTTTAAAAACCAAAGAAAAATTAATTTCCGCTTCATTGGATGGC
ACATTGCGAATCCATTCCATGAAAGGTTTCAAGTTGGACAATTTAGTTAC
CATCAAATCCGTGAATAGCGAGCCAACCGGAATAATTGACATGAGAATAG
AAGAAACAAGAAATCTGATTGCTACTGGGCTCTGTGATAAGACTATAAGA
CTGATCGACATGGACCGACTTGATTGTATCTACAACATAGGATATCAAAA
GGATGTCATCAAATGCTTATATTTTCAATCACATCTATTAATATCGGGGG
GTCATTCGGGATTTTTACAATTCTGGAATACCAATCCAAGTGTTTTCCAT
GAGGCTAGCATGGCCGAGATCCAGGTTTTTACGGATAAAAAATTACCACT
ATCAATTGAATCTCTTTTTTATCATATGAGAAGTTTATGGACTGCCCATA
ATGATGGTTCAATCAAAGAATGGTATTTAGCTTCCATGACATGCATCAGA
ACCCTTTATGGACACAAAGGATCAATTGCATATCTTCATTTCTTTGATGA
TATGATGGGTTCATCAAGCCTTGACGGGTCCATTCGAATTTGGAGATTGA
AAAAATCTCATTCCAGAGAAACTCATGATGAAAAACCGCAAGTTTACAAA
GAAAAAATACCAATTAGC
back to top

protein sequence of SMED30015580-orf-1

>SMED30015580-orf-1 ID=SMED30015580-orf-1|Name=SMED30015580-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=485bp
MSEIFIKTVFKFQKLKIQEKKFVLCSFIGLIDRESLYSLKQTLEPFNLSK
FQNQFGTIDLGNKNEDEDEIPNLQLISEKLVNEILSSSVRIVENEFLSSN
SLEKFILNTNNSKLIDSFALPPIEHKHAVKLDRNLRGQSQRSKKQLKGFP
DTIKLLIKNLATEFSTKIDKYKILIEILCAENWDIQFHVYQCVKSRLLDR
WSMDSIPTKILENIFYYFSPDELIKASLVNKQWLSVALNNGLWENHCATL
GKSLGFTKFVEMMEENIADSARINWFEIYKAIRKLSRQNNSVIDVKNNIR
KSKITFYEAAKSVKIKSKVSKFLSNRSTSVNSSRRASKTSIKFNNVLDPD
PENDTRLLMKPIIGQLKQFQNSEEIAIDFKSSNLVSLVDSKKRSESKFNL
KWLDSNFETHKSAAAGETLQIRKVLTIENCYKLTGHLDGVTMVKFDKSRM
FSSSLDGSLRIWDSISGRSIRKLYGHKVKSYLSN*
back to top

protein sequence of SMED30015580-orf-2

>SMED30015580-orf-2 ID=SMED30015580-orf-2|Name=SMED30015580-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=250bp
MSIFVWSLEQNFSLIKILYGHMGSITSLKLLKTKEKLISASLDGTLRIHS
MKGFKLDNLVTIKSVNSEPTGIIDMRIEETRNLIATGLCDKTIRLIDMDR
LDCIYNIGYQKDVIKCLYFQSHLLISGGHSGFLQFWNTNPSVFHEASMAE
IQVFTDKKLPLSIESLFYHMRSLWTAHNDGSIKEWYLASMTCIRTLYGHK
GSIAYLHFFDDMMGSSSLDGSIRIWRLKKSHSRETHDEKPQVYKEKIPIS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036047F-box-like_dom_sf
IPR036322WD40_repeat_dom_sf
IPR017986WD40_repeat_dom
IPR001810F-box_dom
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030332cyclin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0019005SCF ubiquitin ligase complex
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0007088regulation of mitotic nuclear division
GO:0007096regulation of exit from mitosis
GO:0007411axon guidance
GO:0007419ventral cord development
GO:0016567protein ubiquitination
GO:0030162regulation of proteolysis
GO:0031146SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0035147branch fusion, open tracheal system
GO:0042023DNA endoreduplication
GO:0045926negative regulation of growth
GO:0060253negative regulation of glial cell proliferation
GO:0060438trachea development
GO:0071456cellular response to hypoxia
GO:1900038negative regulation of cellular response to hypoxia
GO:1903146regulation of mitophagy
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 426..463
e-value: 6.8E-5
score: 32.3
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 433..472
score: 12.48
IPR001810F-box domainSMARTSM00256fbox_2coord: 206..246
e-value: 2.2E-4
score: 30.6
IPR001810F-box domainPFAMPF12937F-box-likecoord: 204..247
e-value: 8.5E-8
score: 32.0
IPR001810F-box domainPROSITEPS50181FBOXcoord: 200..246
score: 12.597
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 365..480
e-value: 2.9E-10
score: 41.3
NoneNo IPR availableGENE3DG3DSA:1.20.1280.50coord: 188..290
e-value: 9.2E-10
score: 40.3
NoneNo IPR availablePANTHERPTHR19846WD40 REPEAT PROTEINcoord: 19..477
NoneNo IPR availablePANTHERPTHR19846:SF1coord: 19..477
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 450..464
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 433..484
score: 11.735
IPR036047F-box-like domain superfamilySUPERFAMILYSSF81383F-box domaincoord: 197..257
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 412..476