Collagen alpha-1(IV) chain

Overview
NameCollagen alpha-1(IV) chain
Smed IDSMED30015575
Length (bp)5655
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen alpha-1(IV) chain (SMED30015575) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen alpha-1(IV) chain (SMED30015575) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen alpha-1(IV) chain (SMED30015575) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen alpha-1(IV) chain (SMED30015575) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015575

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig38503newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig38503uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig42739newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig42739uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30015575h1SMcG0020983 dd_Smed_v4_2337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015575h1SMcG0020983 dd_Smed_v4_2337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015575h1SMcG0020983 dd_Smed_v4_2337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015575h1SMcG0020983 dd_Smed_v4_2337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015575h1SMcG0020983 dd_Smed_v4_2337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015575h1SMcG0020983 dd_Smed_v4_2337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig3735newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig3735uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig34709uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig34709newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0002761 Contig3736newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0002761 Contig3736uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig3736newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015575h1SMcG0020983 Contig3736uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30015575h1SMcG0020983 dd_Smed_v6_2337_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30015575h1SMcG0020983 dd_Smed_v6_2337_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30015575h1SMcG0020983 dd_Smed_v6_2337_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015575h1SMcG0020983 dd_Smed_v4_2337_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Human
Match: COL24A1 (collagen type XXIV alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:20821])

HSP 1 Score: 203.371 bits (516), Expect = 1.303e-51
Identity = 350/1096 (31.93%), Postives = 439/1096 (40.05%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDC-----------------------PKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGAN---GTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPG--SKGLPGIKGV--------QGDRGNNGTDGNCTSLGLMGERGF------PGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-------SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGER 3532
            KG+ GF       G  G QG  G  GP G++GD G  G PG  G+ G+ G  G  G IG  G  G +        G  G  G  G  G QG  G+ GE G  G EG  G+ G +G KG  G +G  G          GD+G  G+ G  G                                G++G +G  G +G  G  G  GL    G++GL GIKGD G  G  G  G PG  G++G +G  G  G+ GK+   G+ GD G          +   G  G  G     G  G KG +GN G  G  G  G +G +GP+G+    G                      RG PG KG  G+ G  G                          +KGE G  GN+  +G+ GP G PG+    G  G KG+RG  G  G    K  +                         P GS G +G  G +G  G  G+ G +GAKGE G  G +G  G   K   PGE+G +G  G  GL G  G+ G                    G  G  G  GE G+ G PGT+G++G  GE GA    GT G +G  G+ G  GEPG    E   GLQG  G+KG  G RG  GE G                    KGE G P   G+ GP+G +G+ G+                                  G VG  G+ G+PG KGD+G                           TG+ G++G  G  G+ G KG +G RG +G     G +G DG  G  G RG  GQ G  G   P    G PG  S  L              QG+RG  G +G    +G+ G RG       PG PGD G  G +G RG  G+ G  G  GP G+ G  GL G  G  G                  I+G  G  GI+G+ GKIG  G+QG+ G +G  G +        PG KG  G PG  G  G KG QG+P + G +G  G    G +GD GP GD G  G  G+ G+ G  G +G  G  G  GD G  G  G  G  G R
Sbjct:  536 KGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQ--------GLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPG--------DFGDRGPAGLDGSPGLVGGTGPPGFP---------------------GLRGSVGPVGPIGPAGIPGPMGLS---GNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQN---GPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELG---------------------PRGKPGQKGYAGEPGPEG--------------------------LKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLR------------GLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEE---GLQGKDGLKGVPGGRGLPGEDG-------------------EKGEMGLP---GIIGPLGRSGQTGL------------------------------PGPEGIVGIPGQRGRPGKKGDKG-----------------------QIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGH---LGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKG------------------IQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHR--GAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHR 1428          

HSP 2 Score: 183.726 bits (465), Expect = 1.243e-45
Identity = 366/1143 (32.02%), Postives = 467/1143 (40.86%), Query Frame = 2
Query:  479 RGPVGLKGDIGCDGEPGTVGIDGKNGTHG-TPGKI--GDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---------------PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVG---ESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPD-------------------GENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            RGP G+ G  G  G PG  G  G  G  G +PG+   G+KGD+G  G      +G  G  G++G+ G  G+ G  GE+G  GF G +G      S G  G +GL G E N  PK  +G  G  G +G+ G                                  +GE GIPG  GK G  G +G  G  GDRG  G+ G  GL G  G PG PG +G  G +G  G  G+ G     G  G+KG   I                  KG  GE G+ G +G PG  G  G +GL GP G  G     G  G PG  G  G  G EG  G  GIPG  G  G +G  G         +                 +GE+G  G   G+ GPRG PG     G PG +G +G  GD+G            G IGE G +G  G  G  G  G KG +G  G LG +G+ G                   PG  G +G  GS G  G++G  G                             G  G  GI G  G+ G  G+ G +G  G  G+ G++GF G+PGL         QG  G  GD+G  G  G +G                    +G+ G PG+MG+ GP G  GE G++G  G  G +                      T GSVG   E G  G+PG  G+EG++G+                    +   G  G +GL G  G +G  GL G  G +G++G TG  G +G  G  G RG  G+KG +G   P   +G   S+G PG  G  G +G  GT G    LGLMG  G PG PG  G  G  G  G  G  G  G  G D                   GE G  G  G KG  G                  + G+ G  G  G  G+ G +GEQG++G++G +G      +PG  G+ G PGL+G  G KG+QG    DG  GN G   IG  G  G  G  G  G  G  G  G  G++G  G  G+ G QG KG +G  G PG +G                   +G RG  G++G   +   KG  G+ G +G  GF+      G +GD G  G SG  G  G+
Sbjct:  512 RGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSG-----LMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIG------SPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGP---------------------------------EGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGP---MGLSGNKGLPGI------------------KGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKG--------------TQGEEGPIG-AFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNI----------GKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRG---------------------------PDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGL---------QGLPGSTGDRGLPGEPGLRGL-------------------QGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDV---------------------GTAGSVGGTGEPGLRGEPGAPGEEGLQGK--------------------DGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVG---SRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVG------------------VPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPG--KIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQG------------------KRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGH 1427          

HSP 3 Score: 150.599 bits (379), Expect = 1.608e-35
Identity = 297/966 (30.75%), Postives = 395/966 (40.89%), Query Frame = 2
Query:  404 IKGEQGF------PGEMGHN---GTDGQQGF------------------MGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDR---------------GPNGTF-------------------SIGTRGDNGERGINGTQG---------INGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKG---------------DDGLPGEKGTPGRPGEQGEQGKIGDK------GDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDI------GLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-------IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQ------------GIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDK---------GFSGEP------GLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDG 2902
            I+G++GF      PG+ G     G DG  G                   +G  GP G+ G +G  G  G  GI G  G  GT G++G+ G  GD+               GP+G                      IG  G NG  G  G  G         + GT+GE GP G  G +G  G  G KG  GE G +G         +G+ G++G  GK GE                                  G +G+PG++G  G+ GEKG  G PG  G +G KG                 GLPG  G  G PG QG +G+ G +      G++G+ G   E+G++G +G   +I  T    ++G +G  G +G  G  G +G  G PGL G  GD+      G++GP G  G   ++G  G  G++G  G  G  GE G RG PGA G  G +GK+G         + GE G                   KGE G  G +  +G+ G  G PG +   G+PG +G+ G KGDKG+         P G +G RG  G  G +G  G  GT+GA G    LG+ G DG    PG +G +G  G +GL G KGE GY    +  +        G +G PGP GDQGE+            G+PG+ G  GQ G  GE G  G  G+ G+RG +         G SG+P      GL   + IQG  G  GI G+ G  GP G++G                     G +G PG+ G+AG  GP G KG                               +   GS G  G  G+ G+ G  GI                           G +G++G +G+QG  G  GLKG+ GE G  G TG  G  G  G +GD G +G  G +GP       G  G +G+ G  G  G RG  G  G
Sbjct:  640 IRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEG--------LKGEVGDQGNIGKIGET---------------------------------GPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGE------------------KGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIG-------PTGEVGSRGPPGKIGKSGPKGARGTRGAVGH---LGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLG-----PPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLP-------------------GIRGGPGRTGLAGAPGPPGVKG------------------------------SSGLPGSPGIQGPKGEQGLPGQPGI--------------------------QGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRG 1456          

HSP 4 Score: 142.895 bits (359), Expect = 3.645e-33
Identity = 286/940 (30.43%), Postives = 378/940 (40.21%), Query Frame = 2
Query: 1058 KGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGK---------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGV------------IGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNG---TIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKG-------DKGDEGPSGVNGTTGYV 3772
            +G  G+PG  G PG PG  G +G    KGD G +      GE+GD+G + ++                     G  G KG  G+PGL G  G+ G+ G  G +GS                            G PG +G+ G EG  G                           KG +G+    +G  G  G  G +   G+PG++GK+GFKG +G            G  G+RG  G  G+ G  G           G+ G  G  G  GI G  G S   G  G KG KG  G  GE GE GY                         GD+G  G+PG PG  G++G +G+ G  G  G             IG  G  G  G  GL  N    G  G KG +G++G  G  GE G                       +G PG+ G AG  GP G KG                              +    G++G+ GE G  G+ G+ G+                         S G+KG +G  G  G QG KG+ G  G  G  G  G +G+ G+ G +G  G  G KG +G   P+   G+ G +G+ G KG +GD+G  G  G     G  GERGF G PG  G   + GDRG  GE G  G  G+ GP GE G  G  G +G++GL G                    G +G  G+ G +G  GE G+RG+ G     +PGE+G  G  GLKG  GG+G   +P +DG +G  G+  I    G  G +G  G  G +G  G +G  G  G +G+IG  G +G +G  G+ GK+G  G RG  G  G  G  G  G+ G  G RG  G+ G S     G  G KG +G  G  S  +             D+G+ G  G  G  G+V
Sbjct:  512 RGPRGIPGPHGNPGLPGLPGPKG---PKGDPGFSPGQPVPGEKGDQGLSGLMGPP------------------GMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSP---------------------------GYPGRQGLAGPEGNPGP--------------------------KGAQGF----IGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFP----------GDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGY------------------------PGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELG----------------------PRGKPGQKGYAGEPGPEGLKG------------------------------EVGDQGNIGKIGETGPVGLPGEVGM-----------------------TGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPD---GLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEP------------------GAKGDVGTAGSVGGTGEPGLRGEPG-----APGEEGLQGKDGLKGVPGGRG---LPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPS-----GLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHV 1230          

HSP 5 Score: 88.1965 bits (217), Expect = 1.592e-16
Identity = 182/512 (35.55%), Postives = 223/512 (43.55%), Query Frame = 2
Query: 2351 AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRG---------------------------DQGIKGGSSP-GEKGEVGS------PGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGM---NGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGF---KSINITHGDKGDKGDEGPSGVNGTTG 3766
             GP G  G +GI G  G  G  G  G  G  G+ G    Q      G  G SG  G PGM+GD+G+                             KG+ GL G  G QG  G  G  G  G  G  G  G +GN G KG +G IG  G  G   P    GIPG +G  G KG QG  G+ G  G     GL G  G  G  G  G  G RG  G +G  G  G  GP G +G +GL G KGD G  GT                G +GE G  G KG +G  G  G+RG                           D GI G + P G KG +G+      PGLKG  G +G  G   + G RG  G    G  G+ GP+G  G +GD+G+ G     G +GL GE+G  G+IG++GE+G  G  G  GE+G +G  G  G  G IG  G  G  G  G  G     ++G  GQ+G RG  G    + I    G+KGD+G  GP G+ G TG
Sbjct:  506 PGPSGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGL-----------------------------KGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPA---GLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGT---------------AGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPG--QKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPG-----SQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTG 963          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 196.823 bits (499), Expect = 1.081e-49
Identity = 378/1251 (30.22%), Postives = 485/1251 (38.77%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK-----NGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGR--IGEKGLKG-------------------------KEANKPKI--QEGDKGEKGMSGKDGEN--CTDTGRSSNFYXXXXXXXXXXXXXXXXX----------XXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGD--------------------DGLPGEKGTPGRPGEQGE-----------------QGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD-IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK-------IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG----------------ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +G QG PG+ G  GT G  G  G++G  G KGDIG  G    + IDG       G  G PG  G KGDEG            +G  G  G+ G   ++G  G  GP+GF G   + G +G+ GR  IG  GL G                         KE+  P +  ++G KG  G+ G  G++  C   G   N                               G QG  G PG +G  G  G KG         ++G+PGDRG       +G+ G+                     G PGEKG PG PGE+G                  +G  GDKG  GL G   ++G  G KG    + C                   G  G  G  G PG  G  G  GL G  G  GS   KG  G PG +      G  G +G +G+PG  G+ GK+G  G +  G  G                  + G KG  G++ G E   G PG+   +G+ G+ G +GF GD G    K       G  G  G  G++G+ G PG+ G  G  G +G  GIKGK G    PG  G  G  G  G  G+KG  G I +                         G +G+PG PG  G  G+ G  G  G   + G +G+KG   F G PG+     I G +G KGI G  G  GPSG  G   +                KG++G PG +G+  P  P     +K                                 GS G +G +G PG +GD+G               + G  +            G +G  GLKG+ G  GF G+ GE G  G  G+ G  G  G  G KGD G  +   G  GP       G  G+KG  G+ G  G  GN G DG     G +G  G PG PG  G  G+ G  G  G  G IG  G  G  G +G  G  G  GLNG +             I GV G  G+ G KG+       IGA G+ G+RG +G +G   PG +G  G PG  G      + G P   GR G  G                 +  G  GD G  G  G  G +GD+G+ G  GL GE+G  G  G+ G  G  GK             G  G+ G  G  G  G RG  G +GD   +   +  Q    G  G   I+   G  GD G +GP G+ G+ G 
Sbjct:  308 EGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEG-----------IQGLRGPSGVPGLPALSGVPGALGPQGFPG---LKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPG---QQGLPGSKGIT--LPCIIP----------------GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMI--GSPG------------------LPGSKGATGDIFGAE--NGAPGE---QGLQGLTGHKGFLGDSGLPGLKGV----HGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGL---------------------PGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGE----------------KGDRGNPGPVGIPSPRRPMSNLWLK------------------------------GDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNG-LPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRG--FPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKV------------GPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGL 1411          

HSP 2 Score: 182.57 bits (462), Expect = 3.088e-45
Identity = 96/259 (37.07%), Postives = 131/259 (50.58%), Query Frame = 2
Query: 4649 IKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTK-PLGETFGTQMELEKTISRCRVCVKNM 5416
            ++G  G +G PG  G  G+ G      R      +H Q         CP G + +  GYS +   G E     DLG   SCL +FS  P I+C+    CH+  RN +SYWLS+  PI   PV   ++   ISRC VC AP+   A H Q       CP  W  LW GYS +MHT+  ++GG Q L SPGSCLE  R  P IEC+     CH + +   ++L  V +   F + P+ ET     +L   +SRC+VC+K++
Sbjct: 1438 LQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQ---SEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQ-CPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETL-KAGQLHTRVSRCQVCMKSL 1691          

HSP 3 Score: 160.614 bits (405), Expect = 1.315e-38
Identity = 382/1289 (29.64%), Postives = 505/1289 (39.18%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDI---------------GCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEK------GTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEG---------------------VPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGDKG------TTGFPGKNGTKGAKGENGTLGIKGKD-----------------------GTSEKPGEK--------------------GRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANG------TNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAED-CNATSKVKANEFKDRNKGEKGFPGKMGV---AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGV---------------QGDRGNNGTDG------NCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGD----------------NGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQG--IKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINI----------THGDKGDKGDEGPSGVNGTTGY 3769
            +KGE+GFPG +G  G  G +G MG  G +G+ G                 GC+G  G VG  G +G  G  G  G  G +G +G +   + G+    G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +      G  G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   +  GV              +     R   GA G+ G++G  G        S   E       +    G++GE+G  GN +G +G +GD G  + +G                     +PG+KG R   GD+G    +     P   G +G  G  G KG        G PG  G  G++G  G +G  GKD                       G    PGEK                    G  G KG +GL G++G  G    T   I  G  G  G  G PG  G +G +G+PG PG  G +G+ GE G+ G        G  G RG+KG  G PGL   + + G+ G  G+ G KG    +G+   AE+       ++         G+ G PG  GV    G +GP GE+G                    G  G+ G+ G   ++G  G  G+ G PG  G  GI                           G    KGL G +G  G  GL G +G  G  G  G   + G  G KG  G +G  GI G        GIPG++GL GI G                +GDRGN G  G        ++L L G++G  G+ G NG  G RG +GE G                  G  G  GP G  G RGL G KG +G+ G              G+ G  G +GI GS G  GA G  G++GD G  ++   SPG KG+ G  G KG  G         +DG  GN G    G KG+ G  G +G +G  G  G  G  G+ GE G  G+ G QG  G  G  GL G +G  G  G+ G  G        G +G  G  G S+    G  G  G +G +G+  I I            GD+G  G +GP+G+ G  G 
Sbjct:   75 LKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKG-DPVLAPGSF--KGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALS-GVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGN-LGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGAR---GDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGA---TGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERG------------------SPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGI-----------SGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG------LPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGF------------PGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKG---------RDGLIGNIGFP--GNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGL------PGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGI 1248          

HSP 4 Score: 158.688 bits (400), Expect = 4.673e-38
Identity = 369/1281 (28.81%), Postives = 482/1281 (37.63%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK---------------NGTHGTPGKIGDKGDEG------------DRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEKG------TPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGT----LIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKG--------------EAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPG-----TDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNE------TIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVA---GPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKG---NKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG---------------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERG------FPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQ----------------------------------GIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-----------IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPS--GVNGTTGY 3769
            G QGF G  G +G  G++GF G  GP G KGD G  G PG +GI+G                +G +GT G +G  G +G             +G  G   +      G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +G        G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   + G                 G  G +G PG KG  G  G+       L   +              +     +  ++  +  + G++GP+G+       G+ G+KG  GF    G                     L   KG+ G+RG  G +G  G PG  G  G  G  G  G          PG++G  GS+G  G++GE G+ G           G+ G+             GE+G+PG+PG            NG  G  G  G+ GD+G  G  G+ GL  ++       I G  G  G  G  G  GP G +G                   +KGE G PG + +    G  GP GEKG+                                  G  G  G+DG PGM G  G+ G  G  G I G              TG KG   + GL G +G  G  GL G +GE G  GT G++G  G  G+ G  G  G+ G+ G                     P       G+PG KGLPG  G+ G +G+ G+ G      L G +G      F G PG  G  G  G RG  G  G+ G  GP G  GT    GEKGD G  G +G+  P        ++G  G +G  GS G  G RG++                                  GIRG  G+KG S     PG  GE GS G++G  G  G  G+P   G  G T   +            G KG  G DG  G IG  G+KG +G +G+ G++G  G  G  G  G RG+ GLPG                     + G +G IG  G     + G IG KG  G  G   +N   G KG  G  GPS  GV G  G 
Sbjct:   62 GPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSG---------------VPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGN------LGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGF----------PGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLP-------GTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGL---------------------------------PGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGT---PGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPG---------------------SSGHQGAIGPLG-----SPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGL 1202          

HSP 5 Score: 157.147 bits (396), Expect = 1.552e-37
Identity = 290/970 (29.90%), Postives = 366/970 (37.73%), Query Frame = 2
Query:  416 QGFPGEMGHNGTDGQQGFMGYRG---PVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI---QEGDKGEKGMSGKDGEN--CTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNG------TDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE-GETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSS----------------------EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENG-TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGE------KGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGD------KGFSGEPGLHSNETIQGLQG--------YKGIKGDKGNRGPSGEKGWA-EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGE------RGEIGQNGTTGRI------------GMDGNNGTKGDRGDIGQ----------------------------KGIQGPSNPNATMGIPGSKGLPGIKG---VQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE 2995
            +G PG+ G +G  GQQG  G +G   P  + G  G  G PGT G  G  G+ G PG  G  G           S G++G+ G  G+     + G  G RG KG  G  G+ G  G  G IG  GL G +     I   + G  GE+G+ G  G      D+G                          ++G  G PG LG  G      T G+ G  G PG  G  GIKG  GLPG  G PG  G  G++G  G KG  G   K    G +G  G   ++    +    G  G     G  GE GS G +G PG+ G  G  G +G                                  +GIPG+ G  G  G+ GT  E G+ G+ G  G    +   +   +KG+KG  G+    G  GPRGD G+                          G PG  G RG  G KG +        P    GE G  G +G+ G PG +G  G KG+NG T+ I G  G   +PGE G KG+KG +GL+G       KGE G +  +                      D G  G PG PG  G  G  G  G++G  G IG  G       KGF G PGLH    + G +G          G+ G  G  GP GEKG+      A  K          KG++GFPG   + GP G  G  GI                                 +   G+ G+ G+PG+ G+                              G  G KG KG+QG  GF GL GE      RGE G  GT G++            G  G  G+ G +GD GQ                             G QGP      +G+ GSKGLPGI G     G  G  G  G+    GL G  GF G PG  G  G  G  G+
Sbjct:  630 RGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPG-----------SSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPG-----------------------LKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRG---------------------------------LKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMP----GESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSG---------------------DVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRG----QKGDRGFPG---LQGPAGLPGAPGIS------------------------------LPSLIAGQPGDPGRPGLDGER--GRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGP------VGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQ 1462          

HSP 6 Score: 150.599 bits (379), Expect = 1.621e-35
Identity = 345/1093 (31.56%), Postives = 445/1093 (40.71%), Query Frame = 2
Query:  413 EQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------------EPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG--------------TKGSKGRIGEKGLKGKEANKPKIQ------------------EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGDDGLPGEKGTPGRPGEQGEQGKI-----GDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKG----IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGL-KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDG---NNGTKGDRGDIGQKGIQG------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG----TIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSS-------------PGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI 3361
            E GFPG  G  G  G  G  G +G  G      CDG                      PG  G  G  G+ G  G  G  G  G  GP+G      +G  GE  ++  QG+ G +G+ G +GF G +G  G                G +G  GEKGL G    K                       GDKG+ G+ G+ G   +          GS G SG  G+ G  G +G +G  G PG+ G +G+ GE G         L G PG RG        G+ G DGLPG  G+PG PG +G  G I     G  G++GL G    +G  GD G   +          G KG +      G  G+ G +G PG  G++G  G+KG  G  G+    G  G PG+ G +GK+G  G    +G+PG KG+ G  G  G  ++G  GS       G  G  A  G KGEKG  G V       G PG     G+PG +G +G  G  G+           G  G  G  G+KG  G PG  G    +     L +KG         +KG +GS GSNG  G +G+ G   R       G  G  G           G+ G PG  G  G  G  G  G  G  G+ G+ G +G  G PGL     + GL+G  G    I G  G +G  GE G+          K  + +D   G  GFPG  G  G VG +G+ G+ G  G  G  G +G+ G  G  G QG  G   + G +G  G  G PG+ G  G+ G  GT G  G                G+KG  G+  G  G+ G +G KG+RG  G  G  G  G  G    +   G  GD G+ G+ G            P  P++  G  G  G PGI G +G +G+ G              GF G PG+ G  G RG  G MG  G +G  G  G  G +G  G +G +GL G    T          G  G+ G+ G  G+ G  G  G  G QG +G  GI G                PG  G  G PG +G  G +G  GMP   G+    G T +
Sbjct:  454 ESGFPGLRGEQGPKGNLGLKGIKGDSGF---CACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP-----KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGER------GSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVG--LKGSPGS------PGVAGLPALSGPKGEKGSVGFV-------GFPGIPGLPGIPGTRGLKGIPGSTGKM----------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKG---------DKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGV-----SGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGF----------KGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIP------------GFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLV 1471          

HSP 7 Score: 113.235 bits (282), Expect = 3.835e-24
Identity = 217/693 (31.31%), Postives = 279/693 (40.26%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------EPGTV---GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN----------KPKIQEGDKGEKGMSGKDGENCTDTGRSSN-FYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG------LEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDG------PLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP-----------------------------------------KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGK---DGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXD---------QGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQG 2200
            +G  G PG++G  GT G  G  G +G  GL G  G  G                PG++   G+ G  G  G PG +G KG  G  G  G  ++ G +G+ G  G  G  GI G  G  G +G +G  G  G  G  GR G  G KG   N          +P      KG+KG  G  G N     R                        +G+ G+ G PG +G  G  G KG        G+PG+ G +GI+G  GLPG  G PG  G+ G+  +I   G  G  G+  E G +G KG   +I       +KG  G  G     G++G  G+ G PG+ G  G+ GL G  G      PLGS  + G          KG  G  G  G  G+PG KG  G  G + T + G  G                 G KGEKGY G  +G  G  G  G     G PG++G  G  G  G +        P                                          G  G +GD G  G +G PG+ G KG +GE G +G  GK    G    PG KG+ G +GS+GL G+ G+       A  +  G  G  G  G PG  GD         QG +G+PGIPG DG +G  G  GA G  G+ G +G  GF G PG      + G+ G
Sbjct:  800 RGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI--SGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVS---GDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIG---------PKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAG---------------LPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQT--PTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPG 1461          

HSP 8 Score: 92.0485 bits (227), Expect = 1.115e-17
Identity = 201/675 (29.78%), Postives = 265/675 (39.26%), Query Frame = 2
Query: 2048 IPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----------IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRI------------------GMDGNNGTKGDRGD------IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDG-----------------------NCTSLGLMGERGFPGTPGD--------------------NGTIGDRGRRGEMGDNG------------TIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKG-----VQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IPG+PG        G MG+ G  G  G +G KG  G PGL+         G++GI+G KG+ G  G   + +   A   +  N       G  G  G  G+ G  GP+G  G+                               A +G  G  G  G PG+KGD+G           + G +G  G  G  G    E         + G  GL+G QG +G  GLKG +G+ G     G +                  G+ G  G +GDRG        G  G+ GP  P+   G  G   L  I+G+ GDRG++G+ G                            G  GE+G PG PG+                     G  GD+G+ G  G  G              G+ GP G  GT G  G KG  GL GT G  G  G KG  G  G++    + G  G    RGE+G+ G  G+ G    G  G +GSPGL G  G  G       G P + G +G TG        GL G  G  G  G +G +G++G  GT    G++G  GT G  G  G +GK+GLPG  G  G  G  G+ G  GK G  G   K G  G   +    G +G KG  G+ G   +    G KG+K         G+ G+V
Sbjct:  295 IPGLPGP------RGPMGSEGVQGPPGQQGKKGTLGFPGLN---------GFQGIEGQKGDIGLPGPDVFIDIDGAV--ISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP------------------------------ALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPG---PRGEKGLPGFPGLPGKD--GLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGT---PGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEK---------GSVGFV 905          

HSP 9 Score: 59.6918 bits (143), Expect = 7.062e-8
Identity = 98/302 (32.45%), Postives = 124/302 (41.06%), Query Frame = 2
Query:  407 KGEQGFPG-------EMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIG-------TRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP-------KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD------RGLKGIKGDDGLPGEKGTPG---RPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT 1222
            KGE+G+PG       + G  G  G +GF G +GP GL         PG  GI   +   G PG  G  G +G+RG  G             +GD G+ G  G  G  G KG++G  GF G  G  G KG +G  G  G  GK            K + G +G  G+ G  G+  T T  +              G  G  G  GI G  G PG  G  G  G KGL GIPG        G  G  GD GLPG +G PG    PG+QG  G  G  G     G  + +  + ++     I  +
Sbjct: 1206 KGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGL---------PGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQ--TPTAEAVQV---------PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMS 1487          

HSP 10 Score: 56.225 bits (134), Expect = 7.398e-7
Identity = 131/393 (33.33%), Postives = 176/393 (44.78%), Query Frame = 2
Query: 2654 KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGL------PGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE--MGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG--------------GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            KG +GR G  G++G  G  G  G+TG  G+ G  G  G  G  G KG +GP      MG+PG  G+      PG  G +G  G +G +G   ++G  G  G+PG  G  G  G +G +G+  +      G  G  G  G  G+TG +G  G  G +G  GP G +G  G  G +G  G  G    +G +GE+G++GD G+ G              G   G+KG  G PG KG+ G  G  G P              G+ G  GP    G +G EG +G  G  G +G +G  G  G QG +G++G  GLPG         +  +      SGN GD G  G  G      KGD G +G RG  G   +    G  G  G +G  G+ G  G
Sbjct:   46 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGP------MGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMG----LGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP---RGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPD-------VFIDIDGAVISGNPGDPGVPGLPG-----LKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQG 413          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 195.667 bits (496), Expect = 2.507e-49
Identity = 377/1253 (30.09%), Postives = 486/1253 (38.79%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK-----NGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGR--IGEKGLKG-------------------------KEANKPKI--QEGDKGEKGMSGKDGEN--CTDTGRSSNFYXXXXXXXXXXXXXXXXX----------XXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGD--------------------DGLPGEKGTPGRPGEQGE-----------------QGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXV--GEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD-IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK-------IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG----------------ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +G QG PG+ G  GT G  G  G++G  G KGDIG  G    + IDG       G  G PG  G KGDEG            +G  G  G+ G   ++G  G  GP+GF G   + G +G+ GR  IG  GL G                         KE+  P +  ++G KG  G+ G  G++  C   G   N                               G QG  G PG +G  G  G KG         ++G+PGDRG       +G+ G+                     G PGEKG PG PGE+G                  +G  GDKG  GL G+    G +GD        C +            +   +  G  G  G  G PG  G  G  GL G  G  GS   KG  G PG +      G  G +G +G+PG  G+ GK+G  G +  G  G                  + G KG  G++ G E   G PG+   +G+ G+ G +GF GD G    K       G  G  G  G++G+ G PG+ G  G  G +G  GIKGK G    PG  G  G  G  G  G+KG  G I +                         G +G+PG PG  G  G+ G  G  G   + G +G+KG   F G PG+     I G +G KGI G  G  GPSG  G   +                KG++G PG +G+  P  P     +K                                 GS G +G +G PG +GD+G               + G  +            G +G  GLKG+ G  GF G+ GE G  G  G+ G  G  G  G KGD G  +   G  GP       G  G+KG  G+ G  G  GN G DG     G +G  G PG PG  G  G+ G  G  G  G IG  G  G  G +G  G  G  GLNG +             I GV G  G+ G KG+       IGA G+ G+RG +G +G   PG +G  G PG  G      + G P   GR G  G                 +  G  GD G  G  G  G +GD+G+ G  GL GE+G  G  G+ G  G  GK             G  G+ G  G  G  G RG  G +GD   +   +  Q    G  G   I+   G  GD G +GP G+ G+ G 
Sbjct:  307 EGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEG-----------IQGLRGPSGVPGLPALSGVPGALGPQGFPG---LKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGD------CCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMI--GSPG------------------LPGSKGATGDIFGAE--NGAPGE---QGLQGLTGHKGFLGDSGLPGLKGV----HGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGL---------------------PGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGE----------------KGDRGNPGPVGIPSPRRPMSNLWLK------------------------------GDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNG-LPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRG--FPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKV------------GPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGL 1427          

HSP 2 Score: 182.57 bits (462), Expect = 2.768e-45
Identity = 96/259 (37.07%), Postives = 131/259 (50.58%), Query Frame = 2
Query: 4649 IKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTK-PLGETFGTQMELEKTISRCRVCVKNM 5416
            ++G  G +G PG  G  G+ G      R      +H Q         CP G + +  GYS +   G E     DLG   SCL +FS  P I+C+    CH+  RN +SYWLS+  PI   PV   ++   ISRC VC AP+   A H Q       CP  W  LW GYS +MHT+  ++GG Q L SPGSCLE  R  P IEC+     CH + +   ++L  V +   F + P+ ET     +L   +SRC+VC+K++
Sbjct: 1454 LQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQ---SEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQ-CPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETL-KAGQLHTRVSRCQVCMKSL 1707          

HSP 3 Score: 154.451 bits (389), Expect = 1.074e-36
Identity = 370/1298 (28.51%), Postives = 482/1298 (37.13%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK---------------NGTHGTPGKIGDKGDEG------------DRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEKG------TPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGT----LIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKG--------------EAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTD--------------------GQNGTNGEMGANGTNGVIGDRGD-------KG-FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVA---GPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKG---NKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG---------------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERG------FPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQ----------------------------------GIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-----------IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPS--GVNGTTGY 3769
            G QGF G  G +G  G++GF G  GP G KGD G  G PG +GI+G                +G +GT G +G  G +G             +G  G   +      G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +G        G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   + G                 G  G +G PG KG  G  G+       L   +              +     +  ++  +  + G++GP+G+       G+ G+KG  GF    G                     L   KG+ G+RG  G +G  G PG  G  G  G  G  G          PG++G  GS+G  G++GE G+ G           G+ G+             GE+G+PG+PG                      G  G  G+ G  G  G+ G +GD       KG    E G+     I G  G  G  G  G  GP G +G                   +KGE G PG + +    G  GP GEKG+                                  G  G  G+DG PGM G  G+ G  G  G I G              TG KG   + GL G +G  G  GL G +GE G  GT G++G  G  G+ G  G  G+ G+ G                     P       G+PG KGLPG  G+ G +G+ G+ G      L G +G      F G PG  G  G  G RG  G  G+ G  GP G  GT    GEKGD G  G +G+  P        ++G  G +G  GS G  G RG++                                  GIRG  G+KG S     PG  GE GS G++G  G  G  G+P   G  G T   +            G KG  G DG  G IG  G+KG +G +G+ G++G  G  G  G  G RG+ GLPG                     + G +G IG  G     + G IG KG  G  G   +N   G KG  G  GPS  GV G  G 
Sbjct:   61 GPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSG---------------VPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGN------LGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGF----------PGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLP-------GTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGL---------------------------------PGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGT---PGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPG---------------------SSGHQGAIGPLG-----SPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGL 1218          

HSP 4 Score: 152.14 bits (383), Expect = 5.673e-36
Identity = 345/1110 (31.08%), Postives = 445/1110 (40.09%), Query Frame = 2
Query:  413 EQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------------EPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG--------------TKGSKGRIGEKGLKGKEANKP------------------------KIQEGDKGEKGMSGKDGENC--------TDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG------------LEGIPGDRG------LKGIKGDDGLPGEKGTPGRPGEQGEQGKI-----GDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKG----IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGL-KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDG---NNGTKGDRGDIGQKGIQG------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG----TIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSS-------------PGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI 3361
            E GFPG  G  G  G  G  G +G  G      CDG                      PG  G  G  G+ G  G  G  G  G  GP+G      +G  GE  ++  QG+ G +G+ G +GF G +G  G                G +G  GEKGL G    K                         K ++G  G++G+ G  G+ C         DT R         G  G  G  G  G  G +G  G+PG  G+ G+ G KG            L G PG RG        G+ G DGLPG  G+PG PG +G  G I     G  G++GL G    +G  GD G   +          G KG +      G  G+ G +G PG  G++G  G+KG  G  G+    G  G PG+ G +GK+G  G    +G+PG KG+ G  G  G  ++G  GS       G  G  A  G KGEKG  G V       G PG     G+PG +G +G  G  G+           G  G  G  G+KG  G PG  G    +     L +KG         +KG +GS GSNG  G +G+ G   R       G  G  G           G+ G PG  G  G  G  G  G  G  G+ G+ G +G  G PGL     + GL+G  G    I G  G +G  GE G+          K  + +D   G  GFPG  G  G VG +G+ G+ G  G  G  G +G+ G  G  G QG  G   + G +G  G  G PG+ G  G+ G  GT G  G                G+KG  G+  G  G+ G +G KG+RG  G  G  G  G  G    +   G  GD G+ G+ G            P  P++  G  G  G PGI G +G +G+ G              GF G PG+ G  G RG  G MG  G +G  G  G  G +G  G +G +GL G    T          G  G+ G+ G  G+ G  G  G  G QG +G  GI G                PG  G  G PG +G  G +G  GMP   G+    G T +
Sbjct:  453 ESGFPGLRGEQGPKGNLGLKGIKGDSGF---CACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP-----KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGER------GSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVG--LKGSPGS------PGVAGLPALSGPKGEKGSVGFV-------GFPGIPGLPGIPGTRGLKGIPGSTGKM----------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKG---------DKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGV-----SGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGF----------KGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIP------------GFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLV 1487          

HSP 5 Score: 113.62 bits (283), Expect = 2.679e-24
Identity = 210/672 (31.25%), Postives = 269/672 (40.03%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSN-FYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEK------GLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPD------GPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDL------------------GDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYIN-------RTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPG------------LHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA 2260
            + G  GFPG  GH G  G +G  G  G +  KG  G  G PG  G+ G  G+ G+PG  G     G +G  G+   +G  G  G  GI GT+G+ G  G  G  G  G  G  G KG +G  G  G+      +P      KG+KG  G  G N     R                        +G+ G+ G PG +G  G  G K      G  G+PG+ G +GI+G  GLPG  G PG  G+ G+  +I   G  G  G+  E G +G KG   +I       +KG  G  G     G++G  G+ G PG+ G  G+ GL G        GPLGS  + G          KG  G  G  G  G+PG KG  G  G + T + G  G                 G KGEKGY G  +G  G  G  G     G PG++G  G  G  G +        P   G  G  G+                   GD G  GFPG  G KG KG+ G  G  G       PGE G KG +G  G +G  G++G          +  A        +      P     Q   G  G+PG DG  G  G+ GA G    +G +G KG  G PG               +  + GLQG  G +G  G +GP G  G  
Sbjct:  845 LPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGI--PSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI--SGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVS---GDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIG---------PKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAG---------------LPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSG------LPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGP---VGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMP 1476          

HSP 6 Score: 113.235 bits (282), Expect = 4.016e-24
Identity = 217/693 (31.31%), Postives = 279/693 (40.26%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------EPGTV---GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN----------KPKIQEGDKGEKGMSGKDGENCTDTGRSSN-FYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG------LEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDG------PLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP-----------------------------------------KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGK---DGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXD---------QGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQG 2200
            +G  G PG++G  GT G  G  G +G  GL G  G  G                PG++   G+ G  G  G PG +G KG  G  G  G  ++ G +G+ G  G  G  GI G  G  G +G +G  G  G  G  GR G  G KG   N          +P      KG+KG  G  G N     R                        +G+ G+ G PG +G  G  G KG        G+PG+ G +GI+G  GLPG  G PG  G+ G+  +I   G  G  G+  E G +G KG   +I       +KG  G  G     G++G  G+ G PG+ G  G+ GL G  G      PLGS  + G          KG  G  G  G  G+PG KG  G  G + T + G  G                 G KGEKGY G  +G  G  G  G     G PG++G  G  G  G +        P                                          G  G +GD G  G +G PG+ G KG +GE G +G  GK    G    PG KG+ G +GS+GL G+ G+       A  +  G  G  G  G PG  GD         QG +G+PGIPG DG +G  G  GA G  G+ G +G  GF G PG      + G+ G
Sbjct:  816 RGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI--SGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVS---GDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIG---------PKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAG---------------LPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQT--PTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPG 1477          

HSP 7 Score: 85.5001 bits (210), Expect = 9.572e-16
Identity = 201/692 (29.05%), Postives = 265/692 (38.29%), Query Frame = 2
Query: 2048 IPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDE-----------GIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRI------------------GMDGNNGTKGDRGD------IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDG-----------------------NCTSLGLMGERGFPGTPGDN--------------------GTIGDRGRRGEMGDNG-----------------------------TIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKG-----VQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IPG+PG        G MG+ G  G  G +G KG  G PGL+         G++GI+G KG+ G  G   + +   A   +  N       G  G  G  G+ G  GP+G  G+                               A +G  G  G  G PG+KGD+           G+ G +G  G  G  G    E         + G  GL+G QG +G  GLKG +G+ G     G +                  G+ G  G +GDRG        G  G+ GP  P+   G  G   L  I+G+ GDRG++G+ G                            G  GE+G PG PG+                     G  GD+G+ G  G  G                               G+ GP G  GT G  G KG  GL GT G  G  G KG  G  G++    + G  G    RGE+G+ G  G+ G    G  G +GSPGL G  G  G       G P + G +G TG        GL G  G  G  G +G +G++G  GT    G++G  GT G  G  G +GK+GLPG  G  G  G  G+ G  GK G  G   K G  G   +    G +G KG  G+ G   +    G KG+K         G+ G+V
Sbjct:  294 IPGLPGP------RGPMGSEGVQGPPGQQGKKGTLGFPGLN---------GFQGIEGQKGDIGLPGPDVFIDIDGAV--ISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP------------------------------ALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGDCCCREVGKGDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPG---PRGEKGLPGFPGLPGKD--GLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGT---PGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEK---------GSVGFV 921          

HSP 8 Score: 59.6918 bits (143), Expect = 6.286e-8
Identity = 98/302 (32.45%), Postives = 124/302 (41.06%), Query Frame = 2
Query:  407 KGEQGFPG-------EMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIG-------TRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP-------KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD------RGLKGIKGDDGLPGEKGTPG---RPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT 1222
            KGE+G+PG       + G  G  G +GF G +GP GL         PG  GI   +   G PG  G  G +G+RG  G             +GD G+ G  G  G  G KG++G  GF G  G  G KG +G  G  G  GK            K + G +G  G+ G  G+  T T  +              G  G  G  GI G  G PG  G  G  G KGL GIPG        G  G  GD GLPG +G PG    PG+QG  G  G  G     G  + +  + ++     I  +
Sbjct: 1222 KGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGL---------PGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQ--TPTAEAVQV---------PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMS 1503          

HSP 9 Score: 56.6102 bits (135), Expect = 6.641e-7
Identity = 131/393 (33.33%), Postives = 176/393 (44.78%), Query Frame = 2
Query: 2654 KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGL------PGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE--MGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG--------------GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            KG +GR G  G++G  G  G  G+TG  G+ G  G  G  G  G KG +GP      MG+PG  G+      PG  G +G  G +G +G   ++G  G  G+PG  G  G  G +G +G+  +      G  G  G  G  G+TG +G  G  G +G  GP G +G  G  G +G  G  G    +G +GE+G++GD G+ G              G   G+KG  G PG KG+ G  G  G P              G+ G  GP    G +G EG +G  G  G +G +G  G  G QG +G++G  GLPG         +  +      SGN GD G  G  G      KGD G +G RG  G   +    G  G  G +G  G+ G  G
Sbjct:   45 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGP------MGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMG----LGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP---RGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPD-------VFIDIDGAVISGNPGDPGVPGLPG-----LKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQG 412          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 194.126 bits (492), Expect = 7.217e-49
Identity = 377/1239 (30.43%), Postives = 482/1239 (38.90%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK-----NGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGR--IGEKGLKG-------------------------KEANKPKI--QEGDKGEKGMSGKDGEN--CTDTGRSSNFYXXXXXXXXXXXXXXXXX----------XXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGD--------------------DGLPGEKGTPGRPGEQGE-----------------QGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD-IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK-------IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG----ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +G QG PG+ G  GT G  G  G++G  G KGDIG  G    + IDG       G  G PG  G KGDEG            +G  G  G+ G   ++G  G  GP+GF G   + G +G+ GR  IG  GL G                         KE+  P +  ++G KG  G+ G  G++  C   G   N                               G QG  G PG +G  G  G KG         ++G+PGDRG       +G+ G+                     G PGEKG PG PGE+G                  +G  GDKG  GL G   ++G  G KG    + C                   G  G  G  G PG  G  G  GL G  G  GS   KG  G PG +      G  G +G +G+PG  G+ GK+G  G +  G  G                  + G KG  G++ G E   G PG+   +G+ G+ G +GF GD G    K       G  G  G  G++G+ G PG+ G  G  G +G  GIKGK G    PG  G  G  G  G  G+KG  G I +                         G +G+PG PG  G  G+ G  G  G   + G +G+KG   F G PG+     I G +G KGI G  G  GPSG  G   +                KG++G PG +G+  P  P     +K                                 GS G +G +G PG +GD+G               + G  +            G +G  GLKG+ G  GF G+ GE G  G  G+ G  G  G  G KGD G  +   G  GP       G  G+KG  G+ G  G  GN G DG     G +G  G PG PG  G  G+ G  G  G  G IG  G  G  G +G  G  G  GLNG +             I GV G  G+ G KG+       IGA G+ G+RG +G +G   PG +G  G PG  G      + G P   GR G  G        G  G  GP  + G  GD G  G+ G  GL GE+G  G  G+ G  G  GK             G  G+ G  G  G  G RG  G +GD   +   +  Q    G  G   I+   G  GD G +GP G+ G+ G 
Sbjct:  307 EGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEG-----------IQGLRGPSGVPGLPALSGVPGALGPQGFPG---LKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPG---QQGLPGSKGIT--LPCIIP----------------GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMI--GSPG------------------LPGSKGATGDIFGAE--NGAPGE---QGLQGLTGHKGFLGDSGLPGLKGV----HGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGL---------------------PGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGE----------------KGDRGNPGPVGIPSPRRPMSNLWLK------------------------------GDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNG-LPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRG--FPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGFSGLPGELGLKGMRGEPGFMGTPGKV------------GPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGL 1398          

HSP 2 Score: 182.185 bits (461), Expect = 3.224e-45
Identity = 96/259 (37.07%), Postives = 131/259 (50.58%), Query Frame = 2
Query: 4649 IKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTK-PLGETFGTQMELEKTISRCRVCVKNM 5416
            ++G  G +G PG  G  G+ G      R      +H Q         CP G + +  GYS +   G E     DLG   SCL +FS  P I+C+    CH+  RN +SYWLS+  PI   PV   ++   ISRC VC AP+   A H Q       CP  W  LW GYS +MHT+  ++GG Q L SPGSCLE  R  P IEC+     CH + +   ++L  V +   F + P+ ET     +L   +SRC+VC+K++
Sbjct: 1425 LQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQ---SEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQ-CPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETL-KAGQLHTRVSRCQVCMKSL 1678          

HSP 3 Score: 160.999 bits (406), Expect = 1.031e-38
Identity = 382/1288 (29.66%), Postives = 505/1288 (39.21%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDI---------------GCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEK------GTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEG---------------------VPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGDKG------TTGFPGKNGTKGAKGENGTLGIKGKD-----------------------GTSEKPGEK--------------------GRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANG------TNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAED-CNATSKVKANEFKDRNKGEKGFPGKMGV---AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGV---------------QGDRGNNGTDG------NCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGD----------------NGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQG--IKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINI----------THGDKGDKGDEGPSGVNGTTG 3766
            +KGE+GFPG +G  G  G +G MG  G +G+ G                 GC+G  G VG  G +G  G  G  G  G +G +G +   + G+    G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +      G  G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   +  GV              +     R   GA G+ G++G  G        S   E       +    G++GE+G  GN +G +G +GD G  + +G                     +PG+KG R   GD+G    +     P   G +G  G  G KG        G PG  G  G++G  G +G  GKD                       G    PGEK                    G  G KG +GL G++G  G    T   I  G  G  G  G PG  G +G +G+PG PG  G +G+ GE G+ G        G  G RG+KG  G PGL   + + G+ G  G+ G KG    +G+   AE+       ++         G+ G PG  GV    G +GP GE+G                    G  G+ G+ G   ++G  G  G+ G PG  G  GI                           G    KGL G +G  G  GL G +G  G  G  G   + G  G KG  G +G  GI G        GIPG++GL GI G                +GDRGN G  G        ++L L G++G  G+ G NG  G RG +GE G                  G  G  GP G  G RGL G KG +G+ G              G+ G  G +GI GS G  GA G  G++GD G  ++   SPG KG+ G  G KG  G         +DG  GN G    G KG+ G  G +G +G  G  G  G  G+ GE G  G+ G QG  G  G  GL G +G  G  G+ G  G        G +G  G  G S+    G  G  G +G +G+  I I            GD+G  G +GP+G+ G  G
Sbjct:   74 LKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKG-DPVLAPGSF--KGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALS-GVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGN-LGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGAR---GDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGA---TGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERG------------------SPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGI-----------SGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG------LPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGF------------PGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKG---------RDGLIGNIGFP--GNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGL------PGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPG 1246          

HSP 4 Score: 159.073 bits (401), Expect = 3.923e-38
Identity = 377/1278 (29.50%), Postives = 485/1278 (37.95%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK---------------NGTHGTPGKIGDKGDEG------------DRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEKG------TPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGE-KGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKG--------------EAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPG-----TDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNE------TIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVA---GPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKG---NKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG---------------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERG------FPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQ----------------------------------GIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-----------IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPS--GVNGTTGY 3769
            G QGF G  G +G  G++GF G  GP G KGD G  G PG +GI+G                +G +GT G +G  G +G             +G  G   +      G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +G        G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   + G                 G  G +G PG KG    +G  G    G  G  GR+G  G  G       + E +  +    G  G RG+ G   + G+ G+KG  GF    G                     L   KG+ G+RG  G +G  G PG  G  G  G  G  G          PG++G  GS+G  G++GE G+ G           G+ G+             GE+G+PG+PG            NG  G  G  G+ GD+G  G  G+ GL  ++       I G  G  G  G  G  GP G +G                   +KGE G PG + +    G  GP GEKG+                                  G  G  G+DG PGM G  G+ G  G  G I G              TG KG   + GL G +G  G  GL G +GE G  GT G++G  G  G+ G  G  G+ G+ G                     P       G+PG KGLPG  G+ G +G+ G+ G      L G +G      F G PG  G  G  G RG  G  G+ G  GP G  GT    GEKGD G  G +G+  P        ++G  G +G  GS G  G RG++                                  GIRG  G+KG S     PG  GE GS G++G  G  G  G+P   G  G T   +            G KG  G DG  G IG  G+KG +G +G+ G++G  G  G  G  G RG+ GLPG                     + G +G IG  G     + G IG KG  G  G   +N   G KG  G  GPS  GV G  G 
Sbjct:   61 GPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSG---------------VPGALGPQGFPGLKG---DQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGF----------PGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLP-------GTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGL---------------------------------PGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGT---PGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPG---------------------SSGHQGAIGPLG-----SPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGL 1201          

HSP 5 Score: 140.969 bits (354), Expect = 1.225e-32
Identity = 337/1082 (31.15%), Postives = 435/1082 (40.20%), Query Frame = 2
Query:  413 EQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------------EPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG--------------TKGSKGRIGEKGLKGKEANKPKIQ------------------EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGDDGLPGEKGTPGRPGEQGEQGKI-----GDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKG----IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGL-KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDG---NNGTKGDRGDIGQKGIQG------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGD------------NGTIGDRGRRGEMGDNGTIGNT-------GPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK------------IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKG 3286
            E GFPG  G  G  G  G  G +G  G      CDG                      PG  G  G  G+ G  G  G  G  G  GP+G      +G  GE  ++  QG+ G +G+ G +GF G +G  G                G +G  GEKGL G    K                       GDKG+ G+ G+ G   +          GS G SG  G+ G  G +G +G  G PG+ G +G+ GE G         L G PG RG        G+ G DGLPG  G+PG PG +G  G I     G  G++GL G    +G  GD G   +          G KG +      G  G+ G +G PG  G++G  G+KG  G  G+    G  G PG+ G +GK+G  G    +G+PG KG+ G  G  G  ++G  GS       G  G  A  G KGEKG  G V       G PG     G+PG +G +G  G  G+           G  G  G  G+KG  G PG  G    +     L +KG         +KG +GS GSNG  G +G+ G   R       G  G  G           G+ G PG  G  G  G  G  G  G  G+ G+ G +G  G PGL     + GL+G  G    I G  G +G  GE G+          K  + +D   G  GFPG  G  G VG +G+ G+ G  G  G  G +G+ G  G  G QG  G   + G +G  G  G PG+ G  G+ G  GT G  G                G+KG  G+  G  G+ G +G KG+RG  G  G  G  G  G    +   G  GD G+ G+ G            P  P++  G  G  G PGI G  G  G  G        G+ GE GF GTPG              G  G RG  G  GD G            GP G  G  G+ G  GD G  G +               G+ G +G+ G  GK            +G  G  G++G  G +G  +PG++G  G PG+ G
Sbjct:  453 ESGFPGLRGEQGPKGNLGLKGIKGDSGF---CACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP-----KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGER------GSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVG--LKGSPGS------PGVAGLPALSGPKGEKGSVGFV-------GFPGIPGLPGIPGTRGLKGIPGSTGKM----------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKG---------DKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGV-----SGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGF----------KGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGFSGLPGELGLK------GMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPV---------------GLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEG--APGQQGPFGMPGMPG 1448          

HSP 6 Score: 92.0485 bits (227), Expect = 1.014e-17
Identity = 201/675 (29.78%), Postives = 265/675 (39.26%), Query Frame = 2
Query: 2048 IPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----------IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRI------------------GMDGNNGTKGDRGD------IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDG-----------------------NCTSLGLMGERGFPGTPGDN--------------------GTIGDRGRRGEMGDNG------------TIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKG-----VQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IPG+PG        G MG+ G  G  G +G KG  G PGL+         G++GI+G KG+ G  G   + +   A   +  N       G  G  G  G+ G  GP+G  G+                               A +G  G  G  G PG+KGD+G           + G +G  G  G  G    E         + G  GL+G QG +G  GLKG +G+ G     G +                  G+ G  G +GDRG        G  G+ GP  P+   G  G   L  I+G+ GDRG++G+ G                            G  GE+G PG PG+                     G  GD+G+ G  G  G              G+ GP G  GT G  G KG  GL GT G  G  G KG  G  G++    + G  G    RGE+G+ G  G+ G    G  G +GSPGL G  G  G       G P + G +G TG        GL G  G  G  G +G +G++G  GT    G++G  GT G  G  G +GK+GLPG  G  G  G  G+ G  GK G  G   K G  G   +    G +G KG  G+ G   +    G KG+K         G+ G+V
Sbjct:  294 IPGLPGP------RGPMGSEGVQGPPGQQGKKGTLGFPGLN---------GFQGIEGQKGDIGLPGPDVFIDIDGAV--ISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP------------------------------ALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPG---PRGEKGLPGFPGLPGKD--GLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGT---PGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEK---------GSVGFV 904          

HSP 7 Score: 56.9954 bits (136), Expect = 4.573e-7
Identity = 103/325 (31.69%), Postives = 125/325 (38.46%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQG--------FMGYRGPVGLKGDIGCDGEPGT-VGIDGKNGTHGTPGKIGDKGDEGDRGPNG----------TFSIGTRGDNGERGING------------------TQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP-------KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD------RGLKGIKGDDGLPGEKGTPG---RPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT 1222
            KG  GFPG  G NG  G +G          G  GP GL G  G  G PG  +G  GK G  G   + GD+G  G +GP G          +   G  GD G  G++G                   QG  G  G  G  GF G  G  G KG +G  G  G  GK            K + G +G  G+ G  G+  T T  +              G  G  G  GI G  G PG  G  G  G KGL GIPG        G  G  GD GLPG +G PG    PG+QG  G  G  G     G  + +  + ++     I  +
Sbjct: 1164 KGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRG---QKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQ--TPTAEAVQV---------PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMS 1474          

HSP 8 Score: 56.6102 bits (135), Expect = 6.908e-7
Identity = 131/393 (33.33%), Postives = 176/393 (44.78%), Query Frame = 2
Query: 2654 KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGL------PGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE--MGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG--------------GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            KG +GR G  G++G  G  G  G+TG  G+ G  G  G  G  G KG +GP      MG+PG  G+      PG  G +G  G +G +G   ++G  G  G+PG  G  G  G +G +G+  +      G  G  G  G  G+TG +G  G  G +G  GP G +G  G  G +G  G  G    +G +GE+G++GD G+ G              G   G+KG  G PG KG+ G  G  G P              G+ G  GP    G +G EG +G  G  G +G +G  G  G QG +G++G  GLPG         +  +      SGN GD G  G  G      KGD G +G RG  G   +    G  G  G +G  G+ G  G
Sbjct:   45 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGP------MGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMG----LGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP---RGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPD-------VFIDIDGAVISGNPGDPGVPGLPG-----LKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQG 412          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 194.126 bits (492), Expect = 7.590e-49
Identity = 378/1251 (30.22%), Postives = 485/1251 (38.77%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK-----NGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGR--IGEKGLKG-------------------------KEANKPKI--QEGDKGEKGMSGKDGEN--CTDTGRSSNFYXXXXXXXXXXXXXXXXX----------XXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGD--------------------DGLPGEKGTPGRPGEQGE-----------------QGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD-IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK-------IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG----------------ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +G QG PG+ G  GT G  G  G++G  G KGDIG  G    + IDG       G  G PG  G KGDEG            +G  G  G+ G   ++G  G  GP+GF G   + G +G+ GR  IG  GL G                         KE+  P +  ++G KG  G+ G  G++  C   G   N                               G QG  G PG +G  G  G KG         ++G+PGDRG       +G+ G+                     G PGEKG PG PGE+G                  +G  GDKG  GL G   ++G  G KG    + C                   G  G  G  G PG  G  G  GL G  G  GS   KG  G PG +      G  G +G +G+PG  G+ GK+G  G +  G  G                  + G KG  G++ G E   G PG+   +G+ G+ G +GF GD G    K       G  G  G  G++G+ G PG+ G  G  G +G  GIKGK G    PG  G  G  G  G  G+KG  G I +                         G +G+PG PG  G  G+ G  G  G   + G +G+KG   F G PG+     I G +G KGI G  G  GPSG  G   +                KG++G PG +G+  P  P     +K                                 GS G +G +G PG +GD+G               + G  +            G +G  GLKG+ G  GF G+ GE G  G  G+ G  G  G  G KGD G  +   G  GP       G  G+KG  G+ G  G  GN G DG     G +G  G PG PG  G  G+ G  G  G  G IG  G  G  G +G  G  G  GLNG +             I GV G  G+ G KG+       IGA G+ G+RG +G +G   PG +G  G PG  G      + G P   GR G  G                 +  G  GD G  G  G  G +GD+G+ G  GL GE+G  G  G+ G  G  GK             G  G+ G  G  G  G RG  G +GD   +   +  Q    G  G   I+   G  GD G +GP G+ G+ G 
Sbjct:  307 EGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEG-----------IQGLRGPSGVPGLPALSGVPGALGPQGFPG---LKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPG---QQGLPGSKGIT--LPCIIP----------------GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMI--GSPG------------------LPGSKGATGDIFGAE--NGAPGE---QGLQGLTGHKGFLGDSGLPGLKGV----HGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGL---------------------PGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGE----------------KGDRGNPGPVGIPSPRRPMSNLWLK------------------------------GDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNG-LPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRG--FPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKV------------GPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGL 1410          

HSP 2 Score: 182.57 bits (462), Expect = 2.884e-45
Identity = 96/259 (37.07%), Postives = 131/259 (50.58%), Query Frame = 2
Query: 4649 IKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTK-PLGETFGTQMELEKTISRCRVCVKNM 5416
            ++G  G +G PG  G  G+ G      R      +H Q         CP G + +  GYS +   G E     DLG   SCL +FS  P I+C+    CH+  RN +SYWLS+  PI   PV   ++   ISRC VC AP+   A H Q       CP  W  LW GYS +MHT+  ++GG Q L SPGSCLE  R  P IEC+     CH + +   ++L  V +   F + P+ ET     +L   +SRC+VC+K++
Sbjct: 1437 LQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQ---SEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQ-CPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETL-KAGQLHTRVSRCQVCMKSL 1690          

HSP 3 Score: 157.918 bits (398), Expect = 1.025e-37
Identity = 382/1288 (29.66%), Postives = 505/1288 (39.21%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDI---------------GCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEK------GTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEG---------------------VPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGDKG------TTGFPGKNGTKGAKGENGTLGIKGKD-----------------------GTSEKPGEK--------------------GRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANG------TNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAED-CNATSKVKANEFKDRNKGEKGFPGKMGV---AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGV---------------QGDRGNNGTDG------NCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGD----------------NGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQG--IKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINI----------THGDKGDKGDEGPSGVNGTTG 3766
            +KGE+GFPG +G  G  G +G MG  G +G+ G                 GC+G  G VG  G +G  G  G  G  G +G +G +   + G+    G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +      G  G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   +  GV              +     R   GA G+ G++G  G        S   E       +    G++GE+G  GN +G +G +GD G  + +G                     +PG+KG R   GD+G    +     P   G +G  G  G KG        G PG  G  G++G  G +G  GKD                       G    PGEK                    G  G KG +GL G++G  G    T   I  G  G  G  G PG  G +G +G+PG PG  G +G+ GE G+ G        G  G RG+KG  G PGL   + + G+ G  G+ G KG    +G+   AE+       ++         G+ G PG  GV    G +GP GE+G                    G  G+ G+ G   ++G  G  G+ G PG  G  GI                           G    KGL G +G  G  GL G +G  G  G  G   + G  G KG  G +G  GI G        GIPG++GL GI G                +GDRGN G  G        ++L L G++G  G+ G NG  G RG +GE G                  G  G  GP G  G RGL G KG +G+ G              G+ G  G +GI GS G  GA G  G++GD G  ++   SPG KG+ G  G KG  G         +DG  GN G    G KG+ G  G +G +G  G  G  G  G+ GE G  G+ G QG  G  G  GL G +G  G  G+ G  G        G +G  G  G S+    G  G  G +G +G+  I I            GD+G  G +GP+G+ G  G
Sbjct:   74 LKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKG-DPVLAPGSF--KGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALS-GVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGN-LGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGAR---GDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGA---TGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERG------------------SPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGI-----------SGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG------LPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGF------------PGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKG---------RDGLIGNIGFP--GNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGL------PGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPG 1246          

HSP 4 Score: 156.377 bits (394), Expect = 2.925e-37
Identity = 369/1281 (28.81%), Postives = 482/1281 (37.63%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK---------------NGTHGTPGKIGDKGDEG------------DRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEKG------TPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGT----LIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKG--------------EAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPG-----TDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNE------TIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVA---GPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKG---NKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG---------------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERG------FPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQ----------------------------------GIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-----------IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPS--GVNGTTGY 3769
            G QGF G  G +G  G++GF G  GP G KGD G  G PG +GI+G                +G +GT G +G  G +G             +G  G   +      G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +G        G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   + G                 G  G +G PG KG  G  G+       L   +              +     +  ++  +  + G++GP+G+       G+ G+KG  GF    G                     L   KG+ G+RG  G +G  G PG  G  G  G  G  G          PG++G  GS+G  G++GE G+ G           G+ G+             GE+G+PG+PG            NG  G  G  G+ GD+G  G  G+ GL  ++       I G  G  G  G  G  GP G +G                   +KGE G PG + +    G  GP GEKG+                                  G  G  G+DG PGM G  G+ G  G  G I G              TG KG   + GL G +G  G  GL G +GE G  GT G++G  G  G+ G  G  G+ G+ G                     P       G+PG KGLPG  G+ G +G+ G+ G      L G +G      F G PG  G  G  G RG  G  G+ G  GP G  GT    GEKGD G  G +G+  P        ++G  G +G  GS G  G RG++                                  GIRG  G+KG S     PG  GE GS G++G  G  G  G+P   G  G T   +            G KG  G DG  G IG  G+KG +G +G+ G++G  G  G  G  G RG+ GLPG                     + G +G IG  G     + G IG KG  G  G   +N   G KG  G  GPS  GV G  G 
Sbjct:   61 GPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSG---------------VPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGN------LGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGF----------PGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLP-------GTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGL---------------------------------PGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGT---PGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPG---------------------SSGHQGAIGPLG-----SPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGL 1201          

HSP 5 Score: 155.221 bits (391), Expect = 6.102e-37
Identity = 290/970 (29.90%), Postives = 366/970 (37.73%), Query Frame = 2
Query:  416 QGFPGEMGHNGTDGQQGFMGYRG---PVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI---QEGDKGEKGMSGKDGEN--CTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNG------TDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE-GETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSS----------------------EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENG-TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGE------KGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGD------KGFSGEPGLHSNETIQGLQG--------YKGIKGDKGNRGPSGEKGWA-EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGE------RGEIGQNGTTGRI------------GMDGNNGTKGDRGDIGQ----------------------------KGIQGPSNPNATMGIPGSKGLPGIKG---VQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE 2995
            +G PG+ G +G  GQQG  G +G   P  + G  G  G PGT G  G  G+ G PG  G  G           S G++G+ G  G+     + G  G RG KG  G  G+ G  G  G IG  GL G +     I   + G  GE+G+ G  G      D+G                          ++G  G PG LG  G      T G+ G  G PG  G  GIKG  GLPG  G PG  G  G++G  G KG  G   K    G +G  G   ++    +    G  G     G  GE GS G +G PG+ G  G  G +G                                  +GIPG+ G  G  G+ GT  E G+ G+ G  G    +   +   +KG+KG  G+    G  GPRGD G+                          G PG  G RG  G KG +        P    GE G  G +G+ G PG +G  G KG+NG T+ I G  G   +PGE G KG+KG +GL+G       KGE G +  +                      D G  G PG PG  G  G  G  G++G  G IG  G       KGF G PGLH    + G +G          G+ G  G  GP GEKG+      A  K          KG++GFPG   + GP G  G  GI                                 +   G+ G+ G+PG+ G+                              G  G KG KG+QG  GF GL GE      RGE G  GT G++            G  G  G+ G +GD GQ                             G QGP      +G+ GSKGLPGI G     G  G  G  G+    GL G  GF G PG  G  G  G  G+
Sbjct:  629 RGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPG-----------SSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPG-----------------------LKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRG---------------------------------LKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMP----GESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSG---------------------DVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRG----QKGDRGFPG---LQGPAGLPGAPGIS------------------------------LPSLIAGQPGDPGRPGLDGER--GRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGP------VGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQ 1461          

HSP 6 Score: 147.902 bits (372), Expect = 9.008e-35
Identity = 345/1093 (31.56%), Postives = 445/1093 (40.71%), Query Frame = 2
Query:  413 EQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------------EPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG--------------TKGSKGRIGEKGLKGKEANKPKIQ------------------EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGDDGLPGEKGTPGRPGEQGEQGKI-----GDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKG----IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGL-KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDG---NNGTKGDRGDIGQKGIQG------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG----TIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSS-------------PGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI 3361
            E GFPG  G  G  G  G  G +G  G      CDG                      PG  G  G  G+ G  G  G  G  G  GP+G      +G  GE  ++  QG+ G +G+ G +GF G +G  G                G +G  GEKGL G    K                       GDKG+ G+ G+ G   +          GS G SG  G+ G  G +G +G  G PG+ G +G+ GE G         L G PG RG        G+ G DGLPG  G+PG PG +G  G I     G  G++GL G    +G  GD G   +          G KG +      G  G+ G +G PG  G++G  G+KG  G  G+    G  G PG+ G +GK+G  G    +G+PG KG+ G  G  G  ++G  GS       G  G  A  G KGEKG  G V       G PG     G+PG +G +G  G  G+           G  G  G  G+KG  G PG  G    +     L +KG         +KG +GS GSNG  G +G+ G   R       G  G  G           G+ G PG  G  G  G  G  G  G  G+ G+ G +G  G PGL     + GL+G  G    I G  G +G  GE G+          K  + +D   G  GFPG  G  G VG +G+ G+ G  G  G  G +G+ G  G  G QG  G   + G +G  G  G PG+ G  G+ G  GT G  G                G+KG  G+  G  G+ G +G KG+RG  G  G  G  G  G    +   G  GD G+ G+ G            P  P++  G  G  G PGI G +G +G+ G              GF G PG+ G  G RG  G MG  G +G  G  G  G +G  G +G +GL G    T          G  G+ G+ G  G+ G  G  G  G QG +G  GI G                PG  G  G PG +G  G +G  GMP   G+    G T +
Sbjct:  453 ESGFPGLRGEQGPKGNLGLKGIKGDSGF---CACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP-----KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGER------GSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVG--LKGSPGS------PGVAGLPALSGPKGEKGSVGFV-------GFPGIPGLPGIPGTRGLKGIPGSTGKM----------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKG---------DKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGV-----SGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGF----------KGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIP------------GFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLV 1470          

HSP 7 Score: 111.694 bits (278), Expect = 1.158e-23
Identity = 217/693 (31.31%), Postives = 279/693 (40.26%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------EPGTV---GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN----------KPKIQEGDKGEKGMSGKDGENCTDTGRSSN-FYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG------LEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDG------PLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP-----------------------------------------KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGK---DGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXD---------QGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQG 2200
            +G  G PG++G  GT G  G  G +G  GL G  G  G                PG++   G+ G  G  G PG +G KG  G  G  G  ++ G +G+ G  G  G  GI G  G  G +G +G  G  G  G  GR G  G KG   N          +P      KG+KG  G  G N     R                        +G+ G+ G PG +G  G  G KG        G+PG+ G +GI+G  GLPG  G PG  G+ G+  +I   G  G  G+  E G +G KG   +I       +KG  G  G     G++G  G+ G PG+ G  G+ GL G  G      PLGS  + G          KG  G  G  G  G+PG KG  G  G + T + G  G                 G KGEKGY G  +G  G  G  G     G PG++G  G  G  G +        P                                          G  G +GD G  G +G PG+ G KG +GE G +G  GK    G    PG KG+ G +GS+GL G+ G+       A  +  G  G  G  G PG  GD         QG +G+PGIPG DG +G  G  GA G  G+ G +G  GF G PG      + G+ G
Sbjct:  799 RGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI--SGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVS---GDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIG---------PKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAG---------------LPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQT--PTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPG 1460          

HSP 8 Score: 90.5077 bits (223), Expect = 2.865e-17
Identity = 201/675 (29.78%), Postives = 265/675 (39.26%), Query Frame = 2
Query: 2048 IPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----------IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRI------------------GMDGNNGTKGDRGD------IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDG-----------------------NCTSLGLMGERGFPGTPGDN--------------------GTIGDRGRRGEMGDNG------------TIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKG-----VQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IPG+PG        G MG+ G  G  G +G KG  G PGL+         G++GI+G KG+ G  G   + +   A   +  N       G  G  G  G+ G  GP+G  G+                               A +G  G  G  G PG+KGD+G           + G +G  G  G  G    E         + G  GL+G QG +G  GLKG +G+ G     G +                  G+ G  G +GDRG        G  G+ GP  P+   G  G   L  I+G+ GDRG++G+ G                            G  GE+G PG PG+                     G  GD+G+ G  G  G              G+ GP G  GT G  G KG  GL GT G  G  G KG  G  G++    + G  G    RGE+G+ G  G+ G    G  G +GSPGL G  G  G       G P + G +G TG        GL G  G  G  G +G +G++G  GT    G++G  GT G  G  G +GK+GLPG  G  G  G  G+ G  GK G  G   K G  G   +    G +G KG  G+ G   +    G KG+K         G+ G+V
Sbjct:  294 IPGLPGP------RGPMGSEGVQGPPGQQGKKGTLGFPGLN---------GFQGIEGQKGDIGLPGPDVFIDIDGAV--ISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP------------------------------ALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPG---PRGEKGLPGFPGLPGKD--GLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGT---PGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEK---------GSVGFV 904          

HSP 9 Score: 58.9214 bits (141), Expect = 1.141e-7
Identity = 98/302 (32.45%), Postives = 124/302 (41.06%), Query Frame = 2
Query:  407 KGEQGFPG-------EMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIG-------TRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP-------KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD------RGLKGIKGDDGLPGEKGTPG---RPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT 1222
            KGE+G+PG       + G  G  G +GF G +GP GL         PG  GI   +   G PG  G  G +G+RG  G             +GD G+ G  G  G  G KG++G  GF G  G  G KG +G  G  G  GK            K + G +G  G+ G  G+  T T  +              G  G  G  GI G  G PG  G  G  G KGL GIPG        G  G  GD GLPG +G PG    PG+QG  G  G  G     G  + +  + ++     I  +
Sbjct: 1205 KGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGL---------PGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQ--TPTAEAVQV---------PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMS 1486          

HSP 10 Score: 55.4546 bits (132), Expect = 1.552e-6
Identity = 131/393 (33.33%), Postives = 176/393 (44.78%), Query Frame = 2
Query: 2654 KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGL------PGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE--MGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG--------------GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            KG +GR G  G++G  G  G  G+TG  G+ G  G  G  G  G KG +GP      MG+PG  G+      PG  G +G  G +G +G   ++G  G  G+PG  G  G  G +G +G+  +      G  G  G  G  G+TG +G  G  G +G  GP G +G  G  G +G  G  G    +G +GE+G++GD G+ G              G   G+KG  G PG KG+ G  G  G P              G+ G  GP    G +G EG +G  G  G +G +G  G  G QG +G++G  GLPG         +  +      SGN GD G  G  G      KGD G +G RG  G   +    G  G  G +G  G+ G  G
Sbjct:   45 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGP------MGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMG----LGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP---RGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPD-------VFIDIDGAVISGNPGDPGVPGLPG-----LKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQG 412          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 198.749 bits (504), Expect = 1.019e-50
Identity = 351/1073 (32.71%), Postives = 447/1073 (41.66%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGT------PGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPG-----KLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPG----EKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGE--IGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGDKGTTGFP------------GKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKG--IQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGL 3520
            + G  G+PG  G  G  G  G  G RG  G+ G+ G  G  G  G+ G  G  GT      PG  G  G EGD GP G    GT    GE G +G QG +G +G +G  G +G  G  G +G  G  G  G  G +      ++GD+GE G  G  GE           Y                      GE G+PG       G +G  G  G  GIPGD G  G  G+ G PG    + G  G PG  GE+G  G  G  GL G+   RG++G+ G   I          G  G  G+ G  GE   G  G +G PG NG  G  GL GPDG  G + + G                       G PG  GM G++G  G     GE+G +G +G+KG  G    RG  G  GY G         G PG +  +G PG  G +G+ G  G+         P   G +G  G  G+ G  G P            G +G  G  GE+GT G+ G  G   +PG  G  G  G+ G  G+ GE G       N+ +  +        P        Q   G+PG +G+ G NG+    G  G+ G  GD G+ G  G+       G+ G  G+KG+ G  G  G +G          +      +   GE GFPG  G  G  G  G +G                        E+G  G    NG  G  G+DG+PG+KG+ G+ G+ G  G  G  G  GD         G  G  G  GNQGR G  GL+GE G+ GQ G  GR G  G  G  GD G  G  G  I GP       G PG  GLPG  G+ G+ G+ G  G     G  GE G PG PG+ G  G  G+RG    +G  G  G  G  G  GL G+ G+ G  G                 G  G  G  G +G  G  G+QG  GD G  G  +PG+ G  G  G  G+ G  G+ G+P + GR G  G  A+ ++   G  G+NG  G++G  G+ G  GL G  G  G  G  G  G  G  GL
Sbjct:  283 LDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGT----GEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGY---------------------PGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPG---------------------TPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEA-------GAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPG-------NLAYPGQPGDVGYPGPDGPPGLPGQD--GLPGLNGERGDNGDS-YPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQG-------NDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREG------------------------EKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDV-----GYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGH---DGLPGAPGVPGVEGVPGLEGDCGEDGYPGA---------------PGAPGSNGYPGERGLPGVPGQQGRSGDNGYPG--APGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGL 1236          

HSP 2 Score: 193.356 bits (490), Expect = 4.437e-49
Identity = 388/1236 (31.39%), Postives = 509/1236 (41.18%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGI---DGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGS-------------ECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG-NVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGE-----KGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR--NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQG---------------RQGFKGLKGERGE-----------------------------------IGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGD---------------RGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPG---------------LKGYFGGKGVQGMPAKDGRRGNTGIT----------AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
             +G++G PG  GH G  G  G  G +G  G+ G  G DG PG  G+    G++G +G PG+ G  G  G+ G N     G +G++G  G+ G  G +G  G +G KG  G  G+ G  G  G  G  G++           G KGEKG+ G  G                               + I+ E+ + G +G  G  GEKG +G  G  G+ G+          G PG PG +G++G +GD G RG  GK+   G  G+KG+                  +G  G  G  G+KG  G PG  G  G  G  GP+GPLG              + V+GG G+PG  G  G  G  G  G  G PG  G+ G  G       GE G  G  G  G  G+    G  GE G  G ++ G  G  G  G D   G+PG  G  G+ G+KG   T      P G  G  G+ G  G  GFPG +G  G +G+ G +G  G DG   +PG  G  G+ G+ G  GE      G++GY                            G+ G  G+PG DG  G +G  G  G  G  G  G  G  G+PG      + G+ G KG  G  G RG  G  G++ +  A  +   + +     ++G  G PG+ G  GP G  GE G+ GF G  G  G  G  G  GE GE+G +G +   G  GE G DG PG+ G +G                            G+ GN    G  G               + G  GL GERG+                                    G  G  G  G+ G  G +G+ G  GQ G++G    +   G PG  G PG +G +G+               RG +G  G     GL G+ G+PG+ G  GT GD G  G  G+NG  GN G DG+ G RG +G+ G  GL G  G  GP+G  G  G  G  G+  I G  G+ G  G  G+ G  G     +PG  GE GSPG               L GY    G +G+P  DG+RG+ G+             GL+GD G DG  G  G  G  G  G  GL G  G  G  GD G  G  G+ G+ G R   G  G  G  G  G  G  G  G  G    +V +  G  G+ G+ G +G+  +   +G  G  G  G  G  GT GY
Sbjct:   92 ARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVR---------TSGVKGEKGLPGPPGPPGQPGSYPW-------------------ASKPIEMEV-LQGPVGPAGVKGEKGRDGPVGPPGMLGL---------DGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQG---------------EQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPN------------------------GDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADG--------QPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQD-IYGPPGQAGQDGYPGLDGLPG-----APGLNGEPGSPGQYGMPGLPGGPGESGLPGY---PGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPR---GDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGY 1230          

HSP 3 Score: 188.348 bits (477), Expect = 1.740e-47
Identity = 95/260 (36.54%), Postives = 131/260 (50.38%), Query Frame = 2
Query: 4649 IKGKMGIKGTPGIPGDTGIKGERAAINRSE-ILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSS---LLPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
             +G  G  G PG+PG  G  G       S    FA+H Q        +CP G + +  GYS +   GN   +  DLG P SCL KF+  P + C+    CH + RN  S+WLS+   + P+ NPV    ++  ISRC VC  P  + A H Q T     CP+ W+ +W GYS +MHT+    G+ Q   SPGSCLE  R  P IEC+     C+ +     ++L  V     F KP+ +T      L+  +SRC+VC+KN
Sbjct: 1248 FQGAAGRTGNPGLPGTPGYPGSPGGWAPSRGFTFAKHSQTTA---VPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQDTSVPQ-CPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGT-CNYYATNHGFWLSIVDQDKQFRKPMSQTL-KAGGLKDRVSRCQVCLKN 1501          

HSP 4 Score: 182.956 bits (463), Expect = 7.107e-46
Identity = 356/1150 (30.96%), Postives = 451/1150 (39.22%), Query Frame = 2
Query:  425 PGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNP---GLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGP----RGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE----------MGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGE---RGEIGQNGTTGRIGMDGNNGTKGDR---GDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGF---PGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTI------XXXXXXXXXXXXXIEGVIGERGINGS--KGKIGARGEQGIRGDQGIKGGSSPGEKGEV-GSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            PG  G  G  G  G  G+               PG  G DG  G  G PG  G +GD GD G     S G RGD G  G  G  G+ G  G  G KG EG  G NGT G  G  G  G  G+       Q G+ G  G+SG  GE   ++                            QG  G+       G  G  G+ G+PG+ G  G+KG  G PG  G PG PG  G +G++G +       K +           S    +     +  +G  G  G  GE G  G +G P   GL+G  G  GLKG  G LG    +G                      RG  G  G +G++G      +GE G  G  G  G KG     G  G  G+ G+  G EGP     G+ G   ++G  GV+G +G  G  G            G +G RG +G  G  G PG +G  G        G +G+DG     GE G  G  G  G  GE G  GY  +    +                 G  G  G PGIPG  G  G +GE          +G +G  G  G+RG  G  G PGLH    ++G QG  G  G  G+ G  G  G+     A        F        GFPG++G  GP G  G  G+                                 +G  G  G  G PG  G+ G+                 D       S G+ G  G+ G +GR G  G +G+    G  G+ G  G+ GMDG  G  GD+   G  GQ G  GPS      GIPG  GL G  G++G+ G+NG  G     G  G RG    PG PG++GT G  G  G  G  G +G  G  G  G RG  GE G+    G        G  GP G  G  G+ G+ GERG NG    G  G  G+ G  G  G+ G   P     + G PGL      KG  G+P   GR+GN GI    GL+G+    G++G  G  G  G  G  G EGE G  G  G+ G  G RG+ G PG                      KG+ G  G+ G       G  GQ G  G+ G+      +GD G++G +G  G+ G +G
Sbjct:   42 PGTKGERGNPGFGGEPGH---------------PGAPGQDGPEGAPGAPGMFGAEGDFGDMG-----SKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSG-----QNGNPGRPGLSGPPGEGGVNS----------------------------QGRKGV------KGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRG---------------------KRGKDGVPGNYGEKGS-----QGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDC-GPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGL----------PGPVGPRGPVGAPGAPGQPGIDGMPGYT----EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLD----------------GQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGF--------GFPGQVGYPGPNGDAGAAGL------------------------------PGPDGYPGRDGLPGTPGYPGEAGM--------------NGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPS------GIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGL------KGESGLPGLPGRQGNDGIPGQPGLEGEC---GEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGL---------------------KGENGLDGQPG-----YPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESG 982          

HSP 5 Score: 161.77 bits (408), Expect = 2.149e-39
Identity = 303/938 (32.30%), Postives = 397/938 (42.32%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKG-DIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGIN--GTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKG---IKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGD------------DSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGK---------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGI------PGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR----------NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGP-----SNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKG 3073
            +GE G+PG  G  G  G+ G  GY G  GL G DI   G PG  G  G++G  G PG IGD G  G++G  GT            G+N  G  G  GT GERG  G  G  G++G  G +G+ GE G  G +        GD GE G+ G  G            +                      G++G PG  G  G  G  G +G PG  GL G     G+ G+ G+ G PG+PG +GE G +G  G +G  G    RG+ G  G +        +   G           G  G +G  G+PG +G  G  G+ G DG +G   ++G  G  G  G +G+ G EG +G  G+PG  G  G +G  G    +G+ G +G  G  G  G       +G+ G  GN+       G PGD               +G+PG+ G+RG  GD              G+ G  G  GD G  G  G           G  G KGE+G  G+ G+ G    PG+ G +G  G +G  G  G+ GY  +                G  G  G  GE G+PG+      PG  G+NG +G+ G  G+ G +G  GD G+ G PG + +   QG  G  G++G+ G  G  G  G             + +               G+ G+PG  G+ G  G NGE G     G+ G  G  G  G++G  G  GE+G    +G  G  G  G PG+ G EG+ G  G  G  G  G  G  G   N   G++G  G+ G QGR G  G  G  G+ G  G  G  G  G +G  G  G  G++G+ GP      NP    G PG  G PG KG  G  G+NG  G     G  G  G  G PG  G  G  G  G+ G  G  G TG  G  GT G  G  G
Sbjct:  425 RGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDI--QGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGT------------GVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGID--------GDCGEPGLDGYPGAPGAPGAPGETGFG-------------------FPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGY---------PGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPG------YRGQPGEPGNLAYP----GQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSY-----------PGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGRE------------GEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPG---SPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGS--NGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPP---GQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG 1271          

HSP 6 Score: 150.599 bits (379), Expect = 5.650e-36
Identity = 258/797 (32.37%), Postives = 328/797 (41.15%), Query Frame = 2
Query: 1583 VKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSN------------------------------ETIQGLQGYKGIKGDKGNRGPSGEKGWA--EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGT--KGDRGDIGQKGIQG----PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGT-IGNTGPDGENGT---RGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGS-----------------KGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
             KGE+G  G   G+ G  G PG D  EG PG  G  G +GD G+  +K      +G  G  G  G +G  G PG  G +G  G NGT G  G  G +  PG+ G+ G+ G  GL G  GE G  ++    +                 G+ G  G+PG+PG  G  G  G  G  G  G+ G  G  G  G  G+ ++                              E +QG  G  G+KG+KG  GP G  G    +       +K  +    + G++G  GK GV G  G  G +G                     E+G  G  G   T G  GE G  G+PG +GD G +G  G      G           + + G  G +G KG  G  G  G  G RG +G  G  G+ G+DG  G   KGDRG+ G  G  G    P  P    G PG  GLPG   +QG  G +G  G           GFPG PGD   IGD G  GE G  GT +   GPDG  GT   RG+ G  G  GL+G  G+RG  G  G  GI+G  GE G++G                   G++G  G  G  G  G+ G    PG  G  G+PG  G  G  G  G P + G RG +G+  I       G  G  G DG  G  G+ G  G NG  G  G  G+ G  G  G+ G  G +G+PGE G                    G  G  GE GD  N   G  G+ G  G+RG   +    G+ G  G  G  G +G  G+V
Sbjct:   44 TKGERGNPG-FGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGD-RGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVK----------------GESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQG---------------------EQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGP----------HGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEP-GDCGYPGEDGLPGYD-IQGPPGLDGQSG---------RDGFPGIPGD---IGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGL------------------VGFPGLRGEHGD--NGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFV 757          

HSP 7 Score: 114.775 bits (286), Expect = 4.691e-25
Identity = 198/644 (30.75%), Postives = 249/644 (38.66%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNG------TDGQQGFMG---------YRGPVGLKGDIGCDGEPGTV------GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERG------------INGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLV-----GEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKG 2218
            + G  G+PGE G +G       DGQ GF+G         YRG  G  G++   G+PG V      G  G  G  G PG  G++GD GD  P      G  GD G  G            I G  G+ G  G  G  G +G  G+ G  G +G  GE G  G         Q+G +GEKG  G  GEN                                    G+PG  G++G  G KG  G+ G  G  G  G  G PG+ G PG PGE G+ G  G  G  GL G++ + G+ G  G                      +   G  G  G  G PGL+G  G  GL G  G  G   +             G  G  GE G  G PG +G+ G +GK G                         G+ G  G  G V G  G  GD G+D   G PG  G  G+ G++G            G  G++G  GD G  G PG+ G KG +G++   G  G+DG    PG  GR+G  G   +      G+ GE GY                      G  GD G  G PG  G  G  GT+G  G  G +G+ G  GD+GF G  G   N  + G  GY G  G
Sbjct:  729 LDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGEN------------------------------------GLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPG-PVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMP------------GLPGGPGESGLPGYPGERGLPGLDGKRGH-----------------------DGLPGAPGVPG-VEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGL----------PGVPGQQGRSGDNGYPGAPGQPGIKGPRGDD---GFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYP---------------GLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG 1271          

HSP 8 Score: 62.3882 bits (150), Expect = 4.228e-9
Identity = 71/198 (35.86%), Postives = 93/198 (46.97%), Query Frame = 2
Query: 2948 TPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLK---GYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNG--TIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG 3526
             PG  G  G+ G  GE G  G  G  GP+G  G  G+ G +GD G  G+               +G  G+RG+ GS G  G +G  G+           PG KGE G PG     G+ G  G+ G P + G+ GN G   +     SGP G+ G  + G +G KG +G  G+ G  GN+G  G +G KG  G  GLPG
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGS---------------KGARGDRGLPGSPGHPGLQGLDGL-----------PGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGL-----SGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPG 207          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 196.823 bits (499), Expect = 4.371e-50
Identity = 407/1295 (31.43%), Postives = 509/1295 (39.31%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDI---------GCDGEP---------------GTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIP-----GKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLP-------GEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGE------------RGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGS---IGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG--------NVMGKEGPRGDPGDDSS--EGVPGVKGKRGFKGDKGEAATKCELDCP------------KGSIGERGDLGDKGTTGFP------GKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGY--INRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR--NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQG---------------RQGFKGLKGERGE-----------------------------------IGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGD---------------RGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPG---------------LKGYFGGKGVQGMPAKDGRRGNTGIT----------AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +KGE+G  G +G  G  G  G  GY G  G KGD+         G DG P               GT G  G  G  G PG  G  G EGD GP G    GT    GE G +G QG +G +G +G  G +G  G  G +G  G  G  G  G +      ++GD+GE G  G  GE           Y                      GE G+P     G  G +G  G  G  GIPGD G  G  G+ G P       G  G  G PGE G  G+IG  G  G  G N ERGE             GD G   +          G  G  G  G  G+ GS GS    G+PGL G  G  G+KG  G    E V                     +   GIPG KG  G  G     + G  GS G  G  G  G     G++GE G  G          +G  G +G PGD      G PG KG+RG  G  G    +     P             G  G  G  GD+G  G P      G +G  G  GE G  G+ G  G   +PG +G++G  G NG+ G+ GE G               E   G  G+ G  G  G+ G  G+PG DG  G +G  G  G  G  G  G  G  G+PG      + G+ G KG  G  G RG  G  G++ +  A  +   + +     ++G  G PG+ G  GP G  GE G+ GF G  G  G  G  G  GE GE+G +G +   G  GE G DG PG+ G +G                            G+ GN    G  G               + G  GL GERG+                                    G  G  G  G+ G  G +G+ G  GQ G++G    +   G PG  G PG +G +G+               RG +G  G     GL G+ G+PG+ G  GT GD G  G  G+NG  GN G DG+ G RG +G+ G  GL G  G  GP+G  G  G  G  G+  I G  G+ G  G  G+ G  G     +PG  GE GSPG               L GY    G +G+P  DG+RG+ G+             GL+GD G DG  G  G  G  G  G  GL G  G  G  GD G  G  G+ G+ G R   G  G  G  G  G  G  G  G  G    +V +  G  G+ G+ G +G+  +   +G  G  G  G  G  GT GY
Sbjct:  265 VKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGT----GEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGY---------------------PGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAG----EIV------------------GPMENPAGIPGLKGDHGLPG-----LPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADG--------QPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQD-IYGPPGQAGQDGYPGLDGLPG-----APGLNGEPGSPGQYGMPGLPGGPGESGLPGY---PGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPR---GDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGY 1487          

HSP 2 Score: 189.119 bits (479), Expect = 1.170e-47
Identity = 95/260 (36.54%), Postives = 131/260 (50.38%), Query Frame = 2
Query: 4649 IKGKMGIKGTPGIPGDTGIKGERAAINRSE-ILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSS---LLPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
             +G  G  G PG+PG  G  G       S    FA+H Q        +CP G + +  GYS +   GN   +  DLG P SCL KF+  P + C+    CH + RN  S+WLS+   + P+ NPV    ++  ISRC VC  P  + A H Q T     CP+ W+ +W GYS +MHT+    G+ Q   SPGSCLE  R  P IEC+     C+ +     ++L  V     F KP+ +T      L+  +SRC+VC+KN
Sbjct: 1505 FQGAAGRTGNPGLPGTPGYPGSPGGWAPSRGFTFAKHSQTTA---VPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQDTSVPQ-CPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGT-CNYYATNHGFWLSIVDQDKQFRKPMSQTL-KAGGLKDRVSRCQVCLKN 1758          

HSP 3 Score: 185.267 bits (469), Expect = 1.482e-46
Identity = 390/1205 (32.37%), Postives = 501/1205 (41.58%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGI---DGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGE------IGIPGKLGKNGTDGEKGLEGIP---GDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKG--GVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL---IEGET---GSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVP---GVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLG---------------DKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKG--------SKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDE------GIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKG---------------VQGMPAKDGRRGNTGITAIGLKGDSGPDGDNG---------------TIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
             +G++G PG  GH G  G  G  G +G  G+ G  G DG PG  G+    G++G +G PG+ G  G  G+ G N     G +G++G  G+ G  G +G  G +G KG  G  G+ G  G  G  G  G++           G KGEKG+                 Y  ++     E  +G  G  G++GE      +G PG LG +G  G  GL+G     GD G +G +G DG+PG  G  G  GEQG  G  G  G +G  G+    G  G +G     +C          G  G  G  G  G +G  G PG +G  G +G +GP G  G+    G  G+    E G++G++G  G  G  G+PG  G  G  G++G     I+G     G  GR+G  G  GD    G  GEKG+ G  + K GP G  G     G+P   GV G  G  G+ GE    C   CP G  G  GD G               D G  G PG  G  G+ G +G  G  G  G    PG KG  G          G  GL G+ G  G   R  ++   G  G  G+ G        G QG PG+ G DG+ G  G +G  G  G  GD     F G+PG    +  +G  G  G+ G +G RG                V        ++G  G P   G+ GPVGP+G  G                             G+   +G  G  G  G+PGM+G +      GI G+ G  G+ G  G  G  G  G +  G  G  G  G  G  G  GL G  G  G++G  G  G  G  G  G  G  GQ G +G S     +GI G KG  G  G +G  G  G  G   + G  G  G+PG PGD G  G  G+ G  G +G  G    DG  G  GL GE GD GL G  G  G  G +GL G+ G  GE G +G  G  GA G+ G  G+ G  G  +PG +G+ G PG   Y G  G                 G+P  +G RG+ G +  G  G SG  GD G                 G  G KG +G  GL G  GN+G  G  G +G  G+ G PG                 G+ G  G +G+ GEKG   +    G  G +G  G  G K  N   G  G  G  G  G  G  GY
Sbjct:   92 ARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVR---------TSGVKGEKGLP-----GPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEG-----DCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGY-CPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGF------PGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDS----FPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLP---GLPGPVGPDGYPGT---------------------------PGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGES---GLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGE---DGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPG--TPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSP---------------GQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGY 1213          

HSP 4 Score: 184.111 bits (466), Expect = 3.761e-46
Identity = 373/1158 (32.21%), Postives = 470/1158 (40.59%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKG-DIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRG----------PNGTFSI----------------GTRGDNGERGINGTQGINGTKGERGPKGF---------------EGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTD------------------GEKGLEGIPGDRGLKGIKGDDGLPGEKGTPG--RPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-------IEGETGS-----IXXXXXXXXXXXXXXXXVKGEKGYYGN-----VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGD---KGEAATKCE--LDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINR---------TAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPG------------LHSNETIQGLQGYKGIKGD--KGNRGPSGEKGWA--------EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKG--IQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGL 3520
            +GE G+PG  G  G  G+ G  GY G  GL G DI   G PG  G  G++G  G PG IGD G  G++G          P G   +                G  G+NGERG +     +G  G  G  GF                G  G+ G  G  G  G  GL G          G  G  GM G+ GE        +                      G++G+ G+PG  G+ G+D                  GE GL GI G RG +G  G   +PG +G PG   PG+ G  G  G++G  GL G    +G RG      I+N                    G+ G  G  G PG  G  G  GL GP GP G     G                  E+G  G+PG  G+ G+ G  G         I+G+ G                  +   G  G+ GY G        G  GP G PG D   G PG  G+ G  G     G+  ++ E  L    G  G  G  G +G  G PG +G  GA G+NG  G  G  G    PG  G+ G  G +G+ GE G +G+                   GEEG +G  G PG  G+ G  G+PG+PG DGQ G  GE G  GT G  G  G+ G   + G+PG            L   + + GL G +G  GD   GN G SG+ G A                +          G  G PG+ G  G  G  G +G  G  G  GS G  G  G+ G +GE+G  G    NG  G  G+DG+PG+KG+ G+ G+ G  G  G  G  GD         G  G  G  GNQGR G  GL+GE G+ GQ G  GR G  G  G  GD G  G  G  I GP       G PG  GLPG  G+ G+ G+ G  G     G  GE G PG PG+ G  G  G+RG    +G  G  G  G  G  GL G+ G+ G  G                 G  G  G  G +G  G  G+QG  GD G  G  +PG+ G  G  G  G+ G  G+ G+P + GR G  G  A+ ++   G  G+NG  G++G  G+ G  GL G  G  G  G  G  G  G  GL
Sbjct:  425 RGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDI--QGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPG-----LPGIPGYPGMKGEAGEIVGPMENPAGI-------------------PGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLG---IPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQV-----------------AGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPG------------------ERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDV-----GYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGH---DGLPGAPGVPGVEGVPGLEGDCGEDGYPGA---------------PGAPGSNGYPGERGLPGVPGQQGRSGDNGYPG--APGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGL 1493          

HSP 5 Score: 171.785 bits (434), Expect = 2.290e-42
Identity = 361/1142 (31.61%), Postives = 447/1142 (39.14%), Query Frame = 2
Query:  425 PGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGE-RGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGV---AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEI--GQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPG--TPGDNGTIGDRGRRGEMGDNGTIGNTGP----------------DGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGY--------------FGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG----DSVNSTKGDIGQKGHRGNRGFKSINITHGDKG 3721
            PG  G  G  G  G  G+               PG  G DG  G  G PG  G +GD GD G     S G RGD G  G  G  G+ G  G  G KG EG  G NGT G  G  G  G  G+       Q G+ G  G+SG  GE   ++                            QG  G+       G  G  G+ G+PG+ G  G+KG  G PG  G PG PG  G +G++G +       K +           S    +     +  +         G +G  G  G  G +G  G  G+ G DGP G   +KG                      +G  G  G  GK GK+G     GE GS                  +GE+G  G         G PG     G PG  G+ GF+GD G          P+G +GE  G+ G  G  GF G  G KG  G +G  G  G  G    PG  G+ G  G  G   EKG                              D+GE G PG  G  G  G  G+ G  G +G+ G        G PGL       G  G+ GI GD G+ G SGEKG+       +KV          GE G PG++GV    GP G NGE+G       DG  G  GD G  G  G  G  G N  +G  G  G  GKPG  G +G+                              G+ GL    G  G+ G+KGE GEI        G  G+ G++G  G  G  G  G+ G        G PG +G PG+ G+ G RG  G      SLG+ G +G PG   PG  GT G +G RG  G  G  G  GP                 G +G  GL G++G  GL G        G  G  G  G  GERG++G  G  G  GE G+RG QG  G +  G  G+ G PGL GY              FG  G  G P  +G  G  G+   G  G  G DG  GT G  G+ GMNG  G  G+ G+ G  G  G  G++G+ G PG RG  G  G +GE G  G++G  G  G  G++G       +   G  G  G  G  GF  +   HGD G
Sbjct:   42 PGTKGERGNPGFGGEPGH---------------PGAPGQDGPEGAPGAPGMFGAEGDFGDMG-----SKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSG-----QNGNPGRPGLSGPPGEGGVNS----------------------------QGRKGV------KGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQ---------GPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKG---------------------QKGDLGDAGQRGKRGKDGVPGNYGEKGS------------------QGEQGLGGTP-------GYPGTKGGAGEPGYPGRPGFEGDCG----------PEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKG------------------------------DRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYD----IQGPPGLDGQS---GRDGFPGIPGDIGDPGYSGEKGFPG--TGVNKVGPPGMTGL-PGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGL-----------------------------SGSPGLP---GIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQG------SLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGL------PGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFN--GIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLP--GPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNG 970          

HSP 6 Score: 163.696 bits (413), Expect = 6.718e-40
Identity = 315/987 (31.91%), Postives = 408/987 (41.34%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFS--IGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKG---IKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGD------------DSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNT--GPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKG 3304
              G QG PG  G +G  G+QG +G  G  G  GD    G+PGT G  G+ G  G PG  G +G  G   P    +   G  G +G  G+ G +G +G  G  GP G +G  G  G +G  G  G  GL G+   +     G +GE G +G DG+ C + G            +        +   G  G++G PG  G  G  G  G +G PG  GL G     G+ G+ G+ G PG+PG +GE G +G  G +G  G    RG+ G  G +        +   G           G  G +G  G+PG +G  G  G+ G DG +G   ++G  G  G  G +G+ G EG +G  G+PG  G  G +G  G    +G+ G +G  G  G  G       +G+ G  GN+       G PGD               +G+PG+ G+RG  GD              G+ G  G  GD G  G  G  G  G  G  G  G+KG+ G    PG +G  G  G  GL GE GE G+                            G  G PG PG  G+ G  G  G  G NG+ G RG     G+PGL     + G  GY G  G  G  G  G  G A   N  +  +  + +   +GE G PG+ G+ G                     G+                     G  G++G+DG PG+ G  G  G NG  G  G  G             G  G  GL G  G +G  GL G+RG  G  G  G  G++G  G +GD G+ G  G  G    N   G PG +GLPG+ G QG  G+NG  G     G+ G RG  G PG +G  G  GR G  G  G +      P G+ G  G  GEKG  GL G        G  G  G  G  G  G +G  G  G  G  G  GDQG +G +  G  G  G PG  GY G  G
Sbjct:  654 FPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDS-FPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMR-----GQQGEVGFNGIDGD-CGEPGLDGY------PGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGY---------PGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPG------YRGQPGEPGNLAYP----GQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSY-----------PGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGF---------------------------PGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQ---DGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPG-APGENGDNGNQGRDGQPGLRGESGQPGQPGLPG-------------------RDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGM--------PGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSN---GYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGD------NGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAA--GRTGNPGLPGTPGYPGSPG 1528          

HSP 7 Score: 124.405 bits (311), Expect = 5.718e-28
Identity = 255/824 (30.95%), Postives = 332/824 (40.29%), Query Frame = 2
Query: 1643 PGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGD---------------------KGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSN------------------------------ETIQGLQGYKGIKGDKGNRGPSGEKGW--AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGT--KGDRGDIGQKGIQG----PSNPNATMGIPGSKGLPG--IKGVQGDRGNNGTD------GNCTSLGLMGERGFPGT-------PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENG------TRGLTGEKGDAGLNGTIXXXXXXXXXXXX---XIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSS------------PGEKGEVGSPGLKG------------------YFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDN-----GTIGDEGDKGMNGTIGLEGEIGNNGTIGD-------QGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEG 3739
            PG     G PG  G+ G  G  G+   +     P G  G  GD GD                     +G  G PG  G +G  G NGT G  G  G +  PG+ G+ G+ G  GL G  GE G  ++    +                 G+ G  G+PG+PG  G  G  G  G  G  G+ G  G  G  G  G+ ++                              E +QG  G  G+KG+KG  GP G  G    +       +K  +    + G++G  GK GV G  G  G +G                     E+G  G  G   T G  GE G  G+PG +GD G            G   +G      + + G  G +G KG  G  G  G  G RG +G  G  G+ G+DG  G   KGDRG+ G  G  G    P  P    G PG  GLPG  I+G  G  G +G D      G+    G  GE+GFPGT       PG  G  G+ G  G +G +G  G  G +GE G        G+ G  GD G  G  G  GP G  G     G+ G  G+ G  GS G  G+ G  GI G  G+KG +             PG KG+ G PGL G                  + G +G  G+   DG+RG  G  ++G+ G  GP GD+     GT G +G++G +G  GL G  G  G            G+ G  G  GLPG+RGA G  G+ G  G  G  G  G+RG  G  G       G+ G +G +G  GF  I+   GD G+ G +G
Sbjct:   42 PGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAP-GMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVK----------------GESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQG---------------------EQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCG----------PEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEP-GDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQG--SLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPG--FPGLHGEPGMRGQQGEVGFNGID---GDCGEPGLDG 809          

HSP 8 Score: 98.9821 bits (245), Expect = 3.052e-20
Identity = 150/429 (34.97%), Postives = 184/429 (42.89%), Query Frame = 2
Query: 2630 GDKGNKGLKGN------------QGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGD------------------------------------NGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGL-KGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG--ERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGT 3760
            GD G+KG +G+            QG  G  GLKGE G  G NGT G  GM G  G  G  G  G  G  G S P    G+  S+G  G+KG  G  G  G  GN    GL G +G PG  G  G  G  G +G MG                                      G +G  G  GE G  G  G  G  GL+G              G  G+ G++G  G  G+ G RG+ G+ G+ G KG  S GE+G  G+PG  G  GG G  G P + G  G+ G    +G   G++GP G  G  G +G KG+ G  GL G +G  G +G  G  G+ G  G+PG  E+G  G+ G  G  G+ G  G  GD G  GE G      +G  G  G  G  GF  I    GD GD G  G  G  GT
Sbjct:   85 GDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGV-NSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGP------------PGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKG--SQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGI---PGDIGDPGYSGEKGFPGT 495          

HSP 9 Score: 82.8037 bits (203), Expect = 2.325e-15
Identity = 122/381 (32.02%), Postives = 157/381 (41.21%), Query Frame = 2
Query: 2756 GTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLP------GIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT--------------------------------AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG----DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGD-KGDEGPSGVNGTTG 3766
            GTKG+RG+ G              G PG  G P      G  G  G  G  G  G+  S G  G+RG PG+PG  G  G  G  G  G+ G  G  G DG  G  GL G  G +G NG           G  G+ G  GE G+N S+G+ G +GE G  G  G+ G S  PG KG  G PG  G  G  GV G+  + G R  +G+                                  +G  G  G  G +G +G  G  G++G  G  G  G  G +GD G++G+RGK G+PG                     N G++G  GE+G         TKG  G+ G+ G  GF+      G  G+  G+ GP G  G  G
Sbjct:   43 GTKGERGNPG------------FGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGN---------PGRPGLSGPPGEGGVN-SQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVR-TSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPG---------------------NYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDG 379          

HSP 10 Score: 62.3882 bits (150), Expect = 3.969e-9
Identity = 71/198 (35.86%), Postives = 93/198 (46.97%), Query Frame = 2
Query: 2948 TPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLK---GYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNG--TIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG 3526
             PG  G  G+ G  GE G  G  G  GP+G  G  G+ G +GD G  G+               +G  G+RG+ GS G  G +G  G+           PG KGE G PG     G+ G  G+ G P + G+ GN G   +     SGP G+ G  + G +G KG +G  G+ G  GN+G  G +G KG  G  GLPG
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGS---------------KGARGDRGLPGSPGHPGLQGLDGL-----------PGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGL-----SGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPG 207          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 184.496 bits (467), Expect = 4.339e-48
Identity = 237/657 (36.07%), Postives = 298/657 (45.36%), Query Frame = 2
Query: 1661 EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPG------------------EKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGD---KGFSGEPGLHSNETIQGLQGYKGIKGDKG------NRGPSGEKGW--AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGN---NGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGG-SSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGER 3532
            +GVPG  GK G  GDKG+                 GD GDKG TG PG  G KG  G  G  G KGKDG    PG                  EKG KGS G  G  GEKGE G      +                   GD+GE+G  G PG  G  G +G  GA+GT G  GD+G    KG  G PG   +   +G +G  G KGDKG      ++G  GEKG   A+  + T   K ++  D  KG  G PG+ G        GEKG+                                 +G  G+ G DG PG KGD+G KG +G  G  G  G           S GDKG KGL G +G +G  G KG  G  G  G  G  G DG    +GT G +GD G+KG+ GP       G PG+KG  G KG  G +G +GT G+    G  G +G  GTPG  G  G++G  G  GD G  G  G  G+ G +G  G KG  G  G+               +G  G++G++G KG  GA G  G +GD+G KG    PG+KG+ G  G  G  G KG  G P + G +G+ G    G  G  G  G +G  G +GDKG  G IG  G+ G+ G  G  G+ G++G+ G PG++
Sbjct:   76 DGVPGTNGKDGTPGDKGDT----------------GDKGDKGDTGAPG-VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSK------------------GDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGD------KGEKGL---------------------------------DGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPG-----------SKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGS---------------KGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQK 632          

HSP 2 Score: 163.696 bits (413), Expect = 3.196e-41
Identity = 237/634 (37.38%), Postives = 299/634 (47.16%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGT------------------------HGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVI------GDRGDKGFSGEPGLHSNETIQGLQGYKGIKG 2218
            G+ G PG+ G  G  G +G  G  G VG+KGD G  G PG  G DG  G                          G+PG+ GDKG++G++G NG  S G++GD GE+G +G  G  G KG  G KG +GT G  G KGS G  G  G  G + +      GDKGEKG  G  G+   +    S             G KGEKG  G +G  G PG  G  G DG KG +G PG +G KG KG DG  G+KG  G PG +G++G  G  G +G  G    +G++G+KG         AD  KGA G  G+KG  GE G+ G+ G  G  G  GD G KG DGP G +                           G PGAKG  G++G +G    +G  GS G +G  G KG     G KG+KG      G +GP+GD G   ++G PG KG +G KG           D  KG+ G  G  GDKG  G  G  G KGA G  G+ G KG+ G   +PG+KG KG KG +G  G+KG+ G   +       G                QGE+G  G PG  GQ+G  G+ G  G  G I      GD+GDKG  G+PG    +   G +G  G  G
Sbjct:   83 GKDGTPGDKGDTGDKGDKGDTGAPG-VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNG--SPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGD-----TGDKGEKGSDGAKGDKGANGTPGSK------------GDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGA------------------------DGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKG----EKGLDGPKGDKG---ADGTPGAKGDKGEKG----------ADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG----------------QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 639          

HSP 3 Score: 155.606 bits (392), Expect = 1.345e-38
Identity = 215/587 (36.63%), Postives = 268/587 (45.66%), Query Frame = 2
Query: 2054 GIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNAT--------SKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGE------------NGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP-GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEK---GRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGD-SVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEG 3739
            G+PGT+G++GT G+ G        GD+GDKG +G PG+             G+KGD G +GP GEKG   D  A            K ++     KGEKG PG+ G                                               G  GE G +G PG KGD+G                            G  GN G KG++G  G KG  G  G  G  G+ G  G DGN G+KGD GD G+KG  G        G PGSKG  G KG  G +G +GT G+    G  G +G  GTPG  G  G++G  G  GD G  G  G  G+            +GT G  G+KG+ GL+G  G +G  G KG  G  G  G++G  G+ G  GA G  G +GD+G KG   P G+KG  G+PG KG  G KG  G    DG  G+ G    G  G  G DG  G  GD+G+KG++G  G +G  G  G  GD+GEK   G +G  G PG +G  G KG+ G  G  G  G  G +G  GEKGD      KGD G+KG  G  G K  +   G KGDKGD+G
Sbjct:   77 GVPGTNGKDGTPGDKG------DTGDKGDKGDTGAPGV-------------GVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKG---------------------------------------------DKGEKGEKGSNGSPGSKGDKG--------------------------EKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDK--GADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG 571          

HSP 4 Score: 145.591 bits (366), Expect = 2.528e-35
Identity = 252/690 (36.52%), Postives = 304/690 (44.06%), Query Frame = 2
Query: 1067 DGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNM-----------ERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG-TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSK---GLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG 3091
            DG+PG  G  G PG++G+ G  GDKGD G  G  +           E+G+ GDKG          D  KG KG  G KG  G  G KG  G  G  G+ G  G KG  G  G++   G  G  G  G KG +G  G KG +G  GAKG  G  G  G T  +GE GS G +G KG  G   ++G KGEKG  G   G +G  G  GD  ++G  G  G  G KGDKGE      LD PK         GDKG  G P   G KG KG+ G  G KG DGT   PG KG KG KG +G  G+KG  G                            +G  G PG  G  G+ GT+G  GA+GT G  GD+G+KG  G  G       +G  G  G KGDKG +G  G KG     + T   K ++  D  KG  G PG+ G        GEKG+                                 +G  G+ G DG PG KGD+                             G+KG  G KG  G  G KG KG++G  G  G  G  G  G+ G KG++GDIGQ G +G        G PG K   G PG KG +GD+G  G  G     G  G+ G PG  GD G  GD G+ G+ GD G  G  G  G+ G  G  G+KG  G  G
Sbjct:   76 DGVPGTNGKDGTPGDKGDTGDKGDKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADG-AKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKG----LDGPK---------GDKGADGTP---GAKGDKGDKGADGAKGADGT---PGSKGDKGEKGLDGPKGDKGADGA---------------------------KGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKG------DKGADGTPGAKGDKGEKGADGAKG----ADGTPGSKGDKGADGAKGADGTPGQKGD------KGEKGL---------------------------------DGPKGDKGADGTPGAKGDK-----------------------------GEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKG-QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 639          

HSP 5 Score: 139.428 bits (350), Expect = 2.265e-33
Identity = 250/738 (33.88%), Postives = 313/738 (42.41%), Query Frame = 2
Query:  632 GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKE-------------ANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIP---GDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQ 2788
            G  G NG+ G  G +G  G KG++G  G  G +GV G  G++G  GEKG  G +                 K   G+KGEKG  G+ G+      + SN            GS G KG++G +G  G PG  G  G DG KG +G P   GD+G  G KG DG PG KG  G  GE+G  G  GDKG  G  G   ++GE+G  G                    GSKG  G  G+KG+ G PG  G  G+ GL GP G  G++                           G PGAKG  G +G +G    +G  GS G                KGEKG        +GP+GD G D ++G  G  G +G KG+KG    K     P  KG  GE+G  G KG  G  G  G KG KGE G  G KG DGT    G+KG  G+KG++G  G+KG+ G                          GD+G  G PG  G  G+ G +G  GA+GT G  GD+GDKG  G  G    +   G +G KG KGD G  G  G+KG                    KG+ G PG+ G  G  G  G+KG KG                                   GE G+DG+PG KG +G                            G KG+KG KG+ G+ G KG KG++   GQ+G  G+ G DG  G KG  G  GQ
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPG-VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSN------------GSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTP------------GSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGAD---------------------------GTPGAKGDKGDKGADGAKGADGTPGSKGD---------------KGEKGL-------DGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPK------------------GDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKG-------------------EKGQDGQPGQKGQDGQPGQKGDKGDKG----------------------------------QGEKGQDGQPGQKGQDG--------------------------QPGQKGDKGEKGDIGQPGQKGDKGDK---GQDGQPGQKGQDGQPGQKGQDGQPGQ 640          

HSP 6 Score: 138.658 bits (348), Expect = 3.897e-33
Identity = 257/757 (33.95%), Postives = 319/757 (42.14%), Query Frame = 2
Query:  713 GFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG--------NVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPG 2956
            G  GT G +GT G KG  G+KG KG +   P +  G KG+ G  G  GE   D  + +    G+ G  G +G KG+KG  G +GE G PG+ G  G  GEKG  G PG +G KG KG DG PG K               GDKG  G  G +   G +GDKG+                            G+KG+ GNPG  G TGD G KG DG  G +                           G PG+KG  G++G +G    +G  GS G +G  G KG     G KG+KG  G           G  G +GD GD  ++G  G  G  G KGDKGE      LD PK   G++G  G KG  G P   G KG KGE GT G KG DGT   PG KG KG KG +G  G+KG  G                           D+GE+G  G  G DG  G+ G+ GA+G  G  G  G KG  GE GL   +  +G  G  G KGDKG +G  G KG A+    +   K ++  D  KG+KG  G  G  G  G  G+ G                                   G  GE G+DG+PG KG +G                            G KG+KG KG          +GE+G+ GQ G  G+ G  G  G KG++GDIGQ                     PG KG +GD+G +G  G     G  G++G  G PG
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKG-DTGAPGV--GVKGDPGAQGPPGEKGKDGDKGA---PGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPK---------------GDKGADGAKGADGTPGSKGDKGS---------------------------DGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGA------------------------NGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKG----LDGPK---GDKGADGAKGANGTP---GAKGDKGEKGTDGAKGADGT---PGAKGDKGEKGLDGPKGDKGADGTPGAKG---------------------DKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKG-ADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQ------------------------------PGQKGDKGEKGQDGQPGQKGQDG--------------------------QPGQKGDKGDKG----------QGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQ---------------------PGQKGDKGDKGQDGQPGQKGQDGQPGQKGQDGQPG 639          

HSP 7 Score: 132.109 bits (331), Expect = 5.354e-31
Identity = 179/522 (34.29%), Postives = 236/522 (45.21%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF----SIGTRGDNGERGINGTQGINGT------KGE------RGPKGFEGTMGVNGTKGSKGRIGEKGLKG-KEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFK--GDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGS 1915
            KG  G  G+ G NGT G +G  G +G  G KG  G  G  G  G DG  G  GTPG+ GDKG++G  GP G      + G +GD G++G +G +G +GT      KGE      +G KG +G  G NGT G+KG  GEKG  G K A+     +GDKGEKG+ G  G+   D                              G  G  G  G+ G DG KG +G PG +G KG    DG  G  GTPG+ G++GE+G  G KGD+G  G    +G++G+KG                             G+KG+ G PG  G  GD GL GP G  G++                           G PG+KG            +GE G I                  G+ G  G+  G++G  G PG    +G PG KG +G K  G+KG+     +     G  G++GD G+KG  G PG+ G KG KG++G  G KG+DG   +PG+KG+ G  G 
Sbjct:  240 KGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGAD------------------------------GTPGAKGDKGEKGADGAKGADGTPGSKGDKGA---DGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGA---------------------------DGAKGADGTPGSKGDKGDKGLDGPKGDKGAD---------------------------GTPGSKG-----------DKGEKGDI------------------GQPGQKGD-KGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQK-GQDGQPGQKGDKGEKGDIGQPGQKGDKGDKGQDGQPGQKGQDG---QPGQKGQDGQPGQ 640          

HSP 8 Score: 55.8398 bits (133), Expect = 3.086e-7
Identity = 120/356 (33.71%), Postives = 147/356 (41.29%), Query Frame = 2
Query: 3245 PGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIG---------------LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMG 4267
            PG  G+ G+PG KG  G KG          +G+TG   +G+KGD G  G  G  G +GDKG  G  G                +GE G+ G  GD+GEKG +G  G PG +G  G+KG  G  G       KGD+G  G KG       G  G KG +G+ G K  +   G KGD GD+G  G +G  G                                                D G +G PG KG    +  DG  G  G PG KG KG  G KG  G  GQKG+ GE  L                  GP GD+G  G  G  G  G+ G +G  G  G+PG +G KGE G
Sbjct:   79 PGTNGKDGTPGDKGDTGDKG---------DKGDTGAPGVGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGP------KGDKGADGAKG-----ADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKG------------------------------------------------DKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGL-----------------DGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKG 349          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 183.726 bits (465), Expect = 4.490e-46
Identity = 92/231 (39.83%), Postives = 121/231 (52.38%), Query Frame = 2
Query: 4730 RSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSS--LLPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            R   +  +H Q     +   CPEG   +  GYS +   GNE     DLG   SCL++FS  P + CD    C++  RN +SYWLS+   +P+  PV   E++  ISRC VC APAN  A H Q T+Q   CP  W+ LW GYS  MHT     G  Q  SSPGSCLE  R  P IECN     CH + +   ++L  + + + F  P  +T      L   +SRC+VCVK+
Sbjct: 1529 RDGFVLVKHSQT---TEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPMM-PVNEREIEPYISRCAVCEAPANTIAVHSQ-TIQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTL-KSGNLRTRVSRCQVCVKS 1753          

HSP 2 Score: 174.866 bits (442), Expect = 2.413e-43
Identity = 346/1115 (31.03%), Postives = 453/1115 (40.63%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVG-----LKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKG------------------SKGRIGEKGLKGKEANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG--------IPGDRGLKGIK------------GDDGLPGEKGT-----PGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG-----NVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGA---NGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSK------GLPGIK------GVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG--TIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG-GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG 3526
            + G+ G PG  G  G  G+ G  G RGP G     L G  G  G PG  G DG++G +G PG  G KGD G     GT S    G  GE+G+ G  G  G +G+RG  G  G +G  G  G                    G  G+KG   +   +P      G KGE G  G+ G +            G+ G  G+            +G+ G+PG  GK G DG  GL G         PG  G  G K            G  G+PGE        P  PG+ G  G  G KG+ G  G+    GE G  G   +          G  G  G  G  G+ G  G  G PG+ G  GD+G                                        PG  G+ G++G+ G  + G+ GS                G+KG+ G  G      + G+ G  G PG    +G+PG+ G+ G+ G+KG+A             G  G  G +G+ GFPG++G  G  G  G  G+ G  G +   G+ G  G  G+ GL G  G  G           G +G  G  G PG  G +GE G+PG+PGT G  G  G  G    +G +GV G +GD+GF+G P                  G+KG  GP+                    +D  KG+ G PG+ G+ GP GP+G  G+ GF G+ G                          G  G+ GE G PG+ G                               G +G  G  G  G  GF G+KGE G  GQ+G  GR G+ G  G KGD G  GQ G+ G    +   G+PG +      GLPGI       G  G +G NG  G     GL GE+GF GTPG  G    +G  G  G +G  G  G  G++G  G  G++G  GL+G   +G    +  +  + I G +G  G  G +GK G  G  G +G+ G+ G   +PG KGE G PG  G  G  G  G+P K G  G  G+    G  G  G  G+ G  G  G  G  G  GL+GE G  G  G +GE G  G  G+PG
Sbjct:  461 LPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRG-----GTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGE------------KGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRP---GEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVG---------------------------------------NPGLPGLNGQKGEPGVGVPGQPGS------------PGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDA-------------GLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLP------------------GEKGEAGPAA-------------------RDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGL----------------------PGYGQPGQPGEKGLPGIPG-----------------------------KAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGL---KGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPG 1400          

HSP 3 Score: 150.599 bits (379), Expect = 5.484e-36
Identity = 333/1053 (31.62%), Postives = 431/1053 (40.93%), Query Frame = 2
Query:  974 IPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEK--GTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRG-------IPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGF--------------------------KGDKGEAATKCELD-CPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPG---------EKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGI--PGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST-GDKGNKGLKG---------NQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPG-----------------SKGLPGIKG---VQGDRGNNGTDGNCTSLGLMGERGFPG---TPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARG------------EQGIRGDQGIKG-GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG-------ITAIGLKGDS--------------GPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGD------KGDKGDEGPSGVNGTTGYV 3772
            IPG  GK   DG+ GL+G PG +G  G+ G  G PG+   G PG PG++G  G  G  G  G+ G     G +GD+G  +   C                   GE G  G  G PG  G  G  G+ GP G  G + + G  G PG  G  G++G  G  G +G        PG  G  G +G+NG    G+ G  G  G  G  G   A G  GEKG      G  G  G PG D   G+PG KG+ G+                          +G  GE A + +++  P G  G  G  G KG  G+PG+ G  G  G  G  G+KG  G    PG         +KG  G  G  G+ G KG++G       N                  G +GE G+  PG PG+ G  G  G+ G  G  G  G  G +GF G PGL   + + GL G  G  G+KG+ G  G  G                    +G  GFPG+ G+ G  G  GE G+ G  G  G  G  G                   +G+ G  G  G PGMKG+ GI G  G  G  G  G  G  G KG     G  G  G+KG           G  G  G+KG+RG  G  G  G  G    +G KGD G  GQ G++GP  P+   G+PG                  KGLPGI G    QG  G+ G DG     G+ GE G+PG    PG +G  G  G++G++G +G  G +G  G +G  G+ G +GD G  G               + G+ G+RG++G  G+ G  G            E+G  G  G  G   SPG  G+ G PG+ G  G  G  G P ++G  G +G           G  G S              G DG  G  G +G+ G++G  G  G  G +G  G  G KG  G  G+PG+RG  G                 G  G+ G+ G  +   KG++G  G  G  GF  I    G+       G KG+ G  G  G  GY 
Sbjct:  458 IPGLPGK---DGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRG-GTCSACAPGTK--------------GEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENG--FPGQPGVDGLPGPSGPVGPPGAPGYPGEKG----DAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLN------------------GQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPG-------------------REGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAP---------------GQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG---------------LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGL---------------PGVPGRDGQPG--IPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYA 1402          

HSP 4 Score: 142.51 bits (358), Expect = 1.909e-33
Identity = 339/1023 (33.14%), Postives = 426/1023 (41.64%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPK--------GFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGL--EGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE---MGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGN---------------RGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKG---DRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPG---DNGTIGDRGRRGEMGDNGTIGNTGPDGEN-----------------------------------GTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGE 3262
            +KGE GFPG+    G DG  G  G  GP G  G  G  G+ G  G+ GK G  G PG  G+KG+ G   P      G +GD G  G+ GT G+ G  GE  P+        G  G  G+ GTKG  G  G  G           + G  G  G+ G  G++          + G  G  G  G  G  G  G +G++G PG  G NG  GE G+   G PG  G  G+KGD GLPG  GTPG  G++G  G  G KG  GL G + + G  G+KG A +                      G  G +GS G PG +G  G  G+KG DG  G   V G          KG  G  G+ G  G+PGA G  G +G  G   + G  G  G  G  G  G K   GV G  G  G + G  G  G PG D   GVPG+KG RGF G  GE          KG  G     G KG  G PG+ G +G +G +G  G+ G  G +  PG  G+ G  G  GL G  G+ G   R  A                   G  G+ G+PG PG  G++G  G+    G +G  GV G +GD G SG+PGL     + G  G  GI+GDKG                 G  GE G+              F     G  GFPG  G  G  G +G  GI G                               +G  G+ G++G PG+ G++            G  G  G  G  G S  G  G  G  G QG+ GF GL G++GE G +G  G  G+ G +G  G    +GD+G  GI G    +   G+PG  G PGI G++G+ G           GL G+ GFPG PG   + G  G  G +GE G  GT G  G  GE                                    G +GL G  G  GL G  G+ G  G  G  G  G+ G+RG +G  G  G  GE+G+ G  G      PG  G+
Sbjct:  620 LKGENGFPGQ---PGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPG-----------EVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGL---------------------PGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTG---------LKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPG-MKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGE----------KGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPG-YGQPGQPGEKGLPGIPGKAG---RQGAP------------------GSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFA----GTPGFPGLKGSPGYPGQDGLPGIPGLK---------------------------GDSGFPGQPGQEGLPGLSGEK------------GMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGG---------AGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGF-----PGLDGQ 1508          

HSP 5 Score: 89.7373 bits (221), Expect = 2.147e-17
Identity = 270/777 (34.75%), Postives = 322/777 (41.44%), Query Frame = 2
Query: 2048 IPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKG----LKGNQGRQGFKGLKGERGEIGQNGTTGRIGM---------------DGNNGTKGDRGDIGQKGIQG-PSNP-NATMGIPGSKGLPGIK------------GVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKGE 4279
            IPG PG  G +G  G  G  G  G  G  G     G PG      + G  G KG  G  G RGP G                    D   G  G PG+ G  GP G +G  G+ G  G  G+ G +G        G +GE+G    +G  G  G+ G PGM G   +                       +   G  G KG    L    G  G+ GLKGE G  GQ G  G  G                 G+ G  G  G  GQ G+ G P N   A  G PG  G PG K            G+QG  G    + N  +    G+ G PG PG  G  G  GR GE+G            + G  GL G KGD+GL G  GL G  G  G KG  GV G  GI G KG +G  G  G+ G +G  G   PG+ G  G PGLKG  G  G+ G P  +G+RG  G  A GLKG    DG  G  G  G  G  G  GL G  G  G+ G  G+ G  G  G+                        KG+ G  G  G  V   KGD+G  G  G  G        G KG+ G  G  G  G  G  G  G  G KG  G  G  GT G+ G  G  G  G  GL G  G  GD G +G PG+KG A   + DG  G  G PG  G +G +G  G  G+ G KGE G P  G+ G+ G +G  G  GK G  G  G  G++G  G  G  GE+G  G+ G PG  GL G  G+KG+
Sbjct:  426 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQS-IPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPG--------------------DSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGP--VGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPE-NQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVG------------QPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPG--APGLKGG---DGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGM------------------------KGEDGLPGLPG--VTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGD 1135          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 183.726 bits (465), Expect = 4.490e-46
Identity = 92/231 (39.83%), Postives = 121/231 (52.38%), Query Frame = 2
Query: 4730 RSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSS--LLPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            R   +  +H Q     +   CPEG   +  GYS +   GNE     DLG   SCL++FS  P + CD    C++  RN +SYWLS+   +P+  PV   E++  ISRC VC APAN  A H Q T+Q   CP  W+ LW GYS  MHT     G  Q  SSPGSCLE  R  P IECN     CH + +   ++L  + + + F  P  +T      L   +SRC+VCVK+
Sbjct: 1529 RDGFVLVKHSQT---TEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNDKSYWLSTSEAIPMM-PVNEREIEPYISRCAVCEAPANTIAVHSQ-TIQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTL-KSGNLRTRVSRCQVCVKS 1753          

HSP 2 Score: 174.866 bits (442), Expect = 2.413e-43
Identity = 346/1115 (31.03%), Postives = 453/1115 (40.63%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVG-----LKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKG------------------SKGRIGEKGLKGKEANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG--------IPGDRGLKGIK------------GDDGLPGEKGT-----PGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG-----NVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGA---NGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSK------GLPGIK------GVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG--TIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG-GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG 3526
            + G+ G PG  G  G  G+ G  G RGP G     L G  G  G PG  G DG++G +G PG  G KGD G     GT S    G  GE+G+ G  G  G +G+RG  G  G +G  G  G                    G  G+KG   +   +P      G KGE G  G+ G +            G+ G  G+            +G+ G+PG  GK G DG  GL G         PG  G  G K            G  G+PGE        P  PG+ G  G  G KG+ G  G+    GE G  G   +          G  G  G  G  G+ G  G  G PG+ G  GD+G                                        PG  G+ G++G+ G  + G+ GS                G+KG+ G  G      + G+ G  G PG    +G+PG+ G+ G+ G+KG+A             G  G  G +G+ GFPG++G  G  G  G  G+ G  G +   G+ G  G  G+ GL G  G  G           G +G  G  G PG  G +GE G+PG+PGT G  G  G  G    +G +GV G +GD+GF+G P                  G+KG  GP+                    +D  KG+ G PG+ G+ GP GP+G  G+ GF G+ G                          G  G+ GE G PG+ G                               G +G  G  G  G  GF G+KGE G  GQ+G  GR G+ G  G KGD G  GQ G+ G    +   G+PG +      GLPGI       G  G +G NG  G     GL GE+GF GTPG  G    +G  G  G +G  G  G  G++G  G  G++G  GL+G   +G    +  +  + I G +G  G  G +GK G  G  G +G+ G+ G   +PG KGE G PG  G  G  G  G+P K G  G  G+    G  G  G  G+ G  G  G  G  G  GL+GE G  G  G +GE G  G  G+PG
Sbjct:  461 LPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRG-----GTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGE------------KGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRP---GEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVG---------------------------------------NPGLPGLNGQKGEPGVGVPGQPGS------------PGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDA-------------GLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLP------------------GEKGEAGPAA-------------------RDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGL----------------------PGYGQPGQPGEKGLPGIPG-----------------------------KAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGL---KGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPG 1400          

HSP 3 Score: 150.599 bits (379), Expect = 5.484e-36
Identity = 333/1053 (31.62%), Postives = 431/1053 (40.93%), Query Frame = 2
Query:  974 IPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEK--GTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRG-------IPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGF--------------------------KGDKGEAATKCELD-CPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPG---------EKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGI--PGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST-GDKGNKGLKG---------NQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPG-----------------SKGLPGIKG---VQGDRGNNGTDGNCTSLGLMGERGFPG---TPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARG------------EQGIRGDQGIKG-GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG-------ITAIGLKGDS--------------GPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGD------KGDKGDEGPSGVNGTTGYV 3772
            IPG  GK   DG+ GL+G PG +G  G+ G  G PG+   G PG PG++G  G  G  G  G+ G     G +GD+G  +   C                   GE G  G  G PG  G  G  G+ GP G  G + + G  G PG  G  G++G  G  G +G        PG  G  G +G+NG    G+ G  G  G  G  G   A G  GEKG      G  G  G PG D   G+PG KG+ G+                          +G  GE A + +++  P G  G  G  G KG  G+PG+ G  G  G  G  G+KG  G    PG         +KG  G  G  G+ G KG++G       N                  G +GE G+  PG PG+ G  G  G+ G  G  G  G  G +GF G PGL   + + GL G  G  G+KG+ G  G  G                    +G  GFPG+ G+ G  G  GE G+ G  G  G  G  G                   +G+ G  G  G PGMKG+ GI G  G  G  G  G  G  G KG     G  G  G+KG           G  G  G+KG+RG  G  G  G  G    +G KGD G  GQ G++GP  P+   G+PG                  KGLPGI G    QG  G+ G DG     G+ GE G+PG    PG +G  G  G++G++G +G  G +G  G +G  G+ G +GD G  G               + G+ G+RG++G  G+ G  G            E+G  G  G  G   SPG  G+ G PG+ G  G  G  G P ++G  G +G           G  G S              G DG  G  G +G+ G++G  G  G  G +G  G  G KG  G  G+PG+RG  G                 G  G+ G+ G  +   KG++G  G  G  GF  I    G+       G KG+ G  G  G  GY 
Sbjct:  458 IPGLPGK---DGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRG-GTCSACAPGTK--------------GEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENG--FPGQPGVDGLPGPSGPVGPPGAPGYPGEKG----DAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLN------------------GQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPG-------------------REGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAP---------------GQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGG---------------LPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGL---------------PGVPGRDGQPG--IPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYA 1402          

HSP 4 Score: 142.51 bits (358), Expect = 1.909e-33
Identity = 339/1023 (33.14%), Postives = 426/1023 (41.64%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPK--------GFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGL--EGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE---MGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGN---------------RGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKG---DRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPG---DNGTIGDRGRRGEMGDNGTIGNTGPDGEN-----------------------------------GTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGE 3262
            +KGE GFPG+    G DG  G  G  GP G  G  G  G+ G  G+ GK G  G PG  G+KG+ G   P      G +GD G  G+ GT G+ G  GE  P+        G  G  G+ GTKG  G  G  G           + G  G  G+ G  G++          + G  G  G  G  G  G  G +G++G PG  G NG  GE G+   G PG  G  G+KGD GLPG  GTPG  G++G  G  G KG  GL G + + G  G+KG A +                      G  G +GS G PG +G  G  G+KG DG  G   V G          KG  G  G+ G  G+PGA G  G +G  G   + G  G  G  G  G  G K   GV G  G  G + G  G  G PG D   GVPG+KG RGF G  GE          KG  G     G KG  G PG+ G +G +G +G  G+ G  G +  PG  G+ G  G  GL G  G+ G   R  A                   G  G+ G+PG PG  G++G  G+    G +G  GV G +GD G SG+PGL     + G  G  GI+GDKG                 G  GE G+              F     G  GFPG  G  G  G +G  GI G                               +G  G+ G++G PG+ G++            G  G  G  G  G S  G  G  G  G QG+ GF GL G++GE G +G  G  G+ G +G  G    +GD+G  GI G    +   G+PG  G PGI G++G+ G           GL G+ GFPG PG   + G  G  G +GE G  GT G  G  GE                                    G +GL G  G  GL G  G+ G  G  G  G  G+ G+RG +G  G  G  GE+G+ G  G      PG  G+
Sbjct:  620 LKGENGFPGQ---PGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPG-----------EVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGL---------------------PGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTG---------LKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPG-MKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGE----------KGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPG-YGQPGQPGEKGLPGIPGKAG---RQGAP------------------GSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFA----GTPGFPGLKGSPGYPGQDGLPGIPGLK---------------------------GDSGFPGQPGQEGLPGLSGEK------------GMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGG---------AGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGF-----PGLDGQ 1508          

HSP 5 Score: 89.7373 bits (221), Expect = 2.147e-17
Identity = 270/777 (34.75%), Postives = 322/777 (41.44%), Query Frame = 2
Query: 2048 IPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKG----LKGNQGRQGFKGLKGERGEIGQNGTTGRIGM---------------DGNNGTKGDRGDIGQKGIQG-PSNP-NATMGIPGSKGLPGIK------------GVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKGE 4279
            IPG PG  G +G  G  G  G  G  G  G     G PG      + G  G KG  G  G RGP G                    D   G  G PG+ G  GP G +G  G+ G  G  G+ G +G        G +GE+G    +G  G  G+ G PGM G   +                       +   G  G KG    L    G  G+ GLKGE G  GQ G  G  G                 G+ G  G  G  GQ G+ G P N   A  G PG  G PG K            G+QG  G    + N  +    G+ G PG PG  G  G  GR GE+G            + G  GL G KGD+GL G  GL G  G  G KG  GV G  GI G KG +G  G  G+ G +G  G   PG+ G  G PGLKG  G  G+ G P  +G+RG  G  A GLKG    DG  G  G  G  G  G  GL G  G  G+ G  G+ G  G  G+                        KG+ G  G  G  V   KGD+G  G  G  G        G KG+ G  G  G  G  G  G  G  G KG  G  G  GT G+ G  G  G  G  GL G  G  GD G +G PG+KG A   + DG  G  G PG  G +G +G  G  G+ G KGE G P  G+ G+ G +G  G  GK G  G  G  G++G  G  G  GE+G  G+ G PG  GL G  G+KG+
Sbjct:  426 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQS-IPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPG--------------------DSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGP--VGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPE-NQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVG------------QPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPG--APGLKGG---DGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGM------------------------KGEDGLPGLPG--VTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGD 1135          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 262.692 bits (670), Expect = 4.184e-70
Identity = 424/1181 (35.90%), Postives = 532/1181 (45.05%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE---PGTVGIDGKNGTHGTPGKIGDKGDEGDRG-PNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGS----IGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMF---------------GKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVM----GKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLK--GNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGI---------QGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP-------GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----------VNSTKGDIGQKGHRGNRGFKSINITHGD-KGDKGDEGPSGVNGTTG 3766
            KGE+G PG  G  G  G QG  G  G  G+ G  GCDG+   PG  G+ G  G  G  G++G KG++G+    NG ++ G +G+ G RG  G  G  G  GE+G +G  G  G  G +G  G  GEKG       KP       G  G+ G+ GE       +S+F                K    + G  G  G+ G+ G  G KG  G  GD GL G KG+ GLPG  G  GR G  G  G  G KGDRG  G N   G  G KG       T      G  G  G                 +G PG  G  G  GL GP G  G    KGG G+PG  GN+G  G +GEKG  G+ G KG                 G  G  G  I+G  G  G  G  G KG K  RG KG  G  G+      G  G  G PG     G PG  G++G  G KG+   KC   C     G +GD G  G  G PGK+G +G  GE G  G +G DG + +   PGEKG  G  G  G  GE G+    + +      G++G  G  G  G +G +G +G+PGIPG  G+ G  GE G +G  G  G  G  G  G PG+   S +   G  G  G KGDKG+ G SGEKG    C        +E K   KG KG PG+ G+ GP G +G  G +G+ G  G+ G +G  G  G +G  G +G+    G+VG  G  GK G++G  G                        N   G +G  G+   G  G  G  GL+GE+G+ G  G  G  G DG+ G  GDRGD G  G+         +G   P    G+ G  G+PGI GV   RG +G  G   S GL+   G PG  GD G  G+ G +G  G  G  G  GP G  G  G  G+KG  GL G  G  G  G  G  G+ G+ G++G+ G+ G+ G  G  G +G+QG  G   P        EKG+ G PG  G  G  G  G P   G +G  G+   G  G  G  GD G  G +G  G+NG    +GE G  G  G  GEKG  G  G+PG  G  G  G  G  G +G  G++GD+G+ G  G            +    G  G KG RG RG   +  T  D +GDKG +G  G  G  G
Sbjct:  133 KGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKP-------GAPGIKGEKGEP------ASSF--------------PVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQ---KGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS-SC---RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC------ALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPG-----------------------RNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGV---RGRDGAKGEPGSPGLV---GMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGE---KGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKG 1241          

HSP 2 Score: 249.595 bits (636), Expect = 3.780e-66
Identity = 421/1290 (32.64%), Postives = 552/1290 (42.79%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLK-----------------------------------------GDIGCDGEPGTV------------GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE----------------------------------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLE---GIPGDRGL--KGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG--VKGKRGF------KGDKGEAAT--------KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--------MGANGTNGVIGDRGDKGFSGE------------PGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGI--------KGVQGDRGNNGTDGNCTSLGLMGERGFPGT---PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIG-----LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXX---XXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G QGFPGE G  G  G  G  G RG  GLK                                         GD+G  GEPG V            G+DG+ G  G PG  GD+G +G+ GP G  S G +GD GE G+NG  G  G KGE                                         GP+G  G  G+ G +G  G+ G  GL G+  N+ P  ++G+KG  G++G  G      G   +           +      G +G +G+ GIPG  G  G+ GE+G +   G PGD  L   G  G  G PG+KG  GRPG  G++G +G KGD G    +   G +GDKGT+ +             G  G++G  GE G  G  G+ G+NG TG  G KG DG  G     G  G P        E  +G+KG+ G PGAKG+ G +G  G   I G  G                 G KGEKG  G   G +G  G  G D   G+PG  +KG+ GF      KGDKG             C LD  K  +  +G+ G+ G TG PG  G  G+ GE G  G+KG  G    PG +G +G  G  G  G +G +G                           + G+ G+ GIPG +GQ G  GE        MG  G NG+ G++GD+G +G             PG   +  + G+ G  GI G+KG+ GP G  G A        +     +D  KGE G PG +G+ G  G  G  G                          G +G     G+ G+ G  G PG+ G +G   +  T          G          G KG++GL G  G+QG  G+ GE+G  G  G  G  G+ G+   KG +G+ G  G++G + P  T G PG KGLPG+         G +GD+G +G DG     G  GE+G  G    PG+ G++G  G  G  G +G  G  G  G  G  G  G+KG+ GL+G              G++G  G  G+ G  G  G +GE+GIRG  G+   + P  +G+ GS G +GY G KG Q      G RG TG   +       GL+G  G  G NG  G +GD G  G IG     ++GE G  G  G  G +G  G  GL GERG  G  G     G  G IG +G+KG+RG  G  G             KGD G +G +G RG        GDKGD+G +GPSG+ G  G
Sbjct:  225 LAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPG--STGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG----SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIP---------GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEF---------------GFKGEKGLSG-APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK--MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPG------------------------NPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVA-GPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG------------------------NDGPKGFAGVTGAPGKRGPAGIPGVSGAKG--DKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGL------------PGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLP-ATVPDIRGDKGSQGERGYTGEKGEQ------GERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVG 1411          

HSP 3 Score: 246.514 bits (628), Expect = 3.638e-65
Identity = 415/1244 (33.36%), Postives = 546/1244 (43.89%), Query Frame = 2
Query:  404 IKGEQG-----FPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERG----------------------------------------PKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG---IPGDRGL--KGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG--VKGKRGF------KGDKGEAATK--------CELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--------MGANGTNGVIGDRGDKGFSGE------------PGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK--------GVQGDRGNNGTDGNCTSLGLMGERGFPGT---PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIG-----LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXX---XXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IKGE+G     FP +  H    G +G MG +G  GL G  G  G  G  G+DG+ G  G PG  GD+G +G+ GP G  S G +GD GE G+NG  G  G KGE G                                        P+G  G  G+ G +G  G+ G  GL G+  N+ P  ++G+KG  G++G  G      G   +           +      G +G +G+ GIPG  G  G+ GE+G +G    PGD  L   G  G  G PG+KG  GRPG  G++G +G KGD G    +   G +GDKGT+ +      D  +G           GE G  G  G+ G+NG TG  G KG DG  G     G  G P        E  +G+KG+ G PGAKG+ G +G  G   I G  G  G                KGEKG  G   G +G  G  G D   G+PG  +KG+ GF      KGDKG             C LD  K  +  +G+ G+ G TG PG  G  G+ GE G  G+KG  G    PG +G +G  G  G  G +G +G                           + G+ G+ GIPG +GQ G  GE        MG  G NG+ G++GD+G +G             PG   +  + G+ G  GI G+KG+ GP G  G A        +     +D  KGE G PG +G+ G  G  G  G                          G +G     G+ G+ G  G PG+ G +G   +  T          G          G KG++GL G  G+QG  G+ GE+G  G  G  G  G+ G+   KG +G+ G  G++G + P  T G PG KGLPG+         G +GD+G +G DG     G  GE+G  G    PG+ G++G  G  G  G +G  G  G  G  G  G  G+KG+ GL+G              G++G  G  G+ G  G  G +GE+GIRG  G+   + P  +G+ GS G +GY G KG QG       RG TG   +       GL+G  G  G NG  G +GD G  G IG     ++GE G  G  G  G +G  G  GL GERG  G  G  G     G IG +G+KG+RG  G  G             KGD G +G +G RG   +N   G KGDKGD G  G +G  G V
Sbjct:  274 IKGEKGEPASSFPVKPTHT-VMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPG--STGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG----SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGP---------PGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFG---------------FKGEKGLSG-APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK--MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPG------------------------NPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPG-IDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG------------------------NDGPKGFAGVTGAPGKRGPAGIPGVSGAKG--DKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGL------------PGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPA-TVPDIRGDKGSQGERGYTGEKGEQG------ERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERG---LNGFEGQKGDKGDRGLQGPSGLPGLV 1410          

HSP 4 Score: 229.565 bits (584), Expect = 6.532e-60
Identity = 408/1166 (34.99%), Postives = 527/1166 (45.20%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG----TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--------EANKP-----KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSEC---VKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-----VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGR-------QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKG---------LPGI-----KGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNG------TIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGE------KGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHG 3712
            KG+ G PG  G  G+ G++GF G  G  G    +G  G PG  G  G+ G  G PG  G KGD G +G  G    +   G +GD G  G+ G  G +G +G  G +G+ G  G +G  G  G  GEKG  G+        E  KP      + E  KG+KG  G  G       + +                        +G  GIPG  G+ G  GEKGL G PG+ G  G  G DG PG  G   + GE G  G+ G KGD+G  G++ E+GE G        +C   +    AKG KG  G  G  G  G  G+PG  G TG  G  GP GP G E    + G  G  G  G  G  GN G+ G RGIPG  G  G  G+ G    G  G                 G++GEKG  G        G +G  G PGD    G+PGV G+ G  G+KG+         P G  G  G  G  G  G  G++G KG  G  G +G+ G  G    PG  G KG  G  G  G++G  G    + A    G  G  G  G  G RG  G  G+ GI G  G  G  G+ G +G  G  G++G  G  G PGL  + + +G +G  G  G +G+ GP+G  GW  +        A   +    GEKG  G+ G+ G  G NGEKG      + G  G+ GS+G  G  G  G  G  G  G     G  G+ G+ G+PG+ G  G+KGE G +G+ G              + G KG +G++G  G        +G KG +GERG  G+ G  G  G+ G  G  G +GD   +G+QGP   +   GIPG+KG          PG+     KG+ G  G NG  G   + GL+GERG PG  G+ G       IG  G +GE G  G+ G  G DG  G  GL G+      KG+ GLNG                EG  G++G  G +G  G  G  G +GD G  G +  G  G VG+PG +G+ G KG      +DGR G  G+   G KG+ G     G  G+ G  G NG  G  G  G  G IG QGE+G +G+ GL GE            TG +G+ G KGDRG+ GE+G       G IGQKG  G     +++   G
Sbjct:  498 KGDAGIPGYPGLKGSKGERGFKGNAGAPG-DSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGA------------------------EGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIK-GEPGFHGRDGAKGDKGSFGRSGEKGEPG--------SCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGP------------PGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVG-------PIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGL--AVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGF-----------TGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGD---RGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNG---------------FEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLN--GNDGPVGAPGERGFTGPKG------RDGRDGTPGLP--GQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGE------------TGNVGRPGPKGDRGEPGERG--YEGAIGLIGQKGEPGAPAPAALDYLTG 1555          

HSP 5 Score: 224.942 bits (572), Expect = 1.401e-58
Identity = 425/1235 (34.41%), Postives = 542/1235 (43.89%), Query Frame = 2
Query:  419 GFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGD------------EGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGT-----MGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN---VMGKEGPRGDPGDDSSEGVP---GVKGKRGFKGDKGEAATKCE--LDCPKGSIGERGDLGDKGTTGF---PGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGI---PGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST-GDKGNKGLKGNQGRQGFKGL--KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK------------GVQGDRGNNGTDGNCTSLGLMGE---------------------RGFPGTP-------GDNGTIGDRGRRGEMGDNGTIGNTGP---DGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVI--GERGI------NGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGP---------DGDNGTIGDEGDKGMNGTIGLEGEI------------GNNGTIGDQGEK---------GRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G PG  G NG DG  G  GY G    KG  G  G PG  G  GK G  GT G  G KG             EG +G  G    G +G  G+ GI G  G+ G+KGERG KG  G      +G  GT G+ G  G+KG  G+         G KG+ G+ G  G  C+                         G +G +G  G+PG  GK+G  G  G  G PG+RG  GI G  G PGEKG  GR    G  G  G+ G   L   ++    +GDKG                          G  G KG+ G PG+ G  G+ G KG  G  G+                         G+ G PG  G  G  G  G  I+GE G  GR+G KG+KG     G KGE G        M  +G +G+PG     G P   G  G+RG+ G KG    +    ++ P+G  G RG+ G++G  G    PGK+G +G  G NG  G +G+ G S +PG  G  G  G  G  G++G  G I    A+            G  G  GD+G+ G+PG+   PG  G+ G  G +G  G  G  G  G  G  G  G        GL G  G KGD+G  G  G KG+A                   G  G PGK G AG  G +G KG KG  G  G+ G  G  G  G  G  G +G     G+ G+ G DG PG KG++G  G +G  G+ G   EKG +G  G S   GD G  G  G  G +G  GL   G  G  G+ G  GR G+DG +G  G++G+ G +G+ G      ++G PG  G PG+             G  GDRG+ G  G     GL GE                     RG PG P       GD G+ G+RG  GE G+ G  G TGP    G  G RGL G  G +GLNG  G +G +G +G  G  GV   GE+G+      NG +G IGA G  G RG  G+      GE G VG PG  G  G KG +G+    G+ G  G   A GLKGD+GP         +G  G  GD+GD+G+ G  GL G +            GN+G +G  GE+         GR G  GLPG++G  G     G  G+ G+ G  G +G+ G  G+  +   +G+ G+KG RG  G        G KGD+G+ G  G  G  G +
Sbjct:  413 GAPGPQGLNGVDGLPGPQGYNG---QKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTP-----GQKGDMGIKGDVGGKCSSC---------------------RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGR---TGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAK------------------GVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAP------------------------GNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGAD------------GSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFA-------------------GVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA-----GEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLI 1536          

HSP 6 Score: 213.001 bits (541), Expect = 5.976e-55
Identity = 347/1027 (33.79%), Postives = 447/1027 (43.52%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE-------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDR--------------GLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDK---GFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGF---KGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGY------FGGKGVQGMPAKDGRRGNTGI 3352
            +KG++G+PG  G  G  G +G  G  G  G KG+ G  GE    G+ G  G  GTPG+ G  G  G  G +     G  G +G +G  G+ G +G KGE             +G KG  G  G+ G  G  G  GE+G  G + N  P+   G +G +G++G  GE                                 QG +G+PG  GK+G  G  G  G PG R              GL G++G+ G  G  G  G PG  G  G  GD+GD GL G +   G  G+KG    I         G  G  G +G  G  G  GS G  G+ G  GD G  G DGP G   V G                 G++G  GIPG  G  G +G  G      TG+ G  G +G  G     G+KG++G  G   G++G  G PG+  ++G PG+ G  G  GD  E   K E     G  G RGD G  GT G+PG+ G  G       L + G+ G   + G++GR G  G +G+ GEKGE G                          G++G  G PGIPG  G +G  G  GA G  G  GDRGDK   G SG PGL       GLQG+ G  G KG RG  G+ G           K ++ +    GEKG  G+ G+ GP G  G KG                                   G  G SG +G PG KGD G +GE G  G+     +        N   G  G  GL G +G  G     GL G  G IG  G+ G  G+ G+ G  G  G  G  G++G + P    G  G +GL G +G +GD+G+ G  G     GL+G++G  G PG NG  G  G  GE G  G  G    DG +GT GL G+KG+ G+   +   GP G  G  G  G  GE G  G +G IG +GE+G +G++G+ G +     PG KG+ G PG +GY       G KG  G PA       TGI
Sbjct:  652 LKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGE---KGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGN------------------------------QGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTG---------------APGKRGPAGIPGVSGAKGDKGATGL-----TGNDGPVGGRGPPGAPGLMGIKGDQGLAG-APGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGE----PGPSGLRGDTGPAGTPGWPGEKGLPG-------LAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWG------------------QPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKG------------------------------DRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQ---GFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGR---DGRDGTPGLPGQKGEPGM---LPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGI 1556          

HSP 7 Score: 192.971 bits (489), Expect = 9.102e-49
Identity = 106/275 (38.55%), Postives = 148/275 (53.82%), Query Frame = 2
Query: 4601 KGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINR-SEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLS--SLLPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            +G+ G+RG  G  GL     +G KG PG P         AA++  + IL  RH Q  T      C  G   + TGYS +   GN++    DLGSP SC+ +FS  PV+ C +   C++  RN +++WL+  + +P+  PV+  E++  ISRCVVC APANV A H Q T++   CP  W  LW GYS +MHT+   GG  Q   SPGSCLE  R  P IECN     CH +     +++  +     F +P  +T     E +  +SRC+VC+KN
Sbjct: 1521 RGEPGERGYEGAIGL-----IGQKGEPGAPAP-------AALDYLTGILITRHSQSET---VPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPMM-PVENIEIRQYISRCVVCEAPANVIAVHSQ-TIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTI-KAGERQSHVSRCQVCMKN 1777          

HSP 8 Score: 192.971 bits (489), Expect = 9.576e-49
Identity = 376/1178 (31.92%), Postives = 492/1178 (41.77%), Query Frame = 2
Query:  644 DNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--------EANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIP---------GDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNME----------------RGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXX----------------VKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSI-----------------------GERGDLGDKGTTGFPGKNGTKGAKGENGTLGIK-----GKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGA---------NGTNGVIGDRGDKGFSGEPGL---HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGL-------KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLM---------GERGFPGT--PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-------AIGLKGDSGPDGDNGT---------------------IGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G RG+ G  G  G KGE G  G EG  G  G KG  G  G++G KG+        +A  P +Q   G+ G  G++GKDG +  D                        G  G++G  G+PG  G  G  G KG +G P         G++G  G +G  GL G +G PG  GE+G+ G  G KG RG  G   E                +GE+G+  ++  +  T            G +G +G+ G  G +G  G  G  GD GL   DG  G + + GG G  G  GN G  G+ G+KG RG PG  G+ G  G+ G    G  G+ G+ G  G  G                        G +G  G V G  GP+G  G     G+PG  G  G  G KGE  T   L+ PKGSI                       G +G  GD G  G+PG  G+KG +G  G  G       G+ GT    G  G+KG  G  G  G+KG++G         +           R GP+GD+G  G+PGIPG DG  G  GE G          NG  G  G++G+ G +G PG         +  L   + +KGDKG  G  G KG               F    KG +G PG  G  G  G  GEKG+                            G    +G+ G +G DG PG+ G                  +        + + GDKG+ G  G +G  G   L       KG +GE GQ G  G  G DG+ G +G  G  G  G QGP       G+ G +GL G +G +G++G  G  GN    GL          G RG PG   PG  G  G  G +GE GD G  G  G  G +G+ G  G++GDAGL G              G  G++GE+G  G  G  G  G  G+ G  G++G    G KGE GSPGL G  G KG +G P  DG +G  G+T         G+ G SG  GD G                      +G +GD+G+ G  G +G  G  G  G+QG  G  G  GLPG+    G+KG  G +G  G +G  G  G  GEKG    +  G  G  G +G++G   I+   G  G+KG++G  GV G  G
Sbjct:   87 EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQD------------------------GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPT--------HTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGL---DGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGE--PGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNG-VDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGT-AGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSS---------CRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKG------------VQGF----KGAEGLPGIPGPKGEFGFKGEKGL---------------------------SGAPGNDGTPGRAGRDGYPGIPGQS---------------IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPP------GVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGV------------SGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRD--GAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPG 1138          

HSP 9 Score: 177.563 bits (449), Expect = 4.236e-44
Identity = 353/1012 (34.88%), Postives = 464/1012 (45.85%), Query Frame = 2
Query: 1586 KGEKGYYGNV----------MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEF----------------KDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDG--KPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNS-STGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKG------------------DRGDIGQKGIQGPSNPNATMGIPGSKG---LPGIKGVQGDRGNNGTDGN------------CTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVI-----------GERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFG---------GKGVQGMPAKDGRRGNTGITAI-GLKGDSGP---DGDNGTIGDEGDKGMNGTIGLEGEIGN-NGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGE------------------NGTIGERGSPGDRGLKGEMGEKGE 4279
            KGE+G+ GN            G  G  G PG     G PG  G++G  G KG+   KC   C     G +GD G  G  G PGK+G +G  GE G  G +G DG + +   PGEKG  G  G  G  GE G+    + +      G++G  G  G  G +G +G +G+PGIPG  G+ G  GE G +G  G  G  G  G  G PG+   S +   G  G  G KGDKG+ G SGEKG    C A  ++K                    +D + GE+G+ G  G  GP GP G +G +G  G  G  G +G  G  G  G+ G +G    NG  G  GE G  +PG  G  G+ G  G  G  G  G  G  G  G+    GD+G+ GL G  GR G  G KG+ G IG  G  G  G+ G +G +G                  ++GD G  G  GP       G PG +G   +PG+ G +GD+G  G  GN               +G+ G++G  G PG  G  G  G +G  G  G  G  G  G+   +G  GE G +GL G  G  G  G  G KG+ G+            G++G +G  G+ G  GE+G +G QG+ G   PGEKG VG+PG+ G  G           G  G P   G +G  G++ + GLKG++GP    G  G  G +G++G+ G  GL   + +  G  G QGE+G  G+ G  GERG  G  G+ G          KGDRG  G  G S    +   KGDIG +G  G  G  +I    G  G  G  G  G+ G  G +G+ G  G  G  G +G  G  G  G+ G  G  G  G PG+ G  G  GL GD G +G    R ++GF G +G  GD+G +G  G+    GL GQKG+ G P L  +               G  G +G  G++GT G+ G+ GE                  NG  GE G PG+RGL G  GE+GE
Sbjct:  513 KGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS-SC---RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC-ALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWG--QPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGA---------KGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGV-TIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLP---GLVGQKGDTGYPGLNGNDGPVGAPGE-----RGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGE 1499          

HSP 10 Score: 142.51 bits (358), Expect = 2.398e-33
Identity = 278/831 (33.45%), Postives = 351/831 (42.24%), Query Frame = 2
Query: 1598 GYYGNV---MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNK--GLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGP-----------------------------SNPNATMGIPGSKGLPGIKGVQGDRGNN-----------GTDGNCTSLGLMGERGFPGTPGDNGTIGDRG---------RRGEMGDNGTIGNTGPDGENGT------RGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGE---------------RGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDS------GPDGDNGTIGDEGDKGMNGTIGLE-------------GEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG----DSVNSTKGDIGQKGHRGNRGFKS--------INITHGDKGDKGDEGPSGVNGTTGYV 3772
            GY G V   + ++G RG PG     G  G+KG+ GF G +G +  K +    KG  G  G  GDKG  G PG +G  G  G  G  G  G  G + K G  G+ G  G  GL G  G  GY  +  +    GE  K+      G +G+ G +G  G+ G  G  G  GE G +G  G  G RG+ G  GE G      ++   G  GIKG+K      GE   +     T  V        + G+KG PG +G  G  GP G+ G+ G  G+ G  GG GD G+ G  G  G  G+    G  G +G  G PG KG+ G  G  G  G++G  G  G                  G  G QG  G  GL G +G  GQ G  G  G  GN G  G +G+ G  G+ GP                                    GIPG  GL G KG +G +GN            GT G   + G  G+ G PGTPG  G +G +G         R G  GD GT G  G  G++G       RG  GE+G  G+NG  G  G  G  G  G+ G  GE               +G  G  G  GA+G QG +G +G+ G   PG KGE G  G KG  G  G  G P + GR G  GI    +KG+       G  GD G+ G  G+KG  G+  L+             G+ G  G  G+ G  G RG TGL G  G  G  G+ G  G  G  G KG++G +G  G    D +    G  GQ G RG  G           +N   G+KGD+G  GP G  G  G V
Sbjct:   76 GYAGCVPKCIAEKGNRGLPG---PLGPTGLKGEMGFPGMEGPSGDKGQ----KGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMK--PGAPGIKGEK------GEPASSFPVKPTHTVMGPRG---DMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPG--IPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSV 886          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 262.692 bits (670), Expect = 4.184e-70
Identity = 424/1181 (35.90%), Postives = 532/1181 (45.05%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE---PGTVGIDGKNGTHGTPGKIGDKGDEGDRG-PNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGS----IGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMF---------------GKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVM----GKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLK--GNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGI---------QGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP-------GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----------VNSTKGDIGQKGHRGNRGFKSINITHGD-KGDKGDEGPSGVNGTTG 3766
            KGE+G PG  G  G  G QG  G  G  G+ G  GCDG+   PG  G+ G  G  G  G++G KG++G+    NG ++ G +G+ G RG  G  G  G  GE+G +G  G  G  G +G  G  GEKG       KP       G  G+ G+ GE       +S+F                K    + G  G  G+ G+ G  G KG  G  GD GL G KG+ GLPG  G  GR G  G  G  G KGDRG  G N   G  G KG       T      G  G  G                 +G PG  G  G  GL GP G  G    KGG G+PG  GN+G  G +GEKG  G+ G KG                 G  G  G  I+G  G  G  G  G KG K  RG KG  G  G+      G  G  G PG     G PG  G++G  G KG+   KC   C     G +GD G  G  G PGK+G +G  GE G  G +G DG + +   PGEKG  G  G  G  GE G+    + +      G++G  G  G  G +G +G +G+PGIPG  G+ G  GE G +G  G  G  G  G  G PG+   S +   G  G  G KGDKG+ G SGEKG    C        +E K   KG KG PG+ G+ GP G +G  G +G+ G  G+ G +G  G  G +G  G +G+    G+VG  G  GK G++G  G                        N   G +G  G+   G  G  G  GL+GE+G+ G  G  G  G DG+ G  GDRGD G  G+         +G   P    G+ G  G+PGI GV   RG +G  G   S GL+   G PG  GD G  G+ G +G  G  G  G  GP G  G  G  G+KG  GL G  G  G  G  G  G+ G+ G++G+ G+ G+ G  G  G +G+QG  G   P        EKG+ G PG  G  G  G  G P   G +G  G+   G  G  G  GD G  G +G  G+NG    +GE G  G  G  GEKG  G  G+PG  G  G  G  G  G +G  G++GD+G+ G  G            +    G  G KG RG RG   +  T  D +GDKG +G  G  G  G
Sbjct:  133 KGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKP-------GAPGIKGEKGEP------ASSF--------------PVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQ---KGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS-SC---RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC------ALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPG-----------------------RNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGV---RGRDGAKGEPGSPGLV---GMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGE---KGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKG 1241          

HSP 2 Score: 249.595 bits (636), Expect = 3.780e-66
Identity = 421/1290 (32.64%), Postives = 552/1290 (42.79%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLK-----------------------------------------GDIGCDGEPGTV------------GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE----------------------------------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLE---GIPGDRGL--KGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG--VKGKRGF------KGDKGEAAT--------KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--------MGANGTNGVIGDRGDKGFSGE------------PGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGI--------KGVQGDRGNNGTDGNCTSLGLMGERGFPGT---PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIG-----LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXX---XXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G QGFPGE G  G  G  G  G RG  GLK                                         GD+G  GEPG V            G+DG+ G  G PG  GD+G +G+ GP G  S G +GD GE G+NG  G  G KGE                                         GP+G  G  G+ G +G  G+ G  GL G+  N+ P  ++G+KG  G++G  G      G   +           +      G +G +G+ GIPG  G  G+ GE+G +   G PGD  L   G  G  G PG+KG  GRPG  G++G +G KGD G    +   G +GDKGT+ +             G  G++G  GE G  G  G+ G+NG TG  G KG DG  G     G  G P        E  +G+KG+ G PGAKG+ G +G  G   I G  G                 G KGEKG  G   G +G  G  G D   G+PG  +KG+ GF      KGDKG             C LD  K  +  +G+ G+ G TG PG  G  G+ GE G  G+KG  G    PG +G +G  G  G  G +G +G                           + G+ G+ GIPG +GQ G  GE        MG  G NG+ G++GD+G +G             PG   +  + G+ G  GI G+KG+ GP G  G A        +     +D  KGE G PG +G+ G  G  G  G                          G +G     G+ G+ G  G PG+ G +G   +  T          G          G KG++GL G  G+QG  G+ GE+G  G  G  G  G+ G+   KG +G+ G  G++G + P  T G PG KGLPG+         G +GD+G +G DG     G  GE+G  G    PG+ G++G  G  G  G +G  G  G  G  G  G  G+KG+ GL+G              G++G  G  G+ G  G  G +GE+GIRG  G+   + P  +G+ GS G +GY G KG Q      G RG TG   +       GL+G  G  G NG  G +GD G  G IG     ++GE G  G  G  G +G  G  GL GERG  G  G     G  G IG +G+KG+RG  G  G             KGD G +G +G RG        GDKGD+G +GPSG+ G  G
Sbjct:  225 LAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPG--STGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG----SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIP---------GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEF---------------GFKGEKGLSG-APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK--MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPG------------------------NPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVA-GPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG------------------------NDGPKGFAGVTGAPGKRGPAGIPGVSGAKG--DKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGL------------PGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLP-ATVPDIRGDKGSQGERGYTGEKGEQ------GERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVG 1411          

HSP 3 Score: 246.514 bits (628), Expect = 3.638e-65
Identity = 415/1244 (33.36%), Postives = 546/1244 (43.89%), Query Frame = 2
Query:  404 IKGEQG-----FPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERG----------------------------------------PKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG---IPGDRGL--KGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG--VKGKRGF------KGDKGEAATK--------CELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--------MGANGTNGVIGDRGDKGFSGE------------PGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK--------GVQGDRGNNGTDGNCTSLGLMGERGFPGT---PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIG-----LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXX---XXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IKGE+G     FP +  H    G +G MG +G  GL G  G  G  G  G+DG+ G  G PG  GD+G +G+ GP G  S G +GD GE G+NG  G  G KGE G                                        P+G  G  G+ G +G  G+ G  GL G+  N+ P  ++G+KG  G++G  G      G   +           +      G +G +G+ GIPG  G  G+ GE+G +G    PGD  L   G  G  G PG+KG  GRPG  G++G +G KGD G    +   G +GDKGT+ +      D  +G           GE G  G  G+ G+NG TG  G KG DG  G     G  G P        E  +G+KG+ G PGAKG+ G +G  G   I G  G  G                KGEKG  G   G +G  G  G D   G+PG  +KG+ GF      KGDKG             C LD  K  +  +G+ G+ G TG PG  G  G+ GE G  G+KG  G    PG +G +G  G  G  G +G +G                           + G+ G+ GIPG +GQ G  GE        MG  G NG+ G++GD+G +G             PG   +  + G+ G  GI G+KG+ GP G  G A        +     +D  KGE G PG +G+ G  G  G  G                          G +G     G+ G+ G  G PG+ G +G   +  T          G          G KG++GL G  G+QG  G+ GE+G  G  G  G  G+ G+   KG +G+ G  G++G + P  T G PG KGLPG+         G +GD+G +G DG     G  GE+G  G    PG+ G++G  G  G  G +G  G  G  G  G  G  G+KG+ GL+G              G++G  G  G+ G  G  G +GE+GIRG  G+   + P  +G+ GS G +GY G KG QG       RG TG   +       GL+G  G  G NG  G +GD G  G IG     ++GE G  G  G  G +G  G  GL GERG  G  G  G     G IG +G+KG+RG  G  G             KGD G +G +G RG   +N   G KGDKGD G  G +G  G V
Sbjct:  274 IKGEKGEPASSFPVKPTHT-VMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPG--STGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG----SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGP---------PGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFG---------------FKGEKGLSG-APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK--MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPG------------------------NPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPG-IDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG------------------------NDGPKGFAGVTGAPGKRGPAGIPGVSGAKG--DKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGL------------PGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPA-TVPDIRGDKGSQGERGYTGEKGEQG------ERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERG---LNGFEGQKGDKGDRGLQGPSGLPGLV 1410          

HSP 4 Score: 229.565 bits (584), Expect = 6.532e-60
Identity = 408/1166 (34.99%), Postives = 527/1166 (45.20%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG----TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--------EANKP-----KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSEC---VKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-----VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGR-------QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKG---------LPGI-----KGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNG------TIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGE------KGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHG 3712
            KG+ G PG  G  G+ G++GF G  G  G    +G  G PG  G  G+ G  G PG  G KGD G +G  G    +   G +GD G  G+ G  G +G +G  G +G+ G  G +G  G  G  GEKG  G+        E  KP      + E  KG+KG  G  G       + +                        +G  GIPG  G+ G  GEKGL G PG+ G  G  G DG PG  G   + GE G  G+ G KGD+G  G++ E+GE G        +C   +    AKG KG  G  G  G  G  G+PG  G TG  G  GP GP G E    + G  G  G  G  G  GN G+ G RGIPG  G  G  G+ G    G  G                 G++GEKG  G        G +G  G PGD    G+PGV G+ G  G+KG+         P G  G  G  G  G  G  G++G KG  G  G +G+ G  G    PG  G KG  G  G  G++G  G    + A    G  G  G  G  G RG  G  G+ GI G  G  G  G+ G +G  G  G++G  G  G PGL  + + +G +G  G  G +G+ GP+G  GW  +        A   +    GEKG  G+ G+ G  G NGEKG      + G  G+ GS+G  G  G  G  G  G  G     G  G+ G+ G+PG+ G  G+KGE G +G+ G              + G KG +G++G  G        +G KG +GERG  G+ G  G  G+ G  G  G +GD   +G+QGP   +   GIPG+KG          PG+     KG+ G  G NG  G   + GL+GERG PG  G+ G       IG  G +GE G  G+ G  G DG  G  GL G+      KG+ GLNG                EG  G++G  G +G  G  G  G +GD G  G +  G  G VG+PG +G+ G KG      +DGR G  G+   G KG+ G     G  G+ G  G NG  G  G  G  G IG QGE+G +G+ GL GE            TG +G+ G KGDRG+ GE+G       G IGQKG  G     +++   G
Sbjct:  498 KGDAGIPGYPGLKGSKGERGFKGNAGAPG-DSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGA------------------------EGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIK-GEPGFHGRDGAKGDKGSFGRSGEKGEPG--------SCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGP------------PGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVG-------PIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGL--AVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGF-----------TGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGD---RGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNG---------------FEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLN--GNDGPVGAPGERGFTGPKG------RDGRDGTPGLP--GQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGE------------TGNVGRPGPKGDRGEPGERG--YEGAIGLIGQKGEPGAPAPAALDYLTG 1555          

HSP 5 Score: 224.942 bits (572), Expect = 1.401e-58
Identity = 425/1235 (34.41%), Postives = 542/1235 (43.89%), Query Frame = 2
Query:  419 GFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGD------------EGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGT-----MGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN---VMGKEGPRGDPGDDSSEGVP---GVKGKRGFKGDKGEAATKCE--LDCPKGSIGERGDLGDKGTTGF---PGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGI---PGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST-GDKGNKGLKGNQGRQGFKGL--KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK------------GVQGDRGNNGTDGNCTSLGLMGE---------------------RGFPGTP-------GDNGTIGDRGRRGEMGDNGTIGNTGP---DGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVI--GERGI------NGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGP---------DGDNGTIGDEGDKGMNGTIGLEGEI------------GNNGTIGDQGEK---------GRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G PG  G NG DG  G  GY G    KG  G  G PG  G  GK G  GT G  G KG             EG +G  G    G +G  G+ GI G  G+ G+KGERG KG  G      +G  GT G+ G  G+KG  G+         G KG+ G+ G  G  C+                         G +G +G  G+PG  GK+G  G  G  G PG+RG  GI G  G PGEKG  GR    G  G  G+ G   L   ++    +GDKG                          G  G KG+ G PG+ G  G+ G KG  G  G+                         G+ G PG  G  G  G  G  I+GE G  GR+G KG+KG     G KGE G        M  +G +G+PG     G P   G  G+RG+ G KG    +    ++ P+G  G RG+ G++G  G    PGK+G +G  G NG  G +G+ G S +PG  G  G  G  G  G++G  G I    A+            G  G  GD+G+ G+PG+   PG  G+ G  G +G  G  G  G  G  G  G  G        GL G  G KGD+G  G  G KG+A                   G  G PGK G AG  G +G KG KG  G  G+ G  G  G  G  G  G +G     G+ G+ G DG PG KG++G  G +G  G+ G   EKG +G  G S   GD G  G  G  G +G  GL   G  G  G+ G  GR G+DG +G  G++G+ G +G+ G      ++G PG  G PG+             G  GDRG+ G  G     GL GE                     RG PG P       GD G+ G+RG  GE G+ G  G TGP    G  G RGL G  G +GLNG  G +G +G +G  G  GV   GE+G+      NG +G IGA G  G RG  G+      GE G VG PG  G  G KG +G+    G+ G  G   A GLKGD+GP         +G  G  GD+GD+G+ G  GL G +            GN+G +G  GE+         GR G  GLPG++G  G     G  G+ G+ G  G +G+ G  G+  +   +G+ G+KG RG  G        G KGD+G+ G  G  G  G +
Sbjct:  413 GAPGPQGLNGVDGLPGPQGYNG---QKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTP-----GQKGDMGIKGDVGGKCSSC---------------------RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGR---TGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAK------------------GVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAP------------------------GNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGAD------------GSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFA-------------------GVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA-----GEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLI 1536          

HSP 6 Score: 213.001 bits (541), Expect = 5.976e-55
Identity = 347/1027 (33.79%), Postives = 447/1027 (43.52%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE-------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDR--------------GLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDK---GFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGF---KGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGY------FGGKGVQGMPAKDGRRGNTGI 3352
            +KG++G+PG  G  G  G +G  G  G  G KG+ G  GE    G+ G  G  GTPG+ G  G  G  G +     G  G +G +G  G+ G +G KGE             +G KG  G  G+ G  G  G  GE+G  G + N  P+   G +G +G++G  GE                                 QG +G+PG  GK+G  G  G  G PG R              GL G++G+ G  G  G  G PG  G  G  GD+GD GL G +   G  G+KG    I         G  G  G +G  G  G  GS G  G+ G  GD G  G DGP G   V G                 G++G  GIPG  G  G +G  G      TG+ G  G +G  G     G+KG++G  G   G++G  G PG+  ++G PG+ G  G  GD  E   K E     G  G RGD G  GT G+PG+ G  G       L + G+ G   + G++GR G  G +G+ GEKGE G                          G++G  G PGIPG  G +G  G  GA G  G  GDRGDK   G SG PGL       GLQG+ G  G KG RG  G+ G           K ++ +    GEKG  G+ G+ GP G  G KG                                   G  G SG +G PG KGD G +GE G  G+     +        N   G  G  GL G +G  G     GL G  G IG  G+ G  G+ G+ G  G  G  G  G++G + P    G  G +GL G +G +GD+G+ G  G     GL+G++G  G PG NG  G  G  GE G  G  G    DG +GT GL G+KG+ G+   +   GP G  G  G  G  GE G  G +G IG +GE+G +G++G+ G +     PG KG+ G PG +GY       G KG  G PA       TGI
Sbjct:  652 LKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGE---KGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGN------------------------------QGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTG---------------APGKRGPAGIPGVSGAKGDKGATGL-----TGNDGPVGGRGPPGAPGLMGIKGDQGLAG-APGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGE----PGPSGLRGDTGPAGTPGWPGEKGLPG-------LAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWG------------------QPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKG------------------------------DRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQ---GFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGR---DGRDGTPGLPGQKGEPGM---LPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGI 1556          

HSP 7 Score: 192.971 bits (489), Expect = 9.102e-49
Identity = 106/275 (38.55%), Postives = 148/275 (53.82%), Query Frame = 2
Query: 4601 KGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINR-SEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLS--SLLPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            +G+ G+RG  G  GL     +G KG PG P         AA++  + IL  RH Q  T      C  G   + TGYS +   GN++    DLGSP SC+ +FS  PV+ C +   C++  RN +++WL+  + +P+  PV+  E++  ISRCVVC APANV A H Q T++   CP  W  LW GYS +MHT+   GG  Q   SPGSCLE  R  P IECN     CH +     +++  +     F +P  +T     E +  +SRC+VC+KN
Sbjct: 1521 RGEPGERGYEGAIGL-----IGQKGEPGAPAP-------AALDYLTGILITRHSQSET---VPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPMM-PVENIEIRQYISRCVVCEAPANVIAVHSQ-TIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTI-KAGERQSHVSRCQVCMKN 1777          

HSP 8 Score: 192.971 bits (489), Expect = 9.576e-49
Identity = 376/1178 (31.92%), Postives = 492/1178 (41.77%), Query Frame = 2
Query:  644 DNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--------EANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIP---------GDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNME----------------RGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXX----------------VKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSI-----------------------GERGDLGDKGTTGFPGKNGTKGAKGENGTLGIK-----GKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGA---------NGTNGVIGDRGDKGFSGEPGL---HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGL-------KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLM---------GERGFPGT--PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-------AIGLKGDSGPDGDNGT---------------------IGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G RG+ G  G  G KGE G  G EG  G  G KG  G  G++G KG+        +A  P +Q   G+ G  G++GKDG +  D                        G  G++G  G+PG  G  G  G KG +G P         G++G  G +G  GL G +G PG  GE+G+ G  G KG RG  G   E                +GE+G+  ++  +  T            G +G +G+ G  G +G  G  G  GD GL   DG  G + + GG G  G  GN G  G+ G+KG RG PG  G+ G  G+ G    G  G+ G+ G  G  G                        G +G  G V G  GP+G  G     G+PG  G  G  G KGE  T   L+ PKGSI                       G +G  GD G  G+PG  G+KG +G  G  G       G+ GT    G  G+KG  G  G  G+KG++G         +           R GP+GD+G  G+PGIPG DG  G  GE G          NG  G  G++G+ G +G PG         +  L   + +KGDKG  G  G KG               F    KG +G PG  G  G  G  GEKG+                            G    +G+ G +G DG PG+ G                  +        + + GDKG+ G  G +G  G   L       KG +GE GQ G  G  G DG+ G +G  G  G  G QGP       G+ G +GL G +G +G++G  G  GN    GL          G RG PG   PG  G  G  G +GE GD G  G  G  G +G+ G  G++GDAGL G              G  G++GE+G  G  G  G  G  G+ G  G++G    G KGE GSPGL G  G KG +G P  DG +G  G+T         G+ G SG  GD G                      +G +GD+G+ G  G +G  G  G  G+QG  G  G  GLPG+    G+KG  G +G  G +G  G  G  GEKG    +  G  G  G +G++G   I+   G  G+KG++G  GV G  G
Sbjct:   87 EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQD------------------------GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPT--------HTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGL---DGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGE--PGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNG-VDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGT-AGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSS---------CRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKG------------VQGF----KGAEGLPGIPGPKGEFGFKGEKGL---------------------------SGAPGNDGTPGRAGRDGYPGIPGQS---------------IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPP------GVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGV------------SGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRD--GAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPG 1138          

HSP 9 Score: 177.563 bits (449), Expect = 4.236e-44
Identity = 353/1012 (34.88%), Postives = 464/1012 (45.85%), Query Frame = 2
Query: 1586 KGEKGYYGNV----------MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEF----------------KDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDG--KPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNS-STGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKG------------------DRGDIGQKGIQGPSNPNATMGIPGSKG---LPGIKGVQGDRGNNGTDGN------------CTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVI-----------GERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFG---------GKGVQGMPAKDGRRGNTGITAI-GLKGDSGP---DGDNGTIGDEGDKGMNGTIGLEGEIGN-NGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGE------------------NGTIGERGSPGDRGLKGEMGEKGE 4279
            KGE+G+ GN            G  G  G PG     G PG  G++G  G KG+   KC   C     G +GD G  G  G PGK+G +G  GE G  G +G DG + +   PGEKG  G  G  G  GE G+    + +      G++G  G  G  G +G +G +G+PGIPG  G+ G  GE G +G  G  G  G  G  G PG+   S +   G  G  G KGDKG+ G SGEKG    C A  ++K                    +D + GE+G+ G  G  GP GP G +G +G  G  G  G +G  G  G  G+ G +G    NG  G  GE G  +PG  G  G+ G  G  G  G  G  G  G  G+    GD+G+ GL G  GR G  G KG+ G IG  G  G  G+ G +G +G                  ++GD G  G  GP       G PG +G   +PG+ G +GD+G  G  GN               +G+ G++G  G PG  G  G  G +G  G  G  G  G  G+   +G  GE G +GL G  G  G  G  G KG+ G+            G++G +G  G+ G  GE+G +G QG+ G   PGEKG VG+PG+ G  G           G  G P   G +G  G++ + GLKG++GP    G  G  G +G++G+ G  GL   + +  G  G QGE+G  G+ G  GERG  G  G+ G          KGDRG  G  G S    +   KGDIG +G  G  G  +I    G  G  G  G  G+ G  G +G+ G  G  G  G +G  G  G  G+ G  G  G  G PG+ G  G  GL GD G +G    R ++GF G +G  GD+G +G  G+    GL GQKG+ G P L  +               G  G +G  G++GT G+ G+ GE                  NG  GE G PG+RGL G  GE+GE
Sbjct:  513 KGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS-SC---RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC-ALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWG--QPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGA---------KGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGV-TIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLP---GLVGQKGDTGYPGLNGNDGPVGAPGE-----RGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGE 1499          

HSP 10 Score: 142.51 bits (358), Expect = 2.398e-33
Identity = 278/831 (33.45%), Postives = 351/831 (42.24%), Query Frame = 2
Query: 1598 GYYGNV---MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNK--GLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGP-----------------------------SNPNATMGIPGSKGLPGIKGVQGDRGNN-----------GTDGNCTSLGLMGERGFPGTPGDNGTIGDRG---------RRGEMGDNGTIGNTGPDGENGT------RGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGE---------------RGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDS------GPDGDNGTIGDEGDKGMNGTIGLE-------------GEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG----DSVNSTKGDIGQKGHRGNRGFKS--------INITHGDKGDKGDEGPSGVNGTTGYV 3772
            GY G V   + ++G RG PG     G  G+KG+ GF G +G +  K +    KG  G  G  GDKG  G PG +G  G  G  G  G  G  G + K G  G+ G  G  GL G  G  GY  +  +    GE  K+      G +G+ G +G  G+ G  G  G  GE G +G  G  G RG+ G  GE G      ++   G  GIKG+K      GE   +     T  V        + G+KG PG +G  G  GP G+ G+ G  G+ G  GG GD G+ G  G  G  G+    G  G +G  G PG KG+ G  G  G  G++G  G  G                  G  G QG  G  GL G +G  GQ G  G  G  GN G  G +G+ G  G+ GP                                    GIPG  GL G KG +G +GN            GT G   + G  G+ G PGTPG  G +G +G         R G  GD GT G  G  G++G       RG  GE+G  G+NG  G  G  G  G  G+ G  GE               +G  G  G  GA+G QG +G +G+ G   PG KGE G  G KG  G  G  G P + GR G  GI    +KG+       G  GD G+ G  G+KG  G+  L+             G+ G  G  G+ G  G RG TGL G  G  G  G+ G  G  G  G KG++G +G  G    D +    G  GQ G RG  G           +N   G+KGD+G  GP G  G  G V
Sbjct:   76 GYAGCVPKCIAEKGNRGLPG---PLGPTGLKGEMGFPGMEGPSGDKGQ----KGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMK--PGAPGIKGEK------GEPASSFPVKPTHTVMGPRG---DMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPG--IPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSV 886          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079001)

HSP 1 Score: 262.692 bits (670), Expect = 4.184e-70
Identity = 424/1181 (35.90%), Postives = 532/1181 (45.05%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE---PGTVGIDGKNGTHGTPGKIGDKGDEGDRG-PNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGS----IGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMF---------------GKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVM----GKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLK--GNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGI---------QGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP-------GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----------VNSTKGDIGQKGHRGNRGFKSINITHGD-KGDKGDEGPSGVNGTTG 3766
            KGE+G PG  G  G  G QG  G  G  G+ G  GCDG+   PG  G+ G  G  G  G++G KG++G+    NG ++ G +G+ G RG  G  G  G  GE+G +G  G  G  G +G  G  GEKG       KP       G  G+ G+ GE       +S+F                K    + G  G  G+ G+ G  G KG  G  GD GL G KG+ GLPG  G  GR G  G  G  G KGDRG  G N   G  G KG       T      G  G  G                 +G PG  G  G  GL GP G  G    KGG G+PG  GN+G  G +GEKG  G+ G KG                 G  G  G  I+G  G  G  G  G KG K  RG KG  G  G+      G  G  G PG     G PG  G++G  G KG+   KC   C     G +GD G  G  G PGK+G +G  GE G  G +G DG + +   PGEKG  G  G  G  GE G+    + +      G++G  G  G  G +G +G +G+PGIPG  G+ G  GE G +G  G  G  G  G  G PG+   S +   G  G  G KGDKG+ G SGEKG    C        +E K   KG KG PG+ G+ GP G +G  G +G+ G  G+ G +G  G  G +G  G +G+    G+VG  G  GK G++G  G                        N   G +G  G+   G  G  G  GL+GE+G+ G  G  G  G DG+ G  GDRGD G  G+         +G   P    G+ G  G+PGI GV   RG +G  G   S GL+   G PG  GD G  G+ G +G  G  G  G  GP G  G  G  G+KG  GL G  G  G  G  G  G+ G+ G++G+ G+ G+ G  G  G +G+QG  G   P        EKG+ G PG  G  G  G  G P   G +G  G+   G  G  G  GD G  G +G  G+NG    +GE G  G  G  GEKG  G  G+PG  G  G  G  G  G +G  G++GD+G+ G  G            +    G  G KG RG RG   +  T  D +GDKG +G  G  G  G
Sbjct:  133 KGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKP-------GAPGIKGEKGEP------ASSF--------------PVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQ---KGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS-SC---RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC------ALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPG-----------------------RNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGV---RGRDGAKGEPGSPGLV---GMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGE---KGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKG 1241          

HSP 2 Score: 249.595 bits (636), Expect = 3.780e-66
Identity = 421/1290 (32.64%), Postives = 552/1290 (42.79%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLK-----------------------------------------GDIGCDGEPGTV------------GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE----------------------------------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLE---GIPGDRGL--KGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG--VKGKRGF------KGDKGEAAT--------KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--------MGANGTNGVIGDRGDKGFSGE------------PGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGI--------KGVQGDRGNNGTDGNCTSLGLMGERGFPGT---PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIG-----LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXX---XXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G QGFPGE G  G  G  G  G RG  GLK                                         GD+G  GEPG V            G+DG+ G  G PG  GD+G +G+ GP G  S G +GD GE G+NG  G  G KGE                                         GP+G  G  G+ G +G  G+ G  GL G+  N+ P  ++G+KG  G++G  G      G   +           +      G +G +G+ GIPG  G  G+ GE+G +   G PGD  L   G  G  G PG+KG  GRPG  G++G +G KGD G    +   G +GDKGT+ +             G  G++G  GE G  G  G+ G+NG TG  G KG DG  G     G  G P        E  +G+KG+ G PGAKG+ G +G  G   I G  G                 G KGEKG  G   G +G  G  G D   G+PG  +KG+ GF      KGDKG             C LD  K  +  +G+ G+ G TG PG  G  G+ GE G  G+KG  G    PG +G +G  G  G  G +G +G                           + G+ G+ GIPG +GQ G  GE        MG  G NG+ G++GD+G +G             PG   +  + G+ G  GI G+KG+ GP G  G A        +     +D  KGE G PG +G+ G  G  G  G                          G +G     G+ G+ G  G PG+ G +G   +  T          G          G KG++GL G  G+QG  G+ GE+G  G  G  G  G+ G+   KG +G+ G  G++G + P  T G PG KGLPG+         G +GD+G +G DG     G  GE+G  G    PG+ G++G  G  G  G +G  G  G  G  G  G  G+KG+ GL+G              G++G  G  G+ G  G  G +GE+GIRG  G+   + P  +G+ GS G +GY G KG Q      G RG TG   +       GL+G  G  G NG  G +GD G  G IG     ++GE G  G  G  G +G  G  GL GERG  G  G     G  G IG +G+KG+RG  G  G             KGD G +G +G RG        GDKGD+G +GPSG+ G  G
Sbjct:  225 LAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPG--STGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG----SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIP---------GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEF---------------GFKGEKGLSG-APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK--MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPG------------------------NPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVA-GPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG------------------------NDGPKGFAGVTGAPGKRGPAGIPGVSGAKG--DKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGL------------PGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLP-ATVPDIRGDKGSQGERGYTGEKGEQ------GERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVG 1411          

HSP 3 Score: 246.514 bits (628), Expect = 3.638e-65
Identity = 415/1244 (33.36%), Postives = 546/1244 (43.89%), Query Frame = 2
Query:  404 IKGEQG-----FPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERG----------------------------------------PKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG---IPGDRGL--KGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG--VKGKRGF------KGDKGEAATK--------CELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--------MGANGTNGVIGDRGDKGFSGE------------PGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK--------GVQGDRGNNGTDGNCTSLGLMGERGFPGT---PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIG-----LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXX---XXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IKGE+G     FP +  H    G +G MG +G  GL G  G  G  G  G+DG+ G  G PG  GD+G +G+ GP G  S G +GD GE G+NG  G  G KGE G                                        P+G  G  G+ G +G  G+ G  GL G+  N+ P  ++G+KG  G++G  G      G   +           +      G +G +G+ GIPG  G  G+ GE+G +G    PGD  L   G  G  G PG+KG  GRPG  G++G +G KGD G    +   G +GDKGT+ +      D  +G           GE G  G  G+ G+NG TG  G KG DG  G     G  G P        E  +G+KG+ G PGAKG+ G +G  G   I G  G  G                KGEKG  G   G +G  G  G D   G+PG  +KG+ GF      KGDKG             C LD  K  +  +G+ G+ G TG PG  G  G+ GE G  G+KG  G    PG +G +G  G  G  G +G +G                           + G+ G+ GIPG +GQ G  GE        MG  G NG+ G++GD+G +G             PG   +  + G+ G  GI G+KG+ GP G  G A        +     +D  KGE G PG +G+ G  G  G  G                          G +G     G+ G+ G  G PG+ G +G   +  T          G          G KG++GL G  G+QG  G+ GE+G  G  G  G  G+ G+   KG +G+ G  G++G + P  T G PG KGLPG+         G +GD+G +G DG     G  GE+G  G    PG+ G++G  G  G  G +G  G  G  G  G  G  G+KG+ GL+G              G++G  G  G+ G  G  G +GE+GIRG  G+   + P  +G+ GS G +GY G KG QG       RG TG   +       GL+G  G  G NG  G +GD G  G IG     ++GE G  G  G  G +G  G  GL GERG  G  G  G     G IG +G+KG+RG  G  G             KGD G +G +G RG   +N   G KGDKGD G  G +G  G V
Sbjct:  274 IKGEKGEPASSFPVKPTHT-VMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPG--STGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG----SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGP---------PGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFG---------------FKGEKGLSG-APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK--MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPG------------------------NPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPG-IDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG------------------------NDGPKGFAGVTGAPGKRGPAGIPGVSGAKG--DKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGL------------PGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPA-TVPDIRGDKGSQGERGYTGEKGEQG------ERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERG---LNGFEGQKGDKGDRGLQGPSGLPGLV 1410          

HSP 4 Score: 229.565 bits (584), Expect = 6.532e-60
Identity = 408/1166 (34.99%), Postives = 527/1166 (45.20%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG----TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--------EANKP-----KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSEC---VKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-----VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGR-------QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKG---------LPGI-----KGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNG------TIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGE------KGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHG 3712
            KG+ G PG  G  G+ G++GF G  G  G    +G  G PG  G  G+ G  G PG  G KGD G +G  G    +   G +GD G  G+ G  G +G +G  G +G+ G  G +G  G  G  GEKG  G+        E  KP      + E  KG+KG  G  G       + +                        +G  GIPG  G+ G  GEKGL G PG+ G  G  G DG PG  G   + GE G  G+ G KGD+G  G++ E+GE G        +C   +    AKG KG  G  G  G  G  G+PG  G TG  G  GP GP G E    + G  G  G  G  G  GN G+ G RGIPG  G  G  G+ G    G  G                 G++GEKG  G        G +G  G PGD    G+PGV G+ G  G+KG+         P G  G  G  G  G  G  G++G KG  G  G +G+ G  G    PG  G KG  G  G  G++G  G    + A    G  G  G  G  G RG  G  G+ GI G  G  G  G+ G +G  G  G++G  G  G PGL  + + +G +G  G  G +G+ GP+G  GW  +        A   +    GEKG  G+ G+ G  G NGEKG      + G  G+ GS+G  G  G  G  G  G  G     G  G+ G+ G+PG+ G  G+KGE G +G+ G              + G KG +G++G  G        +G KG +GERG  G+ G  G  G+ G  G  G +GD   +G+QGP   +   GIPG+KG          PG+     KG+ G  G NG  G   + GL+GERG PG  G+ G       IG  G +GE G  G+ G  G DG  G  GL G+      KG+ GLNG                EG  G++G  G +G  G  G  G +GD G  G +  G  G VG+PG +G+ G KG      +DGR G  G+   G KG+ G     G  G+ G  G NG  G  G  G  G IG QGE+G +G+ GL GE            TG +G+ G KGDRG+ GE+G       G IGQKG  G     +++   G
Sbjct:  498 KGDAGIPGYPGLKGSKGERGFKGNAGAPG-DSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGA------------------------EGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIK-GEPGFHGRDGAKGDKGSFGRSGEKGEPG--------SCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGP------------PGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVG-------PIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGL--AVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGF-----------TGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGD---RGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNG---------------FEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLN--GNDGPVGAPGERGFTGPKG------RDGRDGTPGLP--GQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGE------------TGNVGRPGPKGDRGEPGERG--YEGAIGLIGQKGEPGAPAPAALDYLTG 1555          

HSP 5 Score: 224.942 bits (572), Expect = 1.401e-58
Identity = 425/1235 (34.41%), Postives = 542/1235 (43.89%), Query Frame = 2
Query:  419 GFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGD------------EGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGT-----MGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN---VMGKEGPRGDPGDDSSEGVP---GVKGKRGFKGDKGEAATKCE--LDCPKGSIGERGDLGDKGTTGF---PGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGI---PGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST-GDKGNKGLKGNQGRQGFKGL--KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK------------GVQGDRGNNGTDGNCTSLGLMGE---------------------RGFPGTP-------GDNGTIGDRGRRGEMGDNGTIGNTGP---DGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVI--GERGI------NGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGP---------DGDNGTIGDEGDKGMNGTIGLEGEI------------GNNGTIGDQGEK---------GRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G PG  G NG DG  G  GY G    KG  G  G PG  G  GK G  GT G  G KG             EG +G  G    G +G  G+ GI G  G+ G+KGERG KG  G      +G  GT G+ G  G+KG  G+         G KG+ G+ G  G  C+                         G +G +G  G+PG  GK+G  G  G  G PG+RG  GI G  G PGEKG  GR    G  G  G+ G   L   ++    +GDKG                          G  G KG+ G PG+ G  G+ G KG  G  G+                         G+ G PG  G  G  G  G  I+GE G  GR+G KG+KG     G KGE G        M  +G +G+PG     G P   G  G+RG+ G KG    +    ++ P+G  G RG+ G++G  G    PGK+G +G  G NG  G +G+ G S +PG  G  G  G  G  G++G  G I    A+            G  G  GD+G+ G+PG+   PG  G+ G  G +G  G  G  G  G  G  G  G        GL G  G KGD+G  G  G KG+A                   G  G PGK G AG  G +G KG KG  G  G+ G  G  G  G  G  G +G     G+ G+ G DG PG KG++G  G +G  G+ G   EKG +G  G S   GD G  G  G  G +G  GL   G  G  G+ G  GR G+DG +G  G++G+ G +G+ G      ++G PG  G PG+             G  GDRG+ G  G     GL GE                     RG PG P       GD G+ G+RG  GE G+ G  G TGP    G  G RGL G  G +GLNG  G +G +G +G  G  GV   GE+G+      NG +G IGA G  G RG  G+      GE G VG PG  G  G KG +G+    G+ G  G   A GLKGD+GP         +G  G  GD+GD+G+ G  GL G +            GN+G +G  GE+         GR G  GLPG++G  G     G  G+ G+ G  G +G+ G  G+  +   +G+ G+KG RG  G        G KGD+G+ G  G  G  G +
Sbjct:  413 GAPGPQGLNGVDGLPGPQGYNG---QKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTP-----GQKGDMGIKGDVGGKCSSC---------------------RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGR---TGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAK------------------GVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAP------------------------GNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGAD------------GSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFA-------------------GVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA-----GEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLI 1536          

HSP 6 Score: 213.001 bits (541), Expect = 5.976e-55
Identity = 347/1027 (33.79%), Postives = 447/1027 (43.52%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE-------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDR--------------GLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDK---GFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGF---KGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGY------FGGKGVQGMPAKDGRRGNTGI 3352
            +KG++G+PG  G  G  G +G  G  G  G KG+ G  GE    G+ G  G  GTPG+ G  G  G  G +     G  G +G +G  G+ G +G KGE             +G KG  G  G+ G  G  G  GE+G  G + N  P+   G +G +G++G  GE                                 QG +G+PG  GK+G  G  G  G PG R              GL G++G+ G  G  G  G PG  G  G  GD+GD GL G +   G  G+KG    I         G  G  G +G  G  G  GS G  G+ G  GD G  G DGP G   V G                 G++G  GIPG  G  G +G  G      TG+ G  G +G  G     G+KG++G  G   G++G  G PG+  ++G PG+ G  G  GD  E   K E     G  G RGD G  GT G+PG+ G  G       L + G+ G   + G++GR G  G +G+ GEKGE G                          G++G  G PGIPG  G +G  G  GA G  G  GDRGDK   G SG PGL       GLQG+ G  G KG RG  G+ G           K ++ +    GEKG  G+ G+ GP G  G KG                                   G  G SG +G PG KGD G +GE G  G+     +        N   G  G  GL G +G  G     GL G  G IG  G+ G  G+ G+ G  G  G  G  G++G + P    G  G +GL G +G +GD+G+ G  G     GL+G++G  G PG NG  G  G  GE G  G  G    DG +GT GL G+KG+ G+   +   GP G  G  G  G  GE G  G +G IG +GE+G +G++G+ G +     PG KG+ G PG +GY       G KG  G PA       TGI
Sbjct:  652 LKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGE---KGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGN------------------------------QGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTG---------------APGKRGPAGIPGVSGAKGDKGATGL-----TGNDGPVGGRGPPGAPGLMGIKGDQGLAG-APGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGE----PGPSGLRGDTGPAGTPGWPGEKGLPG-------LAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWG------------------QPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKG------------------------------DRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQ---GFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGR---DGRDGTPGLPGQKGEPGM---LPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGI 1556          

HSP 7 Score: 192.971 bits (489), Expect = 9.102e-49
Identity = 106/275 (38.55%), Postives = 148/275 (53.82%), Query Frame = 2
Query: 4601 KGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINR-SEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLS--SLLPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            +G+ G+RG  G  GL     +G KG PG P         AA++  + IL  RH Q  T      C  G   + TGYS +   GN++    DLGSP SC+ +FS  PV+ C +   C++  RN +++WL+  + +P+  PV+  E++  ISRCVVC APANV A H Q T++   CP  W  LW GYS +MHT+   GG  Q   SPGSCLE  R  P IECN     CH +     +++  +     F +P  +T     E +  +SRC+VC+KN
Sbjct: 1521 RGEPGERGYEGAIGL-----IGQKGEPGAPAP-------AALDYLTGILITRHSQSET---VPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPMM-PVENIEIRQYISRCVVCEAPANVIAVHSQ-TIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTI-KAGERQSHVSRCQVCMKN 1777          

HSP 8 Score: 192.971 bits (489), Expect = 9.576e-49
Identity = 376/1178 (31.92%), Postives = 492/1178 (41.77%), Query Frame = 2
Query:  644 DNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--------EANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIP---------GDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNME----------------RGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXX----------------VKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSI-----------------------GERGDLGDKGTTGFPGKNGTKGAKGENGTLGIK-----GKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGA---------NGTNGVIGDRGDKGFSGEPGL---HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGL-------KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLM---------GERGFPGT--PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-------AIGLKGDSGPDGDNGT---------------------IGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G RG+ G  G  G KGE G  G EG  G  G KG  G  G++G KG+        +A  P +Q   G+ G  G++GKDG +  D                        G  G++G  G+PG  G  G  G KG +G P         G++G  G +G  GL G +G PG  GE+G+ G  G KG RG  G   E                +GE+G+  ++  +  T            G +G +G+ G  G +G  G  G  GD GL   DG  G + + GG G  G  GN G  G+ G+KG RG PG  G+ G  G+ G    G  G+ G+ G  G  G                        G +G  G V G  GP+G  G     G+PG  G  G  G KGE  T   L+ PKGSI                       G +G  GD G  G+PG  G+KG +G  G  G       G+ GT    G  G+KG  G  G  G+KG++G         +           R GP+GD+G  G+PGIPG DG  G  GE G          NG  G  G++G+ G +G PG         +  L   + +KGDKG  G  G KG               F    KG +G PG  G  G  G  GEKG+                            G    +G+ G +G DG PG+ G                  +        + + GDKG+ G  G +G  G   L       KG +GE GQ G  G  G DG+ G +G  G  G  G QGP       G+ G +GL G +G +G++G  G  GN    GL          G RG PG   PG  G  G  G +GE GD G  G  G  G +G+ G  G++GDAGL G              G  G++GE+G  G  G  G  G  G+ G  G++G    G KGE GSPGL G  G KG +G P  DG +G  G+T         G+ G SG  GD G                      +G +GD+G+ G  G +G  G  G  G+QG  G  G  GLPG+    G+KG  G +G  G +G  G  G  GEKG    +  G  G  G +G++G   I+   G  G+KG++G  GV G  G
Sbjct:   87 EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQD------------------------GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPT--------HTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGL---DGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGE--PGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNG-VDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGT-AGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSS---------CRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKG------------VQGF----KGAEGLPGIPGPKGEFGFKGEKGL---------------------------SGAPGNDGTPGRAGRDGYPGIPGQS---------------IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPP------GVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGV------------SGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRD--GAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPG 1138          

HSP 9 Score: 177.563 bits (449), Expect = 4.236e-44
Identity = 353/1012 (34.88%), Postives = 464/1012 (45.85%), Query Frame = 2
Query: 1586 KGEKGYYGNV----------MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEF----------------KDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDG--KPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNS-STGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKG------------------DRGDIGQKGIQGPSNPNATMGIPGSKG---LPGIKGVQGDRGNNGTDGN------------CTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVI-----------GERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFG---------GKGVQGMPAKDGRRGNTGITAI-GLKGDSGP---DGDNGTIGDEGDKGMNGTIGLEGEIGN-NGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGE------------------NGTIGERGSPGDRGLKGEMGEKGE 4279
            KGE+G+ GN            G  G  G PG     G PG  G++G  G KG+   KC   C     G +GD G  G  G PGK+G +G  GE G  G +G DG + +   PGEKG  G  G  G  GE G+    + +      G++G  G  G  G +G +G +G+PGIPG  G+ G  GE G +G  G  G  G  G  G PG+   S +   G  G  G KGDKG+ G SGEKG    C A  ++K                    +D + GE+G+ G  G  GP GP G +G +G  G  G  G +G  G  G  G+ G +G    NG  G  GE G  +PG  G  G+ G  G  G  G  G  G  G  G+    GD+G+ GL G  GR G  G KG+ G IG  G  G  G+ G +G +G                  ++GD G  G  GP       G PG +G   +PG+ G +GD+G  G  GN               +G+ G++G  G PG  G  G  G +G  G  G  G  G  G+   +G  GE G +GL G  G  G  G  G KG+ G+            G++G +G  G+ G  GE+G +G QG+ G   PGEKG VG+PG+ G  G           G  G P   G +G  G++ + GLKG++GP    G  G  G +G++G+ G  GL   + +  G  G QGE+G  G+ G  GERG  G  G+ G          KGDRG  G  G S    +   KGDIG +G  G  G  +I    G  G  G  G  G+ G  G +G+ G  G  G  G +G  G  G  G+ G  G  G  G PG+ G  G  GL GD G +G    R ++GF G +G  GD+G +G  G+    GL GQKG+ G P L  +               G  G +G  G++GT G+ G+ GE                  NG  GE G PG+RGL G  GE+GE
Sbjct:  513 KGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS-SC---RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC-ALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWG--QPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGA---------KGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGV-TIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLP---GLVGQKGDTGYPGLNGNDGPVGAPGE-----RGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGE 1499          

HSP 10 Score: 142.51 bits (358), Expect = 2.398e-33
Identity = 278/831 (33.45%), Postives = 351/831 (42.24%), Query Frame = 2
Query: 1598 GYYGNV---MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNK--GLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGP-----------------------------SNPNATMGIPGSKGLPGIKGVQGDRGNN-----------GTDGNCTSLGLMGERGFPGTPGDNGTIGDRG---------RRGEMGDNGTIGNTGPDGENGT------RGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGE---------------RGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDS------GPDGDNGTIGDEGDKGMNGTIGLE-------------GEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG----DSVNSTKGDIGQKGHRGNRGFKS--------INITHGDKGDKGDEGPSGVNGTTGYV 3772
            GY G V   + ++G RG PG     G  G+KG+ GF G +G +  K +    KG  G  G  GDKG  G PG +G  G  G  G  G  G  G + K G  G+ G  G  GL G  G  GY  +  +    GE  K+      G +G+ G +G  G+ G  G  G  GE G +G  G  G RG+ G  GE G      ++   G  GIKG+K      GE   +     T  V        + G+KG PG +G  G  GP G+ G+ G  G+ G  GG GD G+ G  G  G  G+    G  G +G  G PG KG+ G  G  G  G++G  G  G                  G  G QG  G  GL G +G  GQ G  G  G  GN G  G +G+ G  G+ GP                                    GIPG  GL G KG +G +GN            GT G   + G  G+ G PGTPG  G +G +G         R G  GD GT G  G  G++G       RG  GE+G  G+NG  G  G  G  G  G+ G  GE               +G  G  G  GA+G QG +G +G+ G   PG KGE G  G KG  G  G  G P + GR G  GI    +KG+       G  GD G+ G  G+KG  G+  L+             G+ G  G  G+ G  G RG TGL G  G  G  G+ G  G  G  G KG++G +G  G    D +    G  GQ G RG  G           +N   G+KGD+G  GP G  G  G V
Sbjct:   76 GYAGCVPKCIAEKGNRGLPG---PLGPTGLKGEMGFPGMEGPSGDKGQ----KGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMK--PGAPGIKGEK------GEPASSFPVKPTHTVMGPRG---DMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPG--IPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSV 886          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333541)

HSP 1 Score: 226.483 bits (576), Expect = 5.646e-59
Identity = 416/1228 (33.88%), Postives = 542/1228 (44.14%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIG---------CDGEPGT---VGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGL---EGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSI------------------GNPGLNGTTGDIGLKGPDGPLG-SECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG---NVMGKEGP------RGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNE------------TIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGD--------------------------RGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP------GEKGEVGSPGLKGYFGGKGV------QGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKG------------RRGKTGLPGE----RXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVN 3754
            GE G  GE GH G  G +G MGY G +G  G+ G         CDG PG     G  G+NG  G PGK G +G  G+ G  G  S GT+G+ GE G  G  G  G  G+RG KG  G  G+ G KG  G  G KG  G  +  P    G  G KG  G           +   Y                     +G +G+ G  G  G  GE+G     G+PG RG  G  G+ G PG+ G PGR G++G +G  G  G  GL G   ERGE G  G   +          G      +K   G IGS+G I                  G  GL G +GD GL G  GP G SE  + G     + G  G  G +G  G  G+PG  G+ G+ G+N    +GE G  G+ G +G +GD+   G+ G+KG  G   N++G  G       RG PGDD   G+ G+ G++G +GD          DCP  + G RG  G +G TG+PG +G +GA G  G  G++G  G    PG  G KG  G  G+ GE G++G        I      +KGE G  G  G +G+ G  G  G DG +G+ GE G  G  G  GD G +G  GEPG    +             + G  GY GIKG++G+ G +G KG   + N   ++  N  +    GE G+ G  GV G  G  G  G++G IG  G  G         +             G+ G  G DG+PG+  D GI  +           +        +   G  G+ G  G  G  G  G KG +GE G +G  G+ G+ GN G +GD                          +G++G  G  G +    ++G  G +GL G  G+QG  G+ G  G    +G +GERG  G  G  G IG RG  GE G  G  G+ GPDG  G  GL G KG+ G  G  G  G  G     GI+G  GE G+ G    IG  G  G +G +G  G S P      G KGEVGSPG  G  G  G+      +G+P + GR G  G   +    G  G +G  G  G  G +G KG  G  G+ G  G NG IGDQG +G              G+ G+PG     R     +G TG+ G  G+ G +GD G IG  G      KG+ G  G+ G  GF       G +GD+G  GP G+ 
Sbjct:   81 GEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGY---------------------KGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGV---QGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAG-----DYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGD----------DCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGN---PGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAI-EVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPN-PGQIYDNTGE---PGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDY-GQQGAPGLPGRDGEPGL--DGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGP---IGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPP--GAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGIT 1253          

HSP 2 Score: 214.927 bits (546), Expect = 2.188e-55
Identity = 420/1197 (35.09%), Postives = 536/1197 (44.78%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEG---TMGVNGTKGSKGRI-GEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCT--DTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKN--GTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGR----------PGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGK------------NGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAAT--KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDR------------GDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA-------EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST----GDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIG--QKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGL---TGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGE----------RGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGD-----QGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
             KG  G  G+ G  G  G+QG +G  G  G +G+IG    PG  G  GK+   G PG+ GDKG +G   P  T + G  G  GERG +G  G+ G +G  GP G      T  + G  GS+G I                + G  G  G SG  G N +    GRS     G  G  G  G +G  GE G+ G  G+ G+ G+N  G  GE GL G PG  G +G +G+ GLPG+KG PG            G  G +G  GD G  GL G   E+G RGD     + N                 G  G  G +G  G PG +G  G IGL GP G  G +   G                    GH+G+PG  G+ G+ GK             G+L +GE G  G  G +G+ GD   +G  G  G  G   G+ G RGD GD   +G  G  G+ G  G  G  AT  K  L    G  G +G+ GD G TGF G  G           G  G+DG +   G KG KG+KG  G +G +GEIG        I     G  G KG PGP GD G+QG PG+PG DG+ G +G +G  G  GV G              G KGF G+ G      + G  G KG+KG++G  G  G+ G         +        K    ++  +   G  G+ G  G +G NG+ G KG IG  G  G  G+ G  G  G  G  G     G +GE GE G  G +GD G +G NG  G  G  G+ G +G  G +      G+ GN G  G  G +G     G +G+ G++G TG IG  G  G KG RG +G  Q  + G +     +G PG  GLPG  G++G RG+ G  G     G  G +G  G PG NG     G +G  G  G  G  GP GE+G  GL    G+ GD G  G IG +G  G +G +G  G+ G           RG  G +G  G RGEQG  G  G  G   + GE+G++G  G  G+ G +G++G     G RG  GIT    KGD G  G +G  G  G  G  G  G  GE G NG IG      QG  G +G  G PG                    G+ G  G IG KG+      GD+G++G RG  G+ +I    GD GD G +G  G +G  G
Sbjct:  254 YKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGG---PGERGKPGKD---GEPGRFGDKGMKG--APGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDD--CPVCNA----------------GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPG------------------RAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGE-RGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYT---GPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIP----GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGI---NGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPG------------------APGHNGRHGLIGPKGE-----LGDMGRQGERGESGY-AIVGRQGDIGDIGFQGEPGWDGAKG 1371          

HSP 3 Score: 206.838 bits (525), Expect = 6.260e-53
Identity = 428/1258 (34.02%), Postives = 545/1258 (43.32%), Query Frame = 2
Query:  467 FMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG------------TKGSKGRIGEKG-------LKGKEANKPKIQEGDKGEKGMSGKDGENCT--DTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKN--GTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGR----------PGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG------------TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAAT--KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDR------------GDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA-------EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST----GDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIG--QKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGN--------CTSLG----------LMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDG-----------------------EN-----------GTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGL------KGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGE--------------------------KGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
              GY+G VGL+GD G  G  G  G  G+NG  G  G+IG  G+ G  G +G     G +G  G  G  G  G++G+ GERG  GF G  GV G            TK   G IG +G                  + G  G  G SG  G N +    GRS     G  G  G  G +G  GE G+ G  G+ G+ G+N  G  GE GL G PG  G +G +G+ GLPG+KG PG            G  G +G  GD G  GL G   E+G RGD     + N                 G  G  G +G  G PG +G  G IGL GP G  G +   G                    GH+G+PG  G+ G+ GK G            +L +GE G  G  G +G+ GD   +G  G  G  G   G+ G RGD GD   +G  G  G+ G  G  G  AT  K  L    G  G +G+ GD G TGF G  G           G  G+DG +   G KG KG+KG  G +G +GEIG        I     G  G KG PGP GD G+QG PG+PG DG+ G +G +G  G  GV G              G KGF G+ G      + G  G KG+KG++G  G  G+ G         +        K    ++  +   G  G+ G  G +G NG+ G KG IG  G  G  G+ G  G  G  G  G     G +GE GE G  G +GD G +G NG  G  G  G+ G +G  G +      G+ GN G  G  G +G     G +G+ G++G TG IG  G  G KG RG +G  Q  + G +     +G PG  GLPG  G++G RG+ G  G            LG          L G  GFPG  G  G  G+ G  G  G NG IG+ GP G                       EN           G +GL GE+G+ G  G IG  GP G KG +G  G  G+ G +G++G  G +G+QG RG  GI   + P EKG+ G  GL       G+FG KG  G P ++G  G  G     ++G  GP GD G  G  G  G +G IG +GE+G+ G  G++GE                          KG +G  GLPG+ G +G  G  G TG  G  G  G  G +G KG    +    + + G RG  G        GD G  G  G  G  G  GY
Sbjct:  251 LKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDD--CPVCNA----------------GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPG------------------RAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGE-RGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYT---GPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIP----GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGI---TLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGY 1461          

HSP 4 Score: 189.504 bits (480), Expect = 1.106e-47
Identity = 381/1136 (33.54%), Postives = 495/1136 (43.57%), Query Frame = 2
Query:  428 GEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE----------------PGTVGIDGKNGTHGTPGKIGDKGDE------GDRGPNG----TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG------LEGIPGDRGLKGIKGDDGLPGEKGTPGRP---------GEQGEQGKIGDKGDRGLTGKNME---RGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGA---KGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL----------DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQG------------YKGIKGDKGNRGPSGEKGWAEDCNATSKVKA-----NEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSS--------TGDKGNKGLKGNQGRQG---FKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNP-----NATMGIPGSKGLPGI---KGVQGDRGNNGTDGNCTSLGLM--------GERGFPGTPGDNG---------TIGDRGRRGEMGDNGT--------IGNTGPDGENGTRGLTGEKGDAGL---NGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIG-----ARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGE 3457
            GE G NG  G +G+ G RG VGL GD G  GE                 G  G DG NG  G PG+ G +GD+      G RGP G    T   G+ G+ G  G+ G +G+ G +G  G  G +G  G  G  G  G++G  G  GK      +++G+ G+ G SG  G+   D  +  +   GS G  G+ G +G+ G+ G QG  G PG+ G++G  G         L G PG  G+KG +GDDG  G KG  G P         GE GE G  G KG +G  G+      RGE GD+G A  +                     G +G+KG  G  G  G  G  GL G DG  G   + GG+G  G                RG+PG    +G  G  G++G  I+G  G +                  G  G YG + G+ GP+G  G+   +G  G  G  G KG +G+                   P G+ G++G++G  G  G   +NG KG+ G +G  G+ G  G    PG  G  G  G  G +GE+GEIGY  R                      G +G  G  G  G  G +G +G  GANG  G  G+ G+ GF G PG        G++G            Y G  G KG RGP G+   A D  A  K +      N    R+ G KG  G  G+ G  G  GE G KG  G  G  G  G  G  G  G QG +G    +G VG  G +G+ G +G  G+ GE G  G  G +GE G  G   N          TGD+G +G +G QG  G   F G  G +GE G  G  G++G DG  G KG +GD G +G  G + P         G+ G  G PG    KG  G  G NG +G     G          G+ GFPG PG NG          +GD GR+GE G++G         IG+ G  GE G  G  GE+G  GL   NG +G  GP G  G  G  G+ G  G+ G KG+ G     +    G RG+ G+ G    GE+G+ G+PGL G+ G +G  G     G  G TG       G  G  GD G +G  G  G+ G  G +GE
Sbjct:  455 GEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEV-------------------IPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPG---LDGGIGYKG---------------QRGVPGQEVIQGEIGPPGRSG--IKGFPGDV------------------GAPGQYG-LAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNG---QNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQG------------------DIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRH-GLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQ--GEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGA-----DGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 5 Score: 180.644 bits (457), Expect = 4.948e-45
Identity = 333/1028 (32.39%), Postives = 432/1028 (42.02%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGD--------------KGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-------------QEGDKGEKGMSGKDGEN-----CTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIG--------IPGKLGKNGT------------------DGEKGLE---------------------GIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGD-----------KGTTGFPGKNGT---KGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGI---------------PGIPGT----------------DGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCN-ATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNP--------NATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGD 3076
            +G +G  G+ G+ G+ G +G +G  GP G++G  G  G  G  G+ G  G  G PGK+G               KG+ GD G +G    G  GD+GE+G +G+ G  G +GE G +G  G  G  G  G  GR G  G  G+ A  PK+             + GD G+ G  G  GE        +TG       G  G  G +G+KGE+G  G++GEIG        IPG +G  G                   DGE GL+                     G PG  G+KG  GD G PG+ G  GRPG +G +G+ G  G  G TG    +G+RGD     ++         G  G +   G  G+ G  GS+G  G NG  G IG  G  G LG+  ++G                    G  GIPG  GM G+ G+ G +   G  G IG  G  GE G K   G  G  GY G   + G++G  G+PG     G  GV    G KGD GE+     +  P   G+ G+RG +GD           KG  G PG NG     G KG+ G  G+ G+ G   +PG KG  G  G NG+ G KG  G+          GE G  G  GR G  GDQG +G+                GIPG                  G  G  GE G  G  G IG  G KG  G+ G        G +G KG +GD+G RGP G    AE  +   + +     +  + G+KG PG  G  GP G  G +G                                   G  G  G+ G PG  G  G  G  G  G +G  G +G+ G  G +  G +G+ G  G QG  G+ G KGE+G  G  G  GR+G  G  G  GD G  G  G+ G   P        + +M  PG +G PG+ G QG+ G+ G  G    +G  G+RG  G  GD G +G  G  G  G  G  G  G  G  G RGL G +G+
Sbjct:  536 RGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSG--HRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGE--DGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGD----FLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQG------------------LPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRG-------------------------------PQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPG---LIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 6 Score: 169.088 bits (427), Expect = 1.809e-41
Identity = 98/279 (35.13%), Postives = 137/279 (49.10%), Query Frame = 2
Query: 4601 KGKQGDRGGSGPTGLR-IKGKMGIKGTPGIPGDTGIKGERAAINRSE----ILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI---QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHT-XXXXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVK 5410
            +G+ G  G  GP G R  KG MG+ G PG+ G  G +GE A    +      +FARH Q +      +CP  TNL+  GYS   +         DLG   SC+ +F+  P + CD    CHF   N  S WLS+  P+     P++  ++   ISRCVVC     + A H QS +    CP  W E+W GYS  M T     G  Q L SPGSCLE  R  P+IEC+    +C+ +     ++L  + + + F +P  +T   + +    ISRC VC +
Sbjct: 1465 QGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFIFARHSQSV---HVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQS-MSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHG-HGRCNYYDALASFWLTVIEEQDQFVQPRQQTL--KADFTSKISRCTVCRR 1736          

HSP 7 Score: 157.918 bits (398), Expect = 4.776e-38
Identity = 356/1188 (29.97%), Postives = 467/1188 (39.31%), Query Frame = 2
Query:  632 GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGE--------------KGTPGRPGE------------QGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPG------------LNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGE------------------RGDLGDKGTTGFPGKNGTKGA-----KGENGTL---------------GIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI-NRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTN---------GVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRI------GMDGNNGTKGDRGDIGQKGIQGPSNPNATM---GIPGSKGLPGIKGVQGDRGNNGTDGNCTSL-----------GLMGERGFPGTPGD---NGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG---------------------GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPS--GVNGTTGYV 3772
            G +G  G  G  G  G+ G  G+ GP G  G +G  G  G  G  GEKG +G          G KGE G  G  G++                                 GE G PG  G +G DG  G++G  G  G  G++G  G PG+              KGT G  GE             G++G  GD G  GLTG+  + G  G KG    ++                +     IG  G+ G PG            L G  G +GL+G +GP G    +G V                  G  G+PGA+G  G  G+ G    +GE G                +G+KG  G+ G   G +G  G+ G+D   G+PGV+G  G  G    + TK  L  P GS G+                  RG +G  G +G PG NG++G      +GE G                 G+ G+ G   +PG+    G KG  GL G+ G  GY  +R    +   +          GP G QG  G  G+PG DG NG  G  G  G           G  G RG +G +G PG H N    GL G +G++G +GN G +G KG                     G  G PGK+G AGP G   E G                               +   G +G++G+ G  G  GD+G               +  D        TG +G+ G  G QGR G  G  G  G  G+N TT ++      G DG  G +GD GD G KG++G  NP       G PG  G  G KGV+G +G  G  G    +           G +G +G+PG  GD    G  G  GR GE G +G IG  G  G  G   + GE G  G +G  G  G +G  G  G+ G  G +G+ G +G  GA G+ G+ G++G +G                       + G+KGEVGS G  G  G KG  G   + G  GN G+  +       GL G  G  G+ G IG  G +G  G  G  GE G  G  GD G  G  G  GLPG +               G++GN G  G+ G KG +  S  KGD G+ G  G  G+       G +G  GD  P+  GV G  G V
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRG--------DIGPKGEMGYPGIMGKS---------------------------------GEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVS----------------ELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAV------------------GRNGLPGARGEIGGPGERGKPGKDGEPGRF------------GDKGMKGAPGWTG-ADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKS-LPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN-VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPA----------------GIPGEPGKVGAAGPDGKAIEVG-------------------------------SLRKGEIGDTGDSGHRGDTGDDG-----------EKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRK---------------GETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEV 1066          

HSP 8 Score: 155.221 bits (391), Expect = 2.958e-37
Identity = 272/869 (31.30%), Postives = 351/869 (40.39%), Query Frame = 2
Query:  404 IKGEQGFPGE---MGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGD---DGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXV--GEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRG---------DPGDDSSEGVPG-------VKGKRGFKGDKGEAATKCE--------LDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA----EDCNATSKVKANEFKDRNKGEKGFP------GKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQ------GFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKG 2866
             KG++G PG+    G  G  G+ G  G+ G VG  G  G  G PG  G+ G+ G  G  G+ G  G++G RG    F +G  G  G+ G NG Q  +G KG++G  G  G  G NG KGS G  G +GL G         +G  G  G+ G  G                                 + GEIG  G++G NG  G+ G  G  G+ G KG+ GD   DG PG  G PGR GE G  G  G  G +G+   +  +G+ G+ G    I    A   KG +G  G       G  G KG +G+PG NG  G  GLKG  G  G    +G                       G PGAKG+ G  G+NG  I G  G+ G  G +G KG +   GV G  G  G + G +GPRG         + GD+   G+PG           RGF GD+G    + E           P G+ GERGD+G  G  GF G  G KG +G+ G  G  G       P EKG +G  G +G  G  G                                G++G PG PG +G NG  G  G     G  G +GD GF G PG +      GL G KG  GD G +G  GE G+A    +        +     D  KGE+G+P      G++G  GP GP G+ G                                      G  G DG  G KG  G+                        +  GD+G  GL G QG +      G  G +G+RG +G  G  G +G  G +G +G RGD G  G+          G PG +GLPG +G
Sbjct:  800 YKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG---DFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAG-----LQGLPGSPGIPGLPG---------------------------------MIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQG---------------------RPGEPGAKGLGGYPGRNG--INGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQI-GDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPG----ITLPAEKGDEGVAGLDGRAGRPGHF------------------------------GQKGAPGPPGENGPNGAIGHRGPQ-IQGPPGPQGDVGFPGAPGHNGR---HGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWG------------------------------------GIDGMDGLVGPKGQPGVTYSYSM------------------ARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGL---------TGAPGLRGLPGPQG 1502          

HSP 9 Score: 144.436 bits (363), Expect = 5.687e-34
Identity = 230/673 (34.18%), Postives = 304/673 (45.17%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGD------KGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPKGFEG---TMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGK--DGENCTD--TGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQG------EQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXV-------GEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGD--------LGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNK 2317
            KG++G  G +G NG +G +G +G+ G  GL G+ G  G PG+ GI G  G  G  G+ G+      +GD G RGPNG F   G  GD+G  G  G  G+ G KGE G  GF G     GV    G KG  GE GL G     P    G  G KG  G   D +   D   GR         G  G  G  G  G +G +G+ G+PG+ G+ G  G KGL G PG  G+ G+KG  G PG +G  G  GE G        G+IGD+G RGL G+  E+GE+GD+G   I    +   D+           +       G++G  G IG PG  G  GDIG  G  G  G+E +KG                +G++G RG PG   +  ++G  G   ++G  G  G  G+KG  G     G  G  G+ G  +  +GP G  GD    G PG  G+ G  G KGE           G  GERG+         GD G  GF G+ G  GAKGE G  G+ GK+G    PG +G  G  G  G+ G  G +G   +     ++                D+GE G+ G  G +G  G  G +G  G  G +G RGD+G  G  G    +  +G +GY G+ G  G RG  G +G         K +   F   ++
Sbjct:  896 KGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTG-----PIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEV-----GSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKG---------------FQGDQGPRGPPGIT-LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQI--QGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDM-------GRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPG----------DRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFIFARHSQ 1523          

HSP 10 Score: 144.436 bits (363), Expect = 6.619e-34
Identity = 322/1077 (29.90%), Postives = 429/1077 (39.83%), Query Frame = 2
Query:  692 KGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQE-GDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLG--SECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSS---EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTD--------------------------GQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA-EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGN-----NGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDG------------RRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            KG +G  G  G +GV G +G  G IG  G  G    K  + E G++GEKG  G  G                                  +GE+G PG +GK+G  G  G  GI G  G  G++G  G PG+ G  G PG+ G+QG  G+ G+ G+  K   +G RG+ G    +     D                + GSKG  G  GL G  GD GL GP G  G  SE     +                     G PGAKG  G +  +G L   +T                   +KG KGY G + G EGP+G  G+  +    G+PG +G+ G  G++G+     E     G  G++G  G  G TG  G +G+ G +GE+G  G+ G  G +  PG      +K   G +G +G+IG           G+ G++G  G  G  GD G  G  G PG                            G+ G +GE G N    V+G +G+ G +G+PGL            +G +GD+G  G  G+KG   E  N    +          G +G PG  G  G  G  GEKG++G      +                         G  G+ G+ G PG  G+ G  G                        TG +G +GL+GN GR G KGL G  G  G+ G  G  G DG      +  KG+ GD G  G +G        G  G KG  G  G +G+RG  G  G+    G  G  G    PG +G  G  GR         IG  G DG  G RG  G+ G  G+ G           G  G +G  G +G+ G+KG+ GA G +G  GD+G  G   PG  G  G PG  G +G +G  G+P +DG            +RG  G   I  +G+ GP G +G  G  GD G  G  GL G  G  G  G+QG  G  G+TGLPG                     NKG RG             G  G++   G +G          KG+ G  G +G NG  G +
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGP---------------------------------KGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGT-KGNRGETGQPGGVGPPGFDG---------------DRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLI---------------------GPPGAKGEPG-DSLSGVLKPDDT-------------------LKGYKGYVG-LQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGE----PGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN----VVGPKGEPGLNGQPGL------------EGYRGDRGEVGLPGDKGLPGEGYN----IVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNA---------------------GPRGPRGQEGDTGYPGSHGNRGAIGL-----------------------TGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRG------DTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDG---EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVI--QGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPG---------------------NKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKG---------QKGEVGSLGQNGQNGAKGSI 917          

HSP 11 Score: 115.546 bits (288), Expect = 4.005e-25
Identity = 245/811 (30.21%), Postives = 297/811 (36.62%), Query Frame = 2
Query: 1721 TKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLH-----------------------------------SNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEF-------------------KDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIG---------------MDGNNGTKGD------------------RGDIGQKGIQGPSNPNATMGIPG-----------------------SKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGN-------------------TGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            T C  DC KG  G  G  G  G  G  G  G  G  G  G LG KG  G      E G +G KG  G +G KGE+GY                            G+ G PG PG  G +G +G  G  G +G  G  G +G  G+PG                                      +   +G  GY G+ G+KG+ G  G KG   D  A S++  +                      D  KG KG+ G  G  GP GP GE+G                          G  G     G +G  GE GKPG  G+ G                            GDKG KG  G  G  G  G  GERGE G  G  G  G               + G  G++GD                  RG IG  G  G    N + G PG                         GLPG  G+ G+ G N        +G  GE G  G PG  G  GDRG  G  GD G  G                     G DG NG RGL GEK   GL G        G +G +G EG  G  G +G++G IG  G +G++G QG     +PG  G  G PG  G  G  G  G    DG+    G    G  GD+G  G  G  GD+G+KG +G+ G +GE G  G  GD G+ G +G+ G PG  G  G  G    T K+   G  G  G  GE+GD      GD G KG +G      I    G+ G+ G  GP GV G  G
Sbjct:   36 TLC--DC-KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVG------EYGEQGEKGHRGDIGPKGEMGYPGIM------------------------GKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKG---DTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGA------------------------VGRNGLPGARGEIGGPGERGKPGKDGEPG--------------------------RFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN-------VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEK---GLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQG-----NPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDD-----GDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKG 740          

HSP 12 Score: 57.7658 bits (138), Expect = 1.211e-7
Identity = 108/341 (31.67%), Postives = 145/341 (42.52%), Query Frame = 2
Query: 2894 TDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXX---XXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEV--------------------------------------GSPGLKGYFGGKGVQGMPAKDGRRGNTGITA------IGLKGDSGPDGD--NGTI-GDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
             DG   +  L   +G  G  G  G IG  G  G  GD G  G  GP GE G  G  GE+G+ G  G IG +G +G     G  G  G  G RGI+G  G+ G +G  G  G  G++G   PG+ G+                                       GS G  GY G  G +G P   G +G+TG  +      IG  G  G  GD  +G +  D+  KG  G +GL+G+ G  G  G+QG  GR    GLPG R               G+ G  G+RGK G+ G+      G  G KG +G  G+   +   G  G++G++G +G+ G  G
Sbjct:   28 ADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRG--PPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGR---NGLPGAR---------------GEIGGPGERGKPGKDGEP-----GRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQG 343          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0079036)

HSP 1 Score: 226.483 bits (576), Expect = 5.646e-59
Identity = 416/1228 (33.88%), Postives = 542/1228 (44.14%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIG---------CDGEPGT---VGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGL---EGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSI------------------GNPGLNGTTGDIGLKGPDGPLG-SECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG---NVMGKEGP------RGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNE------------TIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGD--------------------------RGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP------GEKGEVGSPGLKGYFGGKGV------QGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKG------------RRGKTGLPGE----RXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVN 3754
            GE G  GE GH G  G +G MGY G +G  G+ G         CDG PG     G  G+NG  G PGK G +G  G+ G  G  S GT+G+ GE G  G  G  G  G+RG KG  G  G+ G KG  G  G KG  G  +  P    G  G KG  G           +   Y                     +G +G+ G  G  G  GE+G     G+PG RG  G  G+ G PG+ G PGR G++G +G  G  G  GL G   ERGE G  G   +          G      +K   G IGS+G I                  G  GL G +GD GL G  GP G SE  + G     + G  G  G +G  G  G+PG  G+ G+ G+N    +GE G  G+ G +G +GD+   G+ G+KG  G   N++G  G       RG PGDD   G+ G+ G++G +GD          DCP  + G RG  G +G TG+PG +G +GA G  G  G++G  G    PG  G KG  G  G+ GE G++G        I      +KGE G  G  G +G+ G  G  G DG +G+ GE G  G  G  GD G +G  GEPG    +             + G  GY GIKG++G+ G +G KG   + N   ++  N  +    GE G+ G  GV G  G  G  G++G IG  G  G         +             G+ G  G DG+PG+  D GI  +           +        +   G  G+ G  G  G  G  G KG +GE G +G  G+ G+ GN G +GD                          +G++G  G  G +    ++G  G +GL G  G+QG  G+ G  G    +G +GERG  G  G  G IG RG  GE G  G  G+ GPDG  G  GL G KG+ G  G  G  G  G     GI+G  GE G+ G    IG  G  G +G +G  G S P      G KGEVGSPG  G  G  G+      +G+P + GR G  G   +    G  G +G  G  G  G +G KG  G  G+ G  G NG IGDQG +G              G+ G+PG     R     +G TG+ G  G+ G +GD G IG  G      KG+ G  G+ G  GF       G +GD+G  GP G+ 
Sbjct:   81 GEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGY---------------------KGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGV---QGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAG-----DYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGD----------DCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGN---PGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAI-EVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPN-PGQIYDNTGE---PGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDY-GQQGAPGLPGRDGEPGL--DGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGP---IGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPP--GAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGIT 1253          

HSP 2 Score: 214.927 bits (546), Expect = 2.188e-55
Identity = 420/1197 (35.09%), Postives = 536/1197 (44.78%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEG---TMGVNGTKGSKGRI-GEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCT--DTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKN--GTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGR----------PGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGK------------NGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAAT--KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDR------------GDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA-------EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST----GDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIG--QKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGL---TGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGE----------RGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGD-----QGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
             KG  G  G+ G  G  G+QG +G  G  G +G+IG    PG  G  GK+   G PG+ GDKG +G   P  T + G  G  GERG +G  G+ G +G  GP G      T  + G  GS+G I                + G  G  G SG  G N +    GRS     G  G  G  G +G  GE G+ G  G+ G+ G+N  G  GE GL G PG  G +G +G+ GLPG+KG PG            G  G +G  GD G  GL G   E+G RGD     + N                 G  G  G +G  G PG +G  G IGL GP G  G +   G                    GH+G+PG  G+ G+ GK             G+L +GE G  G  G +G+ GD   +G  G  G  G   G+ G RGD GD   +G  G  G+ G  G  G  AT  K  L    G  G +G+ GD G TGF G  G           G  G+DG +   G KG KG+KG  G +G +GEIG        I     G  G KG PGP GD G+QG PG+PG DG+ G +G +G  G  GV G              G KGF G+ G      + G  G KG+KG++G  G  G+ G         +        K    ++  +   G  G+ G  G +G NG+ G KG IG  G  G  G+ G  G  G  G  G     G +GE GE G  G +GD G +G NG  G  G  G+ G +G  G +      G+ GN G  G  G +G     G +G+ G++G TG IG  G  G KG RG +G  Q  + G +     +G PG  GLPG  G++G RG+ G  G     G  G +G  G PG NG     G +G  G  G  G  GP GE+G  GL    G+ GD G  G IG +G  G +G +G  G+ G           RG  G +G  G RGEQG  G  G  G   + GE+G++G  G  G+ G +G++G     G RG  GIT    KGD G  G +G  G  G  G  G  G  GE G NG IG      QG  G +G  G PG                    G+ G  G IG KG+      GD+G++G RG  G+ +I    GD GD G +G  G +G  G
Sbjct:  254 YKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGG---PGERGKPGKD---GEPGRFGDKGMKG--APGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDD--CPVCNA----------------GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPG------------------RAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGE-RGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYT---GPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIP----GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGI---NGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPG------------------APGHNGRHGLIGPKGE-----LGDMGRQGERGESGY-AIVGRQGDIGDIGFQGEPGWDGAKG 1371          

HSP 3 Score: 206.838 bits (525), Expect = 6.260e-53
Identity = 428/1258 (34.02%), Postives = 545/1258 (43.32%), Query Frame = 2
Query:  467 FMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG------------TKGSKGRIGEKG-------LKGKEANKPKIQEGDKGEKGMSGKDGENCT--DTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKN--GTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGR----------PGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG------------TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAAT--KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDR------------GDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA-------EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST----GDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIG--QKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGN--------CTSLG----------LMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDG-----------------------EN-----------GTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGL------KGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGE--------------------------KGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
              GY+G VGL+GD G  G  G  G  G+NG  G  G+IG  G+ G  G +G     G +G  G  G  G  G++G+ GERG  GF G  GV G            TK   G IG +G                  + G  G  G SG  G N +    GRS     G  G  G  G +G  GE G+ G  G+ G+ G+N  G  GE GL G PG  G +G +G+ GLPG+KG PG            G  G +G  GD G  GL G   E+G RGD     + N                 G  G  G +G  G PG +G  G IGL GP G  G +   G                    GH+G+PG  G+ G+ GK G            +L +GE G  G  G +G+ GD   +G  G  G  G   G+ G RGD GD   +G  G  G+ G  G  G  AT  K  L    G  G +G+ GD G TGF G  G           G  G+DG +   G KG KG+KG  G +G +GEIG        I     G  G KG PGP GD G+QG PG+PG DG+ G +G +G  G  GV G              G KGF G+ G      + G  G KG+KG++G  G  G+ G         +        K    ++  +   G  G+ G  G +G NG+ G KG IG  G  G  G+ G  G  G  G  G     G +GE GE G  G +GD G +G NG  G  G  G+ G +G  G +      G+ GN G  G  G +G     G +G+ G++G TG IG  G  G KG RG +G  Q  + G +     +G PG  GLPG  G++G RG+ G  G            LG          L G  GFPG  G  G  G+ G  G  G NG IG+ GP G                       EN           G +GL GE+G+ G  G IG  GP G KG +G  G  G+ G +G++G  G +G+QG RG  GI   + P EKG+ G  GL       G+FG KG  G P ++G  G  G     ++G  GP GD G  G  G  G +G IG +GE+G+ G  G++GE                          KG +G  GLPG+ G +G  G  G TG  G  G  G  G +G KG    +    + + G RG  G        GD G  G  G  G  G  GY
Sbjct:  251 LKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDD--CPVCNA----------------GPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPG------------------RAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGE-RGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYT---GPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIP----GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGI---TLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGY 1461          

HSP 4 Score: 189.504 bits (480), Expect = 1.106e-47
Identity = 381/1136 (33.54%), Postives = 495/1136 (43.57%), Query Frame = 2
Query:  428 GEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE----------------PGTVGIDGKNGTHGTPGKIGDKGDE------GDRGPNG----TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG------LEGIPGDRGLKGIKGDDGLPGEKGTPGRP---------GEQGEQGKIGDKGDRGLTGKNME---RGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGA---KGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL----------DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQG------------YKGIKGDKGNRGPSGEKGWAEDCNATSKVKA-----NEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSS--------TGDKGNKGLKGNQGRQG---FKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNP-----NATMGIPGSKGLPGI---KGVQGDRGNNGTDGNCTSLGLM--------GERGFPGTPGDNG---------TIGDRGRRGEMGDNGT--------IGNTGPDGENGTRGLTGEKGDAGL---NGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIG-----ARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGE 3457
            GE G NG  G +G+ G RG VGL GD G  GE                 G  G DG NG  G PG+ G +GD+      G RGP G    T   G+ G+ G  G+ G +G+ G +G  G  G +G  G  G  G  G++G  G  GK      +++G+ G+ G SG  G+   D  +  +   GS G  G+ G +G+ G+ G QG  G PG+ G++G  G         L G PG  G+KG +GDDG  G KG  G P         GE GE G  G KG +G  G+      RGE GD+G A  +                     G +G+KG  G  G  G  G  GL G DG  G   + GG+G  G                RG+PG    +G  G  G++G  I+G  G +                  G  G YG + G+ GP+G  G+   +G  G  G  G KG +G+                   P G+ G++G++G  G  G   +NG KG+ G +G  G+ G  G    PG  G  G  G  G +GE+GEIGY  R                      G +G  G  G  G  G +G +G  GANG  G  G+ G+ GF G PG        G++G            Y G  G KG RGP G+   A D  A  K +      N    R+ G KG  G  G+ G  G  GE G KG  G  G  G  G  G  G  G QG +G    +G VG  G +G+ G +G  G+ GE G  G  G +GE G  G   N          TGD+G +G +G QG  G   F G  G +GE G  G  G++G DG  G KG +GD G +G  G + P         G+ G  G PG    KG  G  G NG +G     G          G+ GFPG PG NG          +GD GR+GE G++G         IG+ G  GE G  G  GE+G  GL   NG +G  GP G  G  G  G+ G  G+ G KG+ G     +    G RG+ G+ G    GE+G+ G+PGL G+ G +G  G     G  G TG       G  G  GD G +G  G  G+ G  G +GE
Sbjct:  455 GEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEV-------------------IPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPG---LDGGIGYKG---------------QRGVPGQEVIQGEIGPPGRSG--IKGFPGDV------------------GAPGQYG-LAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNG---QNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQG------------------DIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRH-GLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQ--GEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGA-----DGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 5 Score: 180.644 bits (457), Expect = 4.948e-45
Identity = 333/1028 (32.39%), Postives = 432/1028 (42.02%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGD--------------KGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-------------QEGDKGEKGMSGKDGEN-----CTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIG--------IPGKLGKNGT------------------DGEKGLE---------------------GIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGD-----------KGTTGFPGKNGT---KGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGI---------------PGIPGT----------------DGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCN-ATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNP--------NATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGD 3076
            +G +G  G+ G+ G+ G +G +G  GP G++G  G  G  G  G+ G  G  G PGK+G               KG+ GD G +G    G  GD+GE+G +G+ G  G +GE G +G  G  G  G  G  GR G  G  G+ A  PK+             + GD G+ G  G  GE        +TG       G  G  G +G+KGE+G  G++GEIG        IPG +G  G                   DGE GL+                     G PG  G+KG  GD G PG+ G  GRPG +G +G+ G  G  G TG    +G+RGD     ++         G  G +   G  G+ G  GS+G  G NG  G IG  G  G LG+  ++G                    G  GIPG  GM G+ G+ G +   G  G IG  G  GE G K   G  G  GY G   + G++G  G+PG     G  GV    G KGD GE+     +  P   G+ G+RG +GD           KG  G PG NG     G KG+ G  G+ G+ G   +PG KG  G  G NG+ G KG  G+          GE G  G  GR G  GDQG +G+                GIPG                  G  G  GE G  G  G IG  G KG  G+ G        G +G KG +GD+G RGP G    AE  +   + +     +  + G+KG PG  G  GP G  G +G                                   G  G  G+ G PG  G  G  G  G  G +G  G +G+ G  G +  G +G+ G  G QG  G+ G KGE+G  G  G  GR+G  G  G  GD G  G  G+ G   P        + +M  PG +G PG+ G QG+ G+ G  G    +G  G+RG  G  GD G +G  G  G  G  G  G  G  G  G RGL G +G+
Sbjct:  536 RGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSG--HRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGE--DGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGD----FLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQG------------------LPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRG-------------------------------PQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPG---LIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE 1503          

HSP 6 Score: 169.088 bits (427), Expect = 1.809e-41
Identity = 98/279 (35.13%), Postives = 137/279 (49.10%), Query Frame = 2
Query: 4601 KGKQGDRGGSGPTGLR-IKGKMGIKGTPGIPGDTGIKGERAAINRSE----ILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI---QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHT-XXXXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVK 5410
            +G+ G  G  GP G R  KG MG+ G PG+ G  G +GE A    +      +FARH Q +      +CP  TNL+  GYS   +         DLG   SC+ +F+  P + CD    CHF   N  S WLS+  P+     P++  ++   ISRCVVC     + A H QS +    CP  W E+W GYS  M T     G  Q L SPGSCLE  R  P+IEC+    +C+ +     ++L  + + + F +P  +T   + +    ISRC VC +
Sbjct: 1465 QGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFIFARHSQSV---HVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQS-MSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHG-HGRCNYYDALASFWLTVIEEQDQFVQPRQQTL--KADFTSKISRCTVCRR 1736          

HSP 7 Score: 157.918 bits (398), Expect = 4.776e-38
Identity = 356/1188 (29.97%), Postives = 467/1188 (39.31%), Query Frame = 2
Query:  632 GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGE--------------KGTPGRPGE------------QGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPG------------LNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGE------------------RGDLGDKGTTGFPGKNGTKGA-----KGENGTL---------------GIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI-NRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTN---------GVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRI------GMDGNNGTKGDRGDIGQKGIQGPSNPNATM---GIPGSKGLPGIKGVQGDRGNNGTDGNCTSL-----------GLMGERGFPGTPGD---NGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG---------------------GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPS--GVNGTTGYV 3772
            G +G  G  G  G  G+ G  G+ GP G  G +G  G  G  G  GEKG +G          G KGE G  G  G++                                 GE G PG  G +G DG  G++G  G  G  G++G  G PG+              KGT G  GE             G++G  GD G  GLTG+  + G  G KG    ++                +     IG  G+ G PG            L G  G +GL+G +GP G    +G V                  G  G+PGA+G  G  G+ G    +GE G                +G+KG  G+ G   G +G  G+ G+D   G+PGV+G  G  G    + TK  L  P GS G+                  RG +G  G +G PG NG++G      +GE G                 G+ G+ G   +PG+    G KG  GL G+ G  GY  +R    +   +          GP G QG  G  G+PG DG NG  G  G  G           G  G RG +G +G PG H N    GL G +G++G +GN G +G KG                     G  G PGK+G AGP G   E G                               +   G +G++G+ G  G  GD+G               +  D        TG +G+ G  G QGR G  G  G  G  G+N TT ++      G DG  G +GD GD G KG++G  NP       G PG  G  G KGV+G +G  G  G    +           G +G +G+PG  GD    G  G  GR GE G +G IG  G  G  G   + GE G  G +G  G  G +G  G  G+ G  G +G+ G +G  GA G+ G+ G++G +G                       + G+KGEVGS G  G  G KG  G   + G  GN G+  +       GL G  G  G+ G IG  G +G  G  G  GE G  G  GD G  G  G  GLPG +               G++GN G  G+ G KG +  S  KGD G+ G  G  G+       G +G  GD  P+  GV G  G V
Sbjct:   42 GIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRG--------DIGPKGEMGYPGIMGKS---------------------------------GEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVS----------------ELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAV------------------GRNGLPGARGEIGGPGERGKPGKDGEPGRF------------GDKGMKGAPGWTG-ADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKS-LPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN-VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPA----------------GIPGEPGKVGAAGPDGKAIEVG-------------------------------SLRKGEIGDTGDSGHRGDTGDDG-----------EKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRK---------------GETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEV 1066          

HSP 8 Score: 155.221 bits (391), Expect = 2.958e-37
Identity = 272/869 (31.30%), Postives = 351/869 (40.39%), Query Frame = 2
Query:  404 IKGEQGFPGE---MGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGD---DGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXV--GEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRG---------DPGDDSSEGVPG-------VKGKRGFKGDKGEAATKCE--------LDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA----EDCNATSKVKANEFKDRNKGEKGFP------GKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQ------GFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKG 2866
             KG++G PG+    G  G  G+ G  G+ G VG  G  G  G PG  G+ G+ G  G  G+ G  G++G RG    F +G  G  G+ G NG Q  +G KG++G  G  G  G NG KGS G  G +GL G         +G  G  G+ G  G                                 + GEIG  G++G NG  G+ G  G  G+ G KG+ GD   DG PG  G PGR GE G  G  G  G +G+   +  +G+ G+ G    I    A   KG +G  G       G  G KG +G+PG NG  G  GLKG  G  G    +G                       G PGAKG+ G  G+NG  I G  G+ G  G +G KG +   GV G  G  G + G +GPRG         + GD+   G+PG           RGF GD+G    + E           P G+ GERGD+G  G  GF G  G KG +G+ G  G  G       P EKG +G  G +G  G  G                                G++G PG PG +G NG  G  G     G  G +GD GF G PG +      GL G KG  GD G +G  GE G+A    +        +     D  KGE+G+P      G++G  GP GP G+ G                                      G  G DG  G KG  G+                        +  GD+G  GL G QG +      G  G +G+RG +G  G  G +G  G +G +G RGD G  G+          G PG +GLPG +G
Sbjct:  800 YKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG---DFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAG-----LQGLPGSPGIPGLPG---------------------------------MIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQG---------------------RPGEPGAKGLGGYPGRNG--INGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQI-GDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPG----ITLPAEKGDEGVAGLDGRAGRPGHF------------------------------GQKGAPGPPGENGPNGAIGHRGPQ-IQGPPGPQGDVGFPGAPGHNGR---HGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWG------------------------------------GIDGMDGLVGPKGQPGVTYSYSM------------------ARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGL---------TGAPGLRGLPGPQG 1502          

HSP 9 Score: 144.436 bits (363), Expect = 5.687e-34
Identity = 230/673 (34.18%), Postives = 304/673 (45.17%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGD------KGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPKGFEG---TMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGK--DGENCTD--TGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQG------EQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXV-------GEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGD--------LGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNK 2317
            KG++G  G +G NG +G +G +G+ G  GL G+ G  G PG+ GI G  G  G  G+ G+      +GD G RGPNG F   G  GD+G  G  G  G+ G KGE G  GF G     GV    G KG  GE GL G     P    G  G KG  G   D +   D   GR         G  G  G  G  G +G +G+ G+PG+ G+ G  G KGL G PG  G+ G+KG  G PG +G  G  GE G        G+IGD+G RGL G+  E+GE+GD+G   I    +   D+           +       G++G  G IG PG  G  GDIG  G  G  G+E +KG                +G++G RG PG   +  ++G  G   ++G  G  G  G+KG  G     G  G  G+ G  +  +GP G  GD    G PG  G+ G  G KGE           G  GERG+         GD G  GF G+ G  GAKGE G  G+ GK+G    PG +G  G  G  G+ G  G +G   +     ++                D+GE G+ G  G +G  G  G +G  G  G +G RGD+G  G  G    +  +G +GY G+ G  G RG  G +G         K +   F   ++
Sbjct:  896 KGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTG-----PIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEV-----GSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKG---------------FQGDQGPRGPPGIT-LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQI--QGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDM-------GRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPG----------DRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFIFARHSQ 1523          

HSP 10 Score: 144.436 bits (363), Expect = 6.619e-34
Identity = 322/1077 (29.90%), Postives = 429/1077 (39.83%), Query Frame = 2
Query:  692 KGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQE-GDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLG--SECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSS---EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTD--------------------------GQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWA-EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGN-----NGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDG------------RRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            KG +G  G  G +GV G +G  G IG  G  G    K  + E G++GEKG  G  G                                  +GE+G PG +GK+G  G  G  GI G  G  G++G  G PG+ G  G PG+ G+QG  G+ G+ G+  K   +G RG+ G    +     D                + GSKG  G  GL G  GD GL GP G  G  SE     +                     G PGAKG  G +  +G L   +T                   +KG KGY G + G EGP+G  G+  +    G+PG +G+ G  G++G+     E     G  G++G  G  G TG  G +G+ G +GE+G  G+ G  G +  PG      +K   G +G +G+IG           G+ G++G  G  G  GD G  G  G PG                            G+ G +GE G N    V+G +G+ G +G+PGL            +G +GD+G  G  G+KG   E  N    +          G +G PG  G  G  G  GEKG++G      +                         G  G+ G+ G PG  G+ G  G                        TG +G +GL+GN GR G KGL G  G  G+ G  G  G DG      +  KG+ GD G  G +G        G  G KG  G  G +G+RG  G  G+    G  G  G    PG +G  G  GR         IG  G DG  G RG  G+ G  G+ G           G  G +G  G +G+ G+KG+ GA G +G  GD+G  G   PG  G  G PG  G +G +G  G+P +DG            +RG  G   I  +G+ GP G +G  G  GD G  G  GL G  G  G  G+QG  G  G+TGLPG                     NKG RG             G  G++   G +G          KG+ G  G +G NG  G +
Sbjct:   41 KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGP---------------------------------KGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGT-KGNRGETGQPGGVGPPGFDG---------------DRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLI---------------------GPPGAKGEPG-DSLSGVLKPDDT-------------------LKGYKGYVG-LQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGE----PGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN----VVGPKGEPGLNGQPGL------------EGYRGDRGEVGLPGDKGLPGEGYN----IVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNA---------------------GPRGPRGQEGDTGYPGSHGNRGAIGL-----------------------TGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRG------DTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDG---EPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVI--QGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPG---------------------NKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKG---------QKGEVGSLGQNGQNGAKGSI 917          

HSP 11 Score: 115.546 bits (288), Expect = 4.005e-25
Identity = 245/811 (30.21%), Postives = 297/811 (36.62%), Query Frame = 2
Query: 1721 TKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLH-----------------------------------SNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEF-------------------KDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIG---------------MDGNNGTKGD------------------RGDIGQKGIQGPSNPNATMGIPG-----------------------SKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGN-------------------TGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            T C  DC KG  G  G  G  G  G  G  G  G  G  G LG KG  G      E G +G KG  G +G KGE+GY                            G+ G PG PG  G +G +G  G  G +G  G  G +G  G+PG                                      +   +G  GY G+ G+KG+ G  G KG   D  A S++  +                      D  KG KG+ G  G  GP GP GE+G                          G  G     G +G  GE GKPG  G+ G                            GDKG KG  G  G  G  G  GERGE G  G  G  G               + G  G++GD                  RG IG  G  G    N + G PG                         GLPG  G+ G+ G N        +G  GE G  G PG  G  GDRG  G  GD G  G                     G DG NG RGL GEK   GL G        G +G +G EG  G  G +G++G IG  G +G++G QG     +PG  G  G PG  G  G  G  G    DG+    G    G  GD+G  G  G  GD+G+KG +G+ G +GE G  G  GD G+ G +G+ G PG  G  G  G    T K+   G  G  G  GE+GD      GD G KG +G      I    G+ G+ G  GP GV G  G
Sbjct:   36 TLC--DC-KGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVG------EYGEQGEKGHRGDIGPKGEMGYPGIM------------------------GKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKG---DTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGA------------------------VGRNGLPGARGEIGGPGERGKPGKDGEPG--------------------------RFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN-------VVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEK---GLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQG-----NPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDD-----GDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKG 740          

HSP 12 Score: 57.7658 bits (138), Expect = 1.211e-7
Identity = 108/341 (31.67%), Postives = 145/341 (42.52%), Query Frame = 2
Query: 2894 TDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXX---XXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEV--------------------------------------GSPGLKGYFGGKGVQGMPAKDGRRGNTGITA------IGLKGDSGPDGD--NGTI-GDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
             DG   +  L   +G  G  G  G IG  G  G  GD G  G  GP GE G  G  GE+G+ G  G IG +G +G     G  G  G  G RGI+G  G+ G +G  G  G  G++G   PG+ G+                                       GS G  GY G  G +G P   G +G+TG  +      IG  G  G  GD  +G +  D+  KG  G +GL+G+ G  G  G+QG  GR    GLPG R               G+ G  G+RGK G+ G+      G  G KG +G  G+   +   G  G++G++G +G+ G  G
Sbjct:   28 ADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRG--PPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGR---NGLPGAR---------------GEIGGPGERGKPGKDGEP-----GRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQG 343          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Zebrafish
Match: col4a1 (collagen, type IV, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081105-114])

HSP 1 Score: 194.897 bits (494), Expect = 2.754e-49
Identity = 98/230 (42.61%), Postives = 126/230 (54.78%), Query Frame = 2
Query: 4739 ILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI---QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKNM 5416
             L  RH Q +   D   CP+GT  I  GYS +   GNE     DLG+  SCL KFS  P + C+    C+F  RN  SYWL++  P+     PV    +K  ISRC VC APA V A H Q T+Q   CP+ W  LW GYS +MHTS    GS Q  +SPGSCLE  R AP IEC+     C+ + ++  ++L  + D + FTKP+  T      L   ISRC+VC+K +
Sbjct: 1360 FLVTRHSQTI---DVPHCPQGTTPIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLTTPEPMPMSMAPVTGESIKPFISRCAVCEAPAMVIAVHSQ-TIQIPNCPDGWASLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT-CNYYANSYSFWLATIEDTDMFTKPVPATL-KAGSLRTHISRCQVCMKRV 1583          

HSP 2 Score: 186.808 bits (473), Expect = 8.169e-47
Identity = 337/1045 (32.25%), Postives = 423/1045 (40.48%), Query Frame = 2
Query:  404 IKGEQGFPGE---MGHNGTDGQQGFMGYRGPVGLKGDI-------GCDGEPGTVG------IDGKNGTHGTPGKIGDKGDEGDRGPNGTFS---------------IGTRGDNGERGINGTQGINGTKGERGPKGFEG-TMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD-----RGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEI-----------GSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCE--LDCPKGSIGE------RGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGD--------------------KGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDG-----NNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKG---VQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGD----AGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVG 3268
            IKGE+G PG     G+ G +G  G MG  G  G  GDI       G  G PGT G      +DG  G  G PG  G KG+ GDRGP+G F                IG  G  G++G  G  G  G  G +G KG  G  + + G +G+ G  GE G  G + ++     G  GE+G+ G  G+                      G  G KG  GI G  GIPG+ G+ G DG  G  G PG      RGL G KG  GLPG    PG PGE+G  G  G  G  G TG    +G +G+ G   +          G                         G KG  G PGL+       + GP G  GS  V G                    G +G+PG  G+ GK+G  G    +GE G +G               + G  G+ G V       G+PGD   +G PG+ G RG  GD G    + E  L  P G++ +      +GD GD G  G PG  G KG  G +G  G+ GKDG    PG  G+ G KG  G++G+ G IG    T A                   GD G  G  G  G  G  G+ G  G  GT+G  GD+GD                     GF GEPG    +   G+ G  G +G KG++G  G  G          V          G  G PG+ G+ GP GP+GEKG                                       +SG+DG PG  G+ G           G  G             GDKGN GL G  G  G  G KG++G  G  G  GR G  G       G KGDRGD GQ G +G +      GIPGS G  G KG    QG  G+ G  G+   +G+ GE G PG  G  G +G +G  G  G  G  G  G  GE G RG  G KG             ++G  G  G +G +G++G +G  G+KG+ G  G QG++G  G  G +  PG KGE G
Sbjct:  419 IKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDR-----GFPGERGVPGFPGDKGDPGLPGIG----------LPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPG---VPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD-------MPGPPGDRGSPGVPG------------------LPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMG---------------MAGPPGFQGLV-------GNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGM---PGSPGQPGDKGDPGIIGKPGSIGEPGDTGAR------------------GDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKP----GEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKG---------------------------------------QSGQDGIPGFTGERG---------EPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1325          

HSP 3 Score: 175.252 bits (443), Expect = 3.014e-43
Identity = 262/786 (33.33%), Postives = 328/786 (41.73%), Query Frame = 2
Query: 1637 GDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTG---FPGKNGTKGAKGENG-----------------TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNET-----------------------------IQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNG--------------TDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAG---------LNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK--IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGT 3760
            G PGD  S G PG  G+ G +G KGEA     L  P+G+ G RG+ G  G  G   FPG+ G  G  G+ G                   GI G  G   + GE G+ G  G  G  G+KGE G         T                   G  G+PG PG  G  G  G  G  G  G  G +G KG  G PG+H                                 I+G +GY+G+ G     GP G++G       +  V          G+ G PGK G  G  GP GE GI G  G  G  G  G+ G  G+KG+ G  G     G +G  GE G+PG++G  G    +          +           TG+KG  G  G+ G  G  G+ G  G+ G  G  G IG  G+ G  GD G  G  G  G   P    G+ GS G PG KG  G +G+ G              T GN  S G  GE G  G  G  G  G  G +G  GD G+IG+ G  GE G  GL G  G+ G         L G  G  G  G+ G  GI G  GERG  G  G+   G+RGE G +GD+G     +PG  G  GSPG+ G  G KG+ G+P   GR G  G+    ++   GP GD    GD+G  G  G  G +G  G  G+ G +GEKG  G  G PG R                  G KGD+G IG  G+      N  KG++G +G  G  G K      G KG+ GD G  G+ G+
Sbjct:  529 GQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTT-------------------GLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD-MPGPPGDRG-------SPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPG--NMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKG-----NPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAME---GPKGDR---GDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSR------------------GYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGS 1256          

HSP 4 Score: 158.303 bits (399), Expect = 4.130e-38
Identity = 331/994 (33.30%), Postives = 413/994 (41.55%), Query Frame = 2
Query:  971 GIPGKLGKNGTDGEKG----LEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNM-----------------ERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKG--GVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP----------------------------KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKG-----------LKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIG------QKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGS--KGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG-ERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGD 3733
            G PG +GK G  GE G      G+ GD+GL G  GD G PG  G PG+ G  G  G  G+ GDRG  G                      G+ GDKG+A           +GAKG  G       I   G  G PG  G +G  GL+G  G  G   V G  G      +   G  G  G KG+ GIPG  G+ G+ G+ G   + G  G+         +  +  RG+ G KG      G  G  G PG+  + G+PGV G  G  G  G    K     P                             G IG+ G  GDKG  G PG +   G  G+ G+ G+ G  G+   PG+ G  G  G  G  G KGEIG +                        G QG  G PG PG  G  G  G  G  G  G  G+RG+ G  G PG  S+  ++ ++G KG  GD+G+ GP+GEKG+      TS       KD   G  G PG  G  G +G  G  G               + G  G +G+ G  G     G+ G  G  G PG KG +G                          S GDKG+ G            KGN G  GF G   E GE GQ GT G  G  G  G KGD+G IG      +KG+ G        G PG  G PG++G  G  G  G  G     G  GERG PG PG     G  G RGE G  G  GN G  G  G+ G+ G KGD GL+G  G             +G  GERG+ G   +G  G RG+QG  G++G  G   P   G  GS G KG  G  G QG P   G +G+ G   IG+ G+ G  G NG  G+ G +G+ G  G +GE    G IG +GE G RG  GL G E         T   G  G  G +G +G +G +G       +G +G +G +G+ G    N   G KG+ G 
Sbjct:  439 GAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKV-----ISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGT-------PGQKGEPGRGLPGPKG----TTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD-MPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPP------------------GFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFP----GTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIG---------------EPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDG--------------------------SKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPG---EPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGR----GLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGD------------QGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGP--PGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGF--IGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGE---QGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQ 1326          

HSP 5 Score: 124.02 bits (310), Expect = 1.120e-27
Identity = 152/411 (36.98%), Postives = 193/411 (46.96%), Query Frame = 2
Query: 2630 GDKGNKGLKG--------NQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG----GSSPGEKGEVGSPG--------------------LKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            GDKG +GL G        ++G  G  GL G +G  GQ G  G+ G  G  G KG+ G +G  G  G        G PG KG PG+ G++GD G+         LG  GERG PG  G  G + D       GD G IG+ G  G  G +G  G  GD G+ G  G+ G  G+ G KG  G+IG+ G  G  G  GARG+ G  G  G KG    G SPG  G  G+ G                     KG  G  G  G P + G++G  G+T  G  G  G  GD G+IG  G  G  G  GL G  G  GT G  GE G +G  G  GE+         G++G+ G  G  G+RG+ G  G  +  ++G+ G KG +GN G   I  + G  G KGD+G SG+ G  G
Sbjct:  743 GDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGD---------LGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMT--GTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEK---------GQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQG 1133          

HSP 6 Score: 79.7221 bits (195), Expect = 3.240e-14
Identity = 106/314 (33.76%), Postives = 131/314 (41.72%), Query Frame = 2
Query: 2672 QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGT-----------IGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGE-----------------VGSP---GLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGL 3520
            QGF G  G +GE G  G +G  G  G NG  G  G  G +G      P      PG KG  G+ G  GDRG  G DG      L G+ G PG PG  G  GDRG  G+ G  G            IG  G  G+ G+ G  G  G  GL G            +  + G  G  G  G  G+ G +G++G  G++G+ G   PG+KG+                  G P   G+ G  G  G  G+P + G  G  G    GL G  G  G  G  G  G+KG  G  G+ G  G  G  G QG KG  G  G+
Sbjct:  411 QGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQG-----EPGDIFVAPGLKGDKGLPGTTGDRGFPGVDG------LPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGA-----KGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPG--FPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGV 706          

HSP 7 Score: 59.6918 bits (143), Expect = 3.947e-8
Identity = 56/141 (39.72%), Postives = 68/141 (48.23%), Query Frame = 2
Query: 2684 GLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTG-----PDGENGTRGLTGEKGDAGLNG 3091
            GL G  G +G  G  G  G  G+ G KGDRG+IG  GI+G        G PG  G+PG+ G++G  G  G  G C   G  GERGF G PG  G +G    R E     + G+ G     P    G RGL G+ G  G  G
Sbjct:    4 GLPGLMGLVGFPGMQGHEGPPGSMGPKGDRGEIGAPGIKGSRGLPGQAGFPGRPGIPGLPGLEGAPGPQGIPG-CN--GTKGERGFDGIPGITGLLGPPVLREERYGTCSKGDPGGVIGLPIPLKGDRGLPGQHGFPGQKG 141          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Zebrafish
Match: col4a1 (collagen, type IV, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081105-114])

HSP 1 Score: 193.741 bits (491), Expect = 4.548e-49
Identity = 98/230 (42.61%), Postives = 126/230 (54.78%), Query Frame = 2
Query: 4739 ILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI---QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKNM 5416
             L  RH Q +   D   CP+GT  I  GYS +   GNE     DLG+  SCL KFS  P + C+    C+F  RN  SYWL++  P+     PV    +K  ISRC VC APA V A H Q T+Q   CP+ W  LW GYS +MHTS    GS Q  +SPGSCLE  R AP IEC+     C+ + ++  ++L  + D + FTKP+  T      L   ISRC+VC+K +
Sbjct: 1094 FLVTRHSQTI---DVPHCPQGTTPIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINNVCNFASRNDYSYWLTTPEPMPMSMAPVTGESIKPFISRCAVCEAPAMVIAVHSQ-TIQIPNCPDGWASLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT-CNYYANSYSFWLATIEDTDMFTKPVPATL-KAGSLRTHISRCQVCMKRV 1317          

HSP 2 Score: 186.808 bits (473), Expect = 6.243e-47
Identity = 336/1086 (30.94%), Postives = 423/1086 (38.95%), Query Frame = 2
Query:  467 FMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN-------------------KPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRG-----------------LKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGD------------RGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR----NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGI-----------------------------TAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIG 3481
              G+ GP G+KG+ G  G  G  G  G NG  G  GK G +G+ GD       + G +GD   +G+ GT G  G  G  G  G +G  G  GTKG   + G KG +G + +                   +P  Q GDKG  G  G  G                          G +G  G +GE G PG  G  G  GE+G+ G PGD+G                   GI G  G+PGE G PG+ G  G  G  G KG+ G       RG  G KGT  +                      G  G KG+ G PG+ GT G  G  GP G                               +G PG  G+ G  G  G    GE G+ G  G  G  G     G+KG+KGY G + G + P G PGD  S GVPG+ G +G  G  G        D   G  G +G++G  G  G PG  G  G  G+ G  G  G  G     G+ G KG +G  GL G  G +  ++        G+ G +G+ G  G +G  G  G PG+PG DG  G+ G+ G  G  G+IG             RGD G+ G  G    + + G  G+ G KG  G++G  G+ G                         GEKG  G MG+ G  G  G KG                                   GS+G  G  GKPG KG  G+                         S G+ G  G  G  G QG  G  GE+G+ GQ+G  G  G  G  G  G RG  G +G  G        G+PG  G PGI G +GD+G +G  G+    G  GERG PG     G  GDRG +G+ G+ G  G  GP G  G+ G  GEKGD G                   +G  G RG  G KG IG  GE G+ G  G KG     E G  G PG  G  G +GV G   + G RG  G+                               +G++G  G  G  G +G +G KG +GT G  G  G  G  G
Sbjct:  135 LQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDI----FVAPGLKGD---KGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPG-QPGDKGSAGFPGAPGR--------PGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPG-------RGLPGPKGTTGLPGVP------------------GFPGEKGNTGMPGVPGTEGRTGPPGPQG------------------------------LKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQG-LPGLDMP-GPPGDRGSPGVPGLPGSKGLPGQPGVPGK----DGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKG---------------------------------DQGSIGYPGSPGKPGEKGVGGL-----------------------PGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPG-RGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGD---QGRPGERGLPGQ-AMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGF------------------QGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKG-----EMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1059          

HSP 3 Score: 181.8 bits (460), Expect = 2.090e-45
Identity = 337/1051 (32.06%), Postives = 425/1051 (40.44%), Query Frame = 2
Query:  404 IKGEQGFPGE---MGHNGTDGQQGFMGYRGPVGLKGDI-------GCDGEPGTVG------IDGKNGTHGTPGKIGDKGD------EGDRGPNGTFS---------------IGTRGDNGERGINGTQGINGTKGERGPKGFEG-TMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD-----RGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEI-----------GSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCE--LDCPKGSIGE------RGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGD--------------------KGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDG-----NNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKG---VQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGD----AGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVG 3268
            IKGE+G PG     G+ G +G  G MG  G  G  GDI       G  G PGT G      +DG  G  G PG  G KG+      +GDRGP+G F                IG  G  G++G  G  G  G  G +G KG  G  + + G +G+ G  GE G  G + ++     G  GE+G+ G  G+                      G  G KG  GI G  GIPG+ G+ G DG  G  G PG      RGL G KG  GLPG    PG PGE+G  G  G  G  G TG    +G +G+ G   +          G                         G KG  G PGL+       + GP G  GS  V G                    G +G+PG  G+ GK+G  G    +GE G +G               + G  G+ G V       G+PGD   +G PG+ G RG  GD G    + E  L  P G++ +      +GD GD G  G PG  G KG  G +G  G+ GKDG    PG  G+ G KG  G++G+ G IG    T A                   GD G  G  G  G  G  G+ G  G  GT+G  GD+GD                     GF GEPG    +   G+ G  G +G KG++G  G  G +        V          G  G PG+ G+ GP GP+GEKG                                       +SG+DG PG  G+ G           G  G             GDKGN GL G  G  G  G KG++G  G  G  GR G  G       G KGDRGD GQ G +G +      GIPGS G  G KG    QG  G+ G  G+   +G+ GE G PG  G  G +G +G  G  G  G  G  G  GE G RG  G KG             ++G  G  G +G +G++G +G  G+KG+ G  G QG++G  G  G +  PG KGE G
Sbjct:  144 IKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDR-----GFPGERGVPGFPGDKGDPGLPGIG----------LPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPG---VPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD-------MPGPPGDRGSPGVPG------------------LPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMG---------------MAGPPGFQGLV-------GNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGM---PGSPGQPGDKGDPGIIGKPGSIGEPGDTGAR------------------GDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPG-SPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKG---------------------------------------QSGQDGIPGFTGERG---------EPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1059          

HSP 4 Score: 172.94 bits (437), Expect = 1.099e-42
Identity = 292/923 (31.64%), Postives = 371/923 (40.20%), Query Frame = 2
Query: 1277 GEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKE-------------GPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTG---FPGKNGTKGAKGENG-----------------TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNET-----------------------------IQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNG--------------TDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGL------------TGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK--IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGT 3760
            G  G  G  GN G NG  G +G  G  G  G   V  G+     +              RG PG  G+ GK+G+ G    +GE    G               +KG++G  G+                  G  G PGD  S G PG  G+ G +G KGEA     L  P+G+ G RG+ G  G  G   FPG+ G  G  G+ G                   GI G  G   + GE G+ G  G  G  G+KGE G         T                   G  G+PG PG  G  G  G  G  G  G  G +G KG  G PG+H                                 I+G +GY+G+ G     GP G++G       +  V          G+ G PGK G  G  GP GE GI G  G  G  G  G+ G  G+KG+ G  G     G +G  GE G+PG++G  G    +          +           TG+KG  G  G+ G  G  G+ G  G+ G  G  G IG  G+ G  GD G  G  G  G   P    G+ GS G PG KG  G +G+ G              T GN  S G  GE G  G  G  G  G  G +G  GD G+IG  G  G+ G +G+             G  G+ GL G  G  G  G+ G  GI G  GERG  G  G+   G+RGE G +GD+G     +PG  G  GSPG+ G  G KG+ G+P   GR G  G+    ++   GP GD    GD+G  G  G  G +G  G  G+ G +GEKG  G  G PG R                  G KGD+G IG  G+      N  KG++G +G  G  G K      G KG+ GD G  G+ G+
Sbjct:  149 GLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTG--------DRGFPGVDGLPGKDGRPGYPGTKGEPAKFG---------------IKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTT-------------------GLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD-MPGPPGDRG-------SPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPG--NMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKG-----NPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAME---GPKGDR---GDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSR------------------GYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGS 990          

HSP 5 Score: 163.696 bits (413), Expect = 7.090e-40
Identity = 350/1105 (31.67%), Postives = 443/1105 (40.09%), Query Frame = 2
Query:  497 KGDIGCDGE--PGTVGIDGKNGTHGTPGKIGDKGD------EGDRGPNGTFSIGTRGDNGE----------------------RGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQ-----EGDKGEKGMSGKDGENCTD--------TGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDG----LPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXX--XXXXXXVGEIGSKGSIGNPGLNGTTGDIGL--KGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGT---------LIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGD------------RGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR----NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDN----------------------GTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTG 3517
            KG+ G DG   PG  G DG+ G  G PG I ++ D           P     +G +GD GE                      +G  G  GI G KG  GP G  G  G NG  G  G+ G +G  G     P ++      G  G++G  G DG    D         G  + F    +     +                  G+ G+ G  G  G  G PG  GL+G KG+ G    LPG +G    PG +GE G+ G +GDRG  G+    G  GDKG   +                  G  G  GE G  G  G PG  GT G  G   +G  GP G+  + G  G PGE GN G  G  G +G  G PG +G+ G  G  G             GE G+ G  G  G  G     G+KG+KGY G + G + P G PGD  S GVPG+ G +G  G  G        D   G  G +G++G  G  G PG  G  G  G+ G  G  G  G     G+ G KG +G  GL G  G +  ++        G+ G +G+ G  G +G  G  G PG+PG DG  G+ G+ G  G  G+IG             RGD G+ G  G    + + G  G+ G KG  G++G  G+ G                         GEKG  G MG+ G  G  G KG                                   GS+G  G  GKPG KG  G+                         S G+ G  G  G  G QG  G  GE+G+ GQ+G  G  G  G  G  G RG  G +G  G        G+PG  G PGI G +GD+G +G  G+    G  GERG PG     G  GDRG +G+ G+ G  G  GP G  G+ G  GEKGD G                   +G  G RG  G KG IG  GE G+ G          G KGE+G  G+ G+ G KG QG+    G  G+ G    GLKG  GP G                        G  G  G KG  G +GL+G  G++GT G  G  G +G+ G
Sbjct:   53 KGEKGADGRSFPGPKGTDGQPGPPGPPGPINEECDVTKGAPGPPGPPGLQGEVGQKGDQGETCTECNAFGPPGLPGPQGPKGLQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGA---PGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQG-LPGLDMP-GPPGDRGSPGVPGLPGSKGLPGQPGVPGK----DGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKG---------------------------------DQGSIGYPGSPGKPGEKGVGGL-----------------------PGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPG-RGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGD---QGRPGERGLPGQ-AMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGF------------------QGAPGSRGYKGDKGFIGVSGEPGLPGYN--------GPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFP--GLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1059          

HSP 6 Score: 123.25 bits (308), Expect = 1.716e-27
Identity = 148/424 (34.91%), Postives = 188/424 (44.34%), Query Frame = 2
Query: 2630 GDKGNKGLKG--------NQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG----GSSPGEKGEVGSPG--------------------LKGYFGGKGVQGMPAKDGRRGNTGIT-------------AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            GDKG +GL G        ++G  G  GL G +G  GQ G  G+ G  G  G KG+ G +G  G  G        G PG KG PG+ G++GD G+         LG  GERG PG  G  G + D       GD G IG+ G  G  G +G  G  GD G+ G  G+ G  G+ G KG  G+IG+ G  G  G  GARG+ G  G  G KG    G SPG  G  G+ G                     KG  G  G  G P + G++G  G+T             +IG  G  G  G+ G  G  G  G  GT G  GE G  G  G  GEKG+ G+ G+PG                       G+RG+ G  G  +  ++G+ G KG +GN G   I  + G  G KGD+G SG+ G  G
Sbjct:  474 GDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGD---------LGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPG---------------------FTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQG 867          

HSP 7 Score: 78.5666 bits (192), Expect = 8.359e-14
Identity = 104/317 (32.81%), Postives = 130/317 (41.01%), Query Frame = 2
Query: 2672 QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGD--------------NGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGE-----------------VGSP---GLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGL 3520
            QGF G  G +GE G  G +G  G  G NG  G  G  G +G      P      PG KG  G+ G  GDRG  G DG     G  G  G+PGT G+    G +G RG  GD                 IG  G  G+ G+ G  G  G  GL G            +  + G  G  G  G  G+ G +G++G  G++G+ G   PG+KG+                  G P   G+ G  G  G  G+P + G  G  G    GL G  G  G  G  G  G+KG  G  G+ G  G  G  G QG KG  G  G+
Sbjct:  136 QGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQG-----EPGDIFVAPGLKGDKGLPGTTGDRGFPGVDG---LPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGA-----KGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPG--FPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGV 437          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Zebrafish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 192.2 bits (487), Expect = 6.355e-49
Identity = 108/278 (38.85%), Postives = 151/278 (54.32%), Query Frame = 2
Query: 4589 PGFTKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKNM 5416
            PGF +G+ G  G SG     ++G+ G +G PG+PG  G+ G    +     L  +H Q     +   CP+G +L+  GYS +   G E     DLG   SCL +F+  P ++C+    C++  RN +SYWLS+  PI   PV+ +E+K  ISRC VC AP+   A H Q T     CP  W  LW GYS +MHT+   +GG Q L+SPGSCLE  R  P IECN     CH + +   ++L  + D +  + P  ET      L + ISRC+VC+KN+
Sbjct:  775 PGF-RGEPGSMGHSG-----LQGEQGTRGRPGMPGPLGMAGRSVNVG---YLLVKHSQ---SEEIPMCPQGMSLLWMGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNPGDICYYASRNDKSYWLSTTQPIPMMPVEESEIKPYISRCSVCEAPSVAIAVHSQDTTIPN-CPVGWRSLWIGYSFLMHTAAGDEGGGQSLASPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSI-DESFQSSPSSETLKAGQLLSR-ISRCQVCMKNL 1037          

HSP 2 Score: 153.68 bits (387), Expect = 6.473e-37
Identity = 242/747 (32.40%), Postives = 319/747 (42.70%), Query Frame = 2
Query: 1583 VKGEKGYYGNVMG-KEGPRGDPG------DDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGK------------------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPG--------LHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGP---VGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGV---------QGDRGNNGTD-----GNCTSLGLMGERGFP-------GTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPG----EKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNT------------GITAIG--LKGDSGPDGDNGTIGDEGD------------------------KGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG 3526
              G KG +G V G   G  GDPG      D    G PG+ G  G +G  G    K E   P G  GE+G  G  GT GFPG+                  +G +G +GE G +G +G  G    PG  G  G+      +G  G+ G           G +G KG +G  G  G  GE+G+ G  GT G+ G  G  GA G  G  G +GD+G +G PG         H  E ++G +G  G  GD G  GP G KG+        K          KG KG PG+ G+ GP    GP G  GI+GF G  G       N                ++G+ G  G+ G  G KGD G         +                STG KG  G+ G +G  G  G++G +G  G+ GT G  G DG  G  G +G  G+ G  G +      G PG KG PG+KG+         +G++G  GTD     GN  + G +GE G P       G+ G  GT GD G +GE+G  G     GP G+ G   + G +GD G  G  G+ G  G +G  GI    G +G  G+ G  G  GE+G++GD+G KG S        KG+ G PG+ G+ G +G QG     G +G+T            G   +   L G+ GP G  G  G  G                          G+ G+ G  GE G+ G  G QGE+G RG+ G+PG
Sbjct:   88 ASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGE-SGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGN------IGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNK--------------GSSGAYGRPGDSGIKGFKGDLG-------PTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGV---PGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPG 803          

HSP 3 Score: 153.68 bits (387), Expect = 7.112e-37
Identity = 290/948 (30.59%), Postives = 373/948 (39.35%), Query Frame = 2
Query:  407 KGEQGFPGEMGHN---------------GTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHG-----TPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-------QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKN------------GTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGL------KGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTN--GVIGDRGDKGFSGEPGLHSNET-IQGLQGYKGIKGDKGNRGPSGEKGW--AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLM---GERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG 3091
            KG  GF G++G                 G  G +G +GY G  G+KG  G  G+PG  G  G  G HG     + G  GD G  G RG  G    G  G  G  G+ G  G+ G KGE GP G +G  G  G  G+ G  G+ G  G       I       + GD+GE G+ G  G      G   N                     G+ G IG PG  G+             G+ G +G+ G PG  G +G+KG  G  GE G PG  G +G  G  G KGDRGLTG        GDK    +I+ T    +             G  G  G++G+PG  G  G  G       +G DG  G   V  GV                    +G+PG  G+ G +G     + G TG                  + G +G+ G    K   +G+ G   + G PG  G +GFKGD G   +       +G  G  G  G KG  G PG+ G+ G  G  G  G +G+ GT   PG  G +G  GS G  G  G+ G    T                  G  G +G  G+ GI G DG  G  G  G  GT+  G  G+ G KG  GE G+ S  T + G  G+KG  GD GN+G  G++G    +     S +K  +      G+ GFPG  G+ G  G  G  GI                            G     G+VG+ G  G+ G++GD G               +        +   GDKG  G+ G  GR+GF   +G+RG  G  G TG  G  G  G KG               P     +PG +G PG  G+QG  G NG  G     G     G +G PG PG  G+ G RG  G MG +G        GE GTRG  G  G  G+ G
Sbjct:   29 KGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGL--TGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGA-IGDPGNI--------------------GVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPP------GDK---PVIHITPHMKEVMK----------GSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGV--------------------KGLPGEPGLEGPKG-----MPGPTG------------------LPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQ---------------GQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQ------GDYGFPGIKGIPGFPGTRGTPGI------------------------PSPFGAKGDRGNVGDFGLFGEKGVQGDRG--------------EKGSSGESGVSGRKGDKGEPGMMGFPGRRGF---QGDRGPFGPKGDTGPPGFPGLPGAKG--------------YPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGL------QGEQGTRGRPGMPGPLGMAG 809          

HSP 4 Score: 143.28 bits (360), Expect = 1.082e-33
Identity = 254/781 (32.52%), Postives = 317/781 (40.59%), Query Frame = 2
Query: 1637 GDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDK---------------------GTTGFPGKNGTKGAKGENGTLGIKGKDG-----------TSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGT---DGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGN----NGTDGNCTSLGLMGERGFPGTPGDNG-TIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVG---SPGLKGYFGGKGVQGMPAKDGRRGNTGITAI---------GLKGDSG----PDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGE------KGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG----------------------DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGD 3724
            GDPG     G+PG +G  GF G  G          PKG+ G  GDLGDK                     G  G+PG  G KG  G +G  G+ G  G           +S  PG+ G  G +G  GL G+ G  GY             G  G KG  GP G QGEQG PG PGT    GQ G  G  G  G  G  G  G +G  GEPGL     ++G  G  G  G  GN GP G++G                K   +G  GFPGK G  G  G +G KG                              +    G  G  G  G PG KGD G+ G  G   +I       +         G+ G+ G  G +G +GF G+ G  G+ G  G    +        KG +G  G+ G++GP       G+PG  GLPGI+G  G  G      G  G+  + G  G+ G  G  GD G TI   G  G  G+ G  G+TG     G  G+ GE+G +GL+G               IEG+ G +G  G+ G  G+ G QG  G QG KG S  PG+ G  G    PG KG+ G KG+ G+    G++GN G+            G KG+ G    P    G  G  G KG  G  G +GEIG  G  G QG+      KG +G  G PG +G  G  G  G  G     G KGDRG +G+ G                            KG+ G  G  G RGF+      G KGD
Sbjct:    3 GDPGPPGESGLPGPRGLEGFPGVPG----------PKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMP------GMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKG-GQGMTGFPGKTGERGLKGFSGTKG------------------------------EIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVV--------KGVKGLPGEPGLEGPK------GMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTG---AKGLYGMPGERGSSGLDG---------------IEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGD 704          

HSP 5 Score: 131.339 bits (329), Expect = 4.497e-30
Identity = 233/736 (31.66%), Postives = 302/736 (41.03%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGI---------------------DGKNGTHGTPGKIGDKGDEGDRGPNG----TFSIGTRGDNGE---------------RGINGTQGINGTKGERGPKGFEGT---------MGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGE--NCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGE----KGLEGIPGDRGL---KGIKGDDGLPGEKGTPGRPGEQG-EQGKIGDKGDRGLTGKNMERGERGDKG-TASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG--NVMGKEGPRGDPGDDS--SEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIP---GTDGQNGTNGEMGANGTNGVIGDRGD------------KGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPN 2371
            + G+ G PG  G  G  G  G  G  GP GL+G+ G  G PGT G                       G+ G  G PG IG +G +G  G  G    T +IG  GD GE               +G  G  G  G  GERG KGF GT          G  G  GS G+ G++GL G   +KP I      ++ M G  G+  N  D G +                      RG +G  GIPG  GK+G  GE    KG++G+PG+ GL   KG+ G  GLPG +G PG  G +   QG  G  G  G  G +  +G +GD G T S+   T    + G  G  G+KG  G  G +GS G  G+ G  G  G  G  GP GS+ ++G                       G  G KG  G  G+ GT  I+G+ G                +G  G KG +G   + G++G +G PG D+    G PG KG+ G            E   P  + G  G LG KGTT   G +G KG  G+ G  G +G+ G S+       KG++G  G  G KG  G+                            G +G PGIP   G  G  G  G+ G  G  GV GDRG+            KG  GEPG+       G  G +G +GD+G  GP G+ G                  +  GE+G PG+MG+ GP G N
Sbjct:  120 LTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGP--------------------RGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQG---------------------FPGSQGHKGRSGDPGQTGTTGIQGQPGQ---------------KGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELG------------ETGIPSTTTGVPGSLGHKGTT---GDSGNKGEIGQRGVPGPQGQQGFSDI------KGTQGDYGFPGIKGIPGF---------------------------PGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGM------MGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRN 745          

HSP 6 Score: 111.694 bits (278), Expect = 5.739e-24
Identity = 190/589 (32.26%), Postives = 239/589 (40.58%), Query Frame = 2
Query: 2120 VIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKG--WAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGD---------------------RGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGE-------KGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNG----TIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
             IGD G  G SG PG       +GL+G+ G+ G KG  G SG+ G                +     +G+ G+PG  GV GP G +G+ G+ G  G  G  G                        S G  G+ G PG +GD G+                          TGD G  G  G +G  G  GLKGE G  G  G  GR G  G  G  G                      RGD G+ G+ G       +G PG+ G+ G  G  GD+G  G  G     GL G +G  G  G  G  G+RG +G  G  G IG  G  G  G  G  G+KGD GL G  G +  +        E + G +G +G+ G  G  G +G +G  GI GG      PGE       KG  G PGL+G  G  G  G+P  +G  G +G   I  +G+ G  G  G  GD G KG  G    TI L G  G  G  G  G  G +G  G+PGER      G +G  G  G  G +G+ G +G  G D +    G  G KG  G+ G        G  G KG  G  G+ G  G 
Sbjct:    1 CIGDPGPPGESGLPG------PRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGE-------------------VFGASSGAPGDPGLPGHRGDTGL--------------------------TGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMK-EVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLI-FQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGER------GSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGL 530          

HSP 7 Score: 97.4413 bits (241), Expect = 1.128e-19
Identity = 182/598 (30.43%), Postives = 246/598 (41.14%), Query Frame = 2
Query:  446 GTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI------------GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG----TKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRG------LKGIKGDDGLPGEKGTPGR------PGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASI--INCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTT----GDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGD---------------PGDDSSEGVPGVKGKRGFKGDKGEAATKCEL---------------DCPKGSIGERGDLGD---------------------------KGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI 1954
            G+ G QG  G+ G  G +G  G  G  G +G+ G  G  G PG  G KGD G  GP G   +            G++GD+G  G  G  G  GTKG  G  G EG  G  G     KG KG  GE GL+G +    P    G +G  GMSG       + G SS  Y        K           + G  G+ G+ G  G+ G KGL G+PG+RG      ++G+KG  G PG  G PG       PG QG +G+ GD G  G TG   + G++G  G   I  ++               + G  G  G+KG +G  G+  TT    G +G KG  G  G++   G  G+PG  G +G    +G +G  G PG KG+ G  G  GT  I    G+                  KG++G  G+  + G++G +GD                GD    G+ G  G+RGF+GD+G    K +                  P+   GE+G  G                            KG  G PG  G+ G +GE G++G  G  G     G +GR G  G  G+ G    +GY+
Sbjct:  242 GSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKG-SSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGA------------------KGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQ---GTRGRPGMPGPLGMAGRSVNVGYL 817          

HSP 8 Score: 68.9366 bits (167), Expect = 6.394e-11
Identity = 103/334 (30.84%), Postives = 130/334 (38.92%), Query Frame = 2
Query:  410 GEQGFPGEMGH---------NGTDGQQGFMGYRGPVGLKGDIGCDG-----------------EPGTVGIDGKNG-------THGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKG------------------RIGEKGLKGKEANKPKI-------QEGDKGEKGMSGKDGENCTDTGR----SSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGE---------------KGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERG 1180
            G QGFPG  GH          GT G QG  G +G  GLKG  G DG                 +PG  G  G+ G       T G PG +G KG  GD G  G   IG RG  G +G  G   I GT+G+ G  G +G  G  GT+G+ G                    GEKG++G    K          ++GDKGE GM G  G       R                           + + GE G PG++G  G  G                 G +G+PG  G+ G  G  G PG  G  G  GEQG +G+ G  G  G+ G+++  G
Sbjct:  484 GLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKG--EIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVG 815          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Zebrafish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 193.356 bits (490), Expect = 8.473e-49
Identity = 108/278 (38.85%), Postives = 151/278 (54.32%), Query Frame = 2
Query: 4589 PGFTKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXX-XXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKNM 5416
            PGF +G+ G  G SG     ++G+ G +G PG+PG  G+ G    +     L  +H Q     +   CP+G +L+  GYS +   G E     DLG   SCL +F+  P ++C+    C++  RN +SYWLS+  PI   PV+ +E+K  ISRC VC AP+   A H Q T     CP  W  LW GYS +MHT+   +GG Q L+SPGSCLE  R  P IECN     CH + +   ++L  + D +  + P  ET      L + ISRC+VC+KN+
Sbjct: 1407 PGF-RGEPGSMGHSG-----LQGEQGTRGRPGMPGPLGMAGRSVNVG---YLLVKHSQ---SEEIPMCPQGMSLLWMGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNPGDICYYASRNDKSYWLSTTQPIPMMPVEESEIKPYISRCSVCEAPSVAIAVHSQDTTIPN-CPVGWRSLWIGYSFLMHTAAGDEGGGQSLASPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSI-DESFQSSPSSETLKAGQLLSR-ISRCQVCMKNL 1669          

HSP 2 Score: 176.022 bits (445), Expect = 1.892e-43
Identity = 365/1165 (31.33%), Postives = 470/1165 (40.34%), Query Frame = 2
Query:  473 GYRGPVGLKGDIGCDGEPGT-------------VGIDGKNGT-----HGTPGKIGDKGDEGDRGPNGTFSI------------------GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGD-----RGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRG---IPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMG-KEGPRGDPG------DDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGK------------------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPG--------LHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGP---VGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGV---------QGDRGNNGTD-----GNCTSLGLMGERGFP-------GTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPG----EKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNT------------GITAIG--LKGDSGPDG---------------------DNGTIGDEGDKGMNG------TIGLEGEIGNNGTIGDQGEKGRRGKTGLPG 3526
            G RGP G  G+ G  G P T             VG  G  G+      G+PG  G  G  G +GP G   +                  G  G  GE G  G QG  GTKG  G  GF GT G+ G KG KG + E   KG          GD G+ G SG  GE                                        G+ G +G DGE G  G PG+       G  G PG KG  G PG  G  G  G+ G      +GL+G   + G+ G  G             +G   +      +G+ G  G  G PG  G  G  G+ GP G  G     G  G  GE G  G  G +G  G RG    PG KG+ G  G +G   ++G +G                      KG +G V G   G  GDPG      D    G PG+ G  G +G  G    K E   P G  GE+G  G  GT GFPG+                  +G +G +GE G +G +G  G    PG  G  G+      +G  G+ G           G +G KG +G  G  G  GE+G+ G  GT G+ G  G  GA G  G  G +GD+G +G PG         H  E ++G +G  G  GD G  GP G KG+        K          KG KG PG+ G+ GP    GP G  GI+GF G  G  G K                   ++G+ G  G+ G  G KGD G         +                STG KG  G+ G +G  G  G++G +G  G+ GT G  G DG  G  G +G  G+ G  G +      G PG KG PG+KG+         +G++G  GTD     GN  + G +GE G P       G+ G  GT GD G +GE+G  G     GP G+ G   + G +GD G  G  G+ G  G +G  GI    G +G  G+ G  G  GE+G++GD+G KG S        KG+ G PG+ G+ G +G QG     G +G+T            G   +   L G+ GP G                     D+G +G  G KGM G      + G  GE G+ G  G QGE+G RG+ G+PG
Sbjct:  381 GPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKG--------SAGDPGDPGHSGFPGEQ---------------------------------------GRPGIDGRDGEPGFRGPPGE-------GPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGG---------------------KGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGE-SGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGN------IGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNK------------------GSSGAYGRPGDSGIKGFKGDLG-------PTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGV---PGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPG 1435          

HSP 3 Score: 174.481 bits (441), Expect = 4.682e-43
Identity = 386/1284 (30.06%), Postives = 497/1284 (38.71%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVG--------------------LKGDIGCDGEPGTVGIDGKNGT-----HGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQG---INGTKGERGPKGFEGTMGVNGTKGSKGR----------------------------IGEKGLKGK--------------EANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGL-----------------EGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGP--DGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLI---------EGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDK---------------------GTTGFPGKNGTKGAKGENGTLGIKGKDG-----------TSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGT---DGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNG-TIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVG---SPGLKGYFGGKGVQGMPAKDGRRGNTGITAI---------GLKGDSG----PDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGE------KGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG----------------------DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGD 3724
            G  GFPG +G  G  G +G  G++GP G                    +KG++G  GEPG  G+  +         G  GK+G KGD+GD G      + T+ ++G  G  G +G   ++G  G RG  G  G  G NG KG  G                              G KG KG+              E   P+   G KG  G +G+ G   T  G         +          E+  +G  G  G PG  GK G  G+ GL                  G PG  G  G +GD G PG KG  G PG  G +G  G KG +G   + +++G  GD G                          G  G  G  G PG++G  G+ G +GP  +GP+G    KG                     + G PG  G+ G +G  G ++          G+ G  G +GR G  G       +G   +   V       GDPG     G+PG +G  GF G  G          PKG+ G  GDLGDK                     G  G+PG  G KG  G +G  G+ G  G           +S  PG+ G  G +G  GL G+ G  GY             G  G KG  GP G QGEQG PG PGT    GQ G  G  G  G  G  G  G +G  GEPGL     ++G  G  G  G  GN GP G++G                K   +G  GFPGK G  G  G +G KG                              +    G  G  G  G PG KGD G+ G  G   +I       +         G+ G+ G  G +G +GF G+ G  G+ G  G    +        KG +G  G+ G++GP       G+PG  GLPGI+G  G  G  G  G+  + G  G+ G  G  GD G TI   G  G  G+ G  G+TG     G  G+ GE+G +GL+G               IEG+ G +G  G+ G  G+ G QG  G QG KG S  PG+ G  G    PG KG+ G KG+ G+    G++GN G+            G KG+ G    P    G  G  G KG  G  G +GEIG  G  G QG+      KG +G  G PG +G  G  G  G  G     G KGDRG +G+ G                            KG+ G  G  G RGF+      G KGD
Sbjct:  183 GPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLG-----YLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDP------------------------GHSGFPGEQGRPGIDGRDGEPGFRGPPGEGPVGEPGAKG---------------------YSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECI----GDPGPPGESGLPGPRGLEGFPGVPG----------PKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMP------GMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKG-GQGMTGFPGKTGERGLKGFSGTKG------------------------------EIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVV--------KGVKGLPGEPGLEGPK------GMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTG---AKGLYGMPGERGSSGLDG---------------IEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGD 1333          

HSP 4 Score: 153.295 bits (386), Expect = 1.539e-36
Identity = 290/951 (30.49%), Postives = 375/951 (39.43%), Query Frame = 2
Query:  407 KGEQGFPGEMGHN---------------GTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHG-----TPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-------QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKN------------GTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGL------KGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTN--GVIGDRGDKGFSGEPGLHSNET-IQGLQGYKGIKGDKGNRGPSGEKGW--AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGN------NGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG 3091
            KG  GF G++G                 G  G +G +GY G  G+KG  G  G+PG  G  G  G HG     + G  GD G  G RG  G    G  G  G  G+ G  G+ G KGE GP G +G  G  G  G+ G  G+ G  G       I       + GD+GE G+ G  G      G   N                     G+ G IG PG  G+             G+ G +G+ G PG  G +G+KG  G  GE G PG  G +G  G  G KGDRGLTG        GDK    +I+ T    +             G  G  G++G+PG  G  G  G       +G DG  G   V  GV                    +G+PG  G+ G +G     + G TG                  + G +G+     G  GP+G+ G   + G PG  G +GFKGD G   +       +G  G  G  G KG  G PG+ G+ G  G  G  G +G+ GT   PG  G +G  GS G  G  G+ G    T                  G  G +G  G+ GI G DG  G  G  G  GT+  G  G+ G KG  GE G+ S  T + G  G+KG  GD GN+G  G++G    +     S +K  +      G+ GFPG  G+ G  G  G  GI                            G     G+VG+ G  G+ G++GD G               +        +   GDKG  G+ G  GR+GF   +G+RG  G  G TG  G  G  G KG               P     +PG +G PG  G+QG  G        G  G+   +G  G +G PG PG  G+ G RG  G MG +G        GE GTRG  G  G  G+ G
Sbjct:  662 KGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGL--TGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGA-IGDPGNI--------------------GVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPP------GDK---PVIHITPHMKEVMK----------GSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGV--------------------KGLPGEPGLEGPKG-----MPGPTG------------------LPGIEGF----PGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQ---------------GQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQ------GDYGFPGIKGIPGFPGTRGTPGI------------------------PSPFGAKGDRGNVGDFGLFGEKGVQGDRG--------------EKGSSGESGVSGRKGDKGEPGMMGFPGRRGF---QGDRGPFGPKGDTGPPGFPGLPGAKG--------------YPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGL------QGEQGTRGRPGMPGPLGMAG 1441          

HSP 5 Score: 145.206 bits (365), Expect = 3.969e-34
Identity = 243/763 (31.85%), Postives = 309/763 (40.50%), Query Frame = 2
Query: 1616 MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGK--DGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFS---------GEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKG--WAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGD---------------------RGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEV-GSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNG----TIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
             G++G +GDPG   + G+PG  G  G  G KG      E        G  GD GD G +GFPG+ G  G  G +G  G +G   +G   +PG KG  G  G +GL+G KG  G +                             +G+ G+PG DGQ G +G  G  G  G    RG   +S         G PG       +GL+G+ G+ G KG  G SG+ G                +     +G+ G+PG  GV GP G +G+ G+ G  G  G  G                        S G  G+ G PG +GD G+                          TGD G  G  G +G  G  GLKGE G  G  G  GR G  G  G  G                      RGD G+ G+ G       +G PG+ G+ G  G  GD+G  G  G     GL G +G  G  G  G  G+RG +G  G  G IG  G  G  G  G  G+KGD GL G  G +  +        E + G +G +G+ G  G  G +G +G  GI GG      PGE   V G  GL G  G +G +GMP   G  G  G   + G KG+ G  G  G  GD G KG  G    TI L G  G  G  G  G  G +G  G+PGER      G +G  G  G  G +G+ G +G  G D +    G  G KG  G+ G        G  G KG  G  G+ G  G 
Sbjct:  478 WGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAV----QKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPGEGPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGAT-------------------------KGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGE-------------------VFGASSGAPGDPGLPGHRGDTGL--------------------------TGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMK-EVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGER------GSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGL 1159          

HSP 6 Score: 133.265 bits (334), Expect = 1.946e-30
Identity = 259/863 (30.01%), Postives = 337/863 (39.05%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGI---------------------DGKNGTHGTPGKIGDKGDEGDRGPNG----TFSIGTRGDNGE---------------RGINGTQGINGTKGERGPKGFEGT---------MGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGE--NCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGE----KGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKG----TASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG--NVMGKEGPRGDPGDDS--SEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIP---GTDGQNGTNGEMGANGTNGVIGDRGD------------KGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNN 2755
            + G+ G PG  G  G  G  G  G  GP GL+G+ G  G PGT G                       G+ G  G PG IG +G +G  G  G    T +IG  GD GE               +G  G  G  G  GERG KGF GT          G  G  GS G+ G++GL G   +KP I      ++ M G  G+  N  D G +                      RG +G  GIPG  GK+G  GE    KG++G+PG+ GL+G K   G+PG  G PG  G  G  G  G+KG  G  G+  + G +G KG    T S+   T    + G  G  G+KG  G  G +GS G  G+ G  G  G  G  GP GS+ ++G                       G  G KG  G  G+ GT  I+G+ G                +G  G KG +G   + G++G +G PG D+    G PG KG+ G            E   P  + G  G LG KGTT   G +G KG  G+ G  G +G+ G S+       KG++G  G  G KG  G+                            G +G PGIP   G  G  G  G+ G  G  GV GDRG+            KG  GEPG+       G  G +G +GD+G  GP G+ G                  +  GE+G PG+MG+ GP G                             G  G  G    +G VG SG  G PG+                                 G  G+ G +G  G  G  GL+GE+G  G+ G  G +GM G +
Sbjct:  753 LTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGP--------------------RGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPK---GMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQG---------------------FPGSQGHKGRSGDPGQTGTTGIQGQPGQ---------------KGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELG------------ETGIPSTTTGVPGSLGHKGTT---GDSGNKGEIGQRGVPGPQGQQGFSDI------KGTQGDYGFPGIKGIPGF---------------------------PGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGM------MGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSG---------------------------RNGNPGPAGPPGDSGFVGPSGHKGMPGL--------------------------------PGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRS 1443          

HSP 7 Score: 103.219 bits (256), Expect = 2.641e-21
Identity = 310/1103 (28.11%), Postives = 401/1103 (36.36%), Query Frame = 2
Query:  959 QGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLP---------GEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDI--------GLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRG-----DPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDL---------GDKGTTGFPGKNGTKGAKGENGTL-------------------------GIKGKD-------------GTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMG-----------------ANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTK-GDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNC------------------------TSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTI-----GNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG-------------------GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT----------------AIGLKGDSGPDGDNGTIGDEGDKGMNGT---IGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGN----RGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +G  G+PG LG  G  G KG +G PG +G KG+KG+ G           G +G PG  G  G  G  G  G RG  G +   G RGD G                          G  G +G+ G PG+ G  GD           +G  GP G   + G                 G+ G+RG+PG +G +G +G  G    +GE   I                +KG KG  G + G+ GP G      P     +G  G  G +G KGD G  +TK E     G  G RG+          GD G  GFPG NG KG  GE G L                         G KG                T E  G +G +G KG++G  GE G                               +G  G  G PG+ G+ G  G+ G                  +G  G+ G+ G +G  G+PG      + G  G +G+ G KG +G        E   A  K  A +  D   G  GFPG+ G  G  G +GE G +G  G                             G VGE G  G  G  G  G+                           G KGN G +     +G  GL G+ G+ G +G TG  G  G+  ++ G +  I  + I  P  P  + G+PG +GL G  GV G +G  G  G+                           LG  G +G  G PG +G  G  G  G  G++G +     G  G  G  G RG TG  GD GL G              G+EG+ G  G+ G  G  G +GEQG  G  G  G                       G +G+ G PGL G  G KG  G P   G  GN G                    G KG  G  G  G  G+ G KG +GT   IGL G  G  G  G  G+KG RG TG PG++             K    G+KGD G +G+ G +            G  G+ GH G     +G K +    G +G KG  GP+G+ G  G+
Sbjct:   54 KGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGF---------------------PGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVG---------------PTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKI----------------LKGVKGELGEI-GEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGV-SGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKG--------ELMEAVQKGSAGDPGD--PGHSGFPGEQGRPGIDGRDGEPGFRGPPG----------------------------EGPVGEPGAKGYSGPPGRSGL--------------------------IGPKGNPG-QVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGES-GLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYF------------GMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDK----PVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGF 1020          

HSP 8 Score: 94.7449 bits (234), Expect = 9.743e-19
Identity = 180/598 (30.10%), Postives = 242/598 (40.47%), Query Frame = 2
Query:  446 GTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI------------GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG----TKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRG------LKGIKGDDGLPGEKGTPGR------PGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASI--INCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTT----GDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGD---------------PGDDSSEGVPGVKGKRGFKGDKGEAATKCELDC------------------------PKGSIG------------------ERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI 1954
            G+ G QG  G+ G  G +G  G  G  G +G+ G  G  G PG  G KGD G  GP G   +            G++GD+G  G  G  G  GTKG  G  G EG  G  G     KG KG  GE GL+G +    P    G +G  GMSG  G        SS  Y        K           + G  G+ G+ G  G+ G KGL G+PG+RG      ++G+KG  G PG  G PG       PG QG +G+ GD G  G TG   + G++G  G   I  ++               + G  G  G+KG +G  G+  TT    G +G KG  G  G++   G  G+PG  G +G    +G +G  G PG KG+ G  G  GT  I    G+                  KG++G  G+  + G++G +GD                GD    G+ G  G+RGF+GD+G    K +                           P G +G                  + G +G  G  G PG  G  G+ G  G  G  G  G   + G +GR G  G  G+ G    +GY+
Sbjct:  875 GSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKG-----SSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGA------------------KGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYL 1449          

HSP 9 Score: 91.6633 bits (226), Expect = 7.949e-18
Identity = 110/317 (34.70%), Postives = 141/317 (44.48%), Query Frame = 2
Query: 2855 GIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGN---TGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKT--GLPGERXXXXXXXXXXXXXXXXXXXN--KGDRGKIGEKGDS----VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G+K   G  G     G C      G RG PG  G  G  G +GR+GE G  G  G     GE+G  G  G KG  G+ G           G  G +GV G  G +G++GK G  G  G RGD G+              PG  G  GG+G  G P   G +G+     +     +GD GP G  G +G  GD G  G  G +G  G  G  G +G+KG R K   G+ GE G IG+ G  G   +     +  +G++GK+G KGD       STK + G  G  G RG   ++   G +GD G  G  G NG  G V
Sbjct:   31 GVKKSTGPCGGRDCSGGCQCYPEKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGM---KGEHGEAGFVGPKGSVGMEGV---------PGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGM--------------PGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDV 321          

HSP 10 Score: 89.7373 bits (221), Expect = 2.961e-17
Identity = 108/304 (35.53%), Postives = 135/304 (44.41%), Query Frame = 2
Query: 2633 DKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTI--------GNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGAR-----------GEQGIRGDQGIKGGSSP------GEKGEVGSPGLK---GYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEI 3460
            +KG +GL G  G QG  G KG +GE G  G  G  G  G  G  G +G +G +G+ G           G+ G+PG  G  G RG  G DG   + G  G  GFPG  G  GT G  G +GE GD   +        G+ GP G  G  G TG+ G  GL G                +G  G +G+ G+KG+ G R           GE G  G  G+   +SP      GEKG++GS G K   GY   K   G+    G RGN      GL G  GP GD G  G  G+ G  G +G  GE+
Sbjct:   53 EKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPG---------FNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLPG---------------FQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNP-----GLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGEL 327          

HSP 11 Score: 85.8853 bits (211), Expect = 4.943e-16
Identity = 224/826 (27.12%), Postives = 289/826 (34.99%), Query Frame = 2
Query: 1727 CELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGT------TGRIGMDGNNGTKGDRGD----------------------------IGQKG-------------------IQGPSNPNATMGIPGSKGLPGIKGVQGDRGNN-------GTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTI--------------------------GNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGG--------------------KGVQGMPAKDG-------------------RRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQ---------------GEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKI-----GEKGDS-VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            C+    KG+ G  G LG +G TG       KG +GE G              G KG KG  G  G VG KG +G       N                     G  G+PG PG  G  G  G  G NGT      RGD G  G PGL   E  QG  G+ G+KG+KG+                  ++   + +R +G+ G  G  G+ GP G  G +G+           G         +  +  +      G +GE GE G PG+                               S GDKG+ G    +   G  G  G RG  G +G       TG  G  GNNG KGD G+                             G+KG                   + GP  P    G  G  G PG    Q             G  G   SL    E  F G+PG  G  G  G++G  GD+G                            G  G  G+ GT+G  G  G  G  G  G +G  G       +G  G+ G  G  G  G +G  GI G  G  G   P  +G VG PG KGY G                     KG+ G+P  DG                   R G+     +   GD GP G++G  G  G +G  G  G +G  G +G +GD+               G  G RG  G PG +G  G  G++G+ G  G SG KG+ G++     G  GD  +   +GD G  G  G  G+  +    G  G KG+ GP G+ G  G
Sbjct:   48 CQCYPEKGARGLPGPLGPQGPTG------PKGRQGEPGLQ------------GPKGMKGEHGEAGFVGPKGSVGMEGVPGFN---------------------GADGVPGHPGPSGARGKAGPDGCNGT------RGDSGMPGFPGL---EGGQGTPGWPGMKGEKGD-----------------PLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGL----PGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGV------------FSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSL----EEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPGEGPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQG 788          

HSP 12 Score: 80.1073 bits (196), Expect = 2.617e-14
Identity = 194/643 (30.17%), Postives = 235/643 (36.55%), Query Frame = 2
Query:  653 ERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLG--SECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEA----------------------------------------------ATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTK-------------GAKGENGTL--GIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQ------GIPGIPGTD---GQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVG 2365
            E+G  G  G  G +G  GPKG +G  G+ G KG KG  GE G  G            KG  GM G  G N  D                                 G+PG  G +G  G+ G +G  G RG  G+ G  GL G +GTPG PG +GE      KGD       MER  RGD G A                       VG  G  G  G PG  G  G  GLKG  G  G  ++ +KG                +GE G  G PG  G+F +     +  +GE G +G +G KG+ G  + +   G  G+ G   G  G  G PG     G+PG  G  G KGD GE                                                   EL  P+G    RG  G  G TG PG   T+             G  G  G+L    KG  G   +PG  G+KG KG +GL     E             G+ G  G  G  G +GDQG+       G+PG PGT+   G  G  GE+      G  GD GD G SG PG      I G  G  G +G  G  GP GE G                    KG  G PG+ G+ GP G
Sbjct:   53 EKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGP-----------KGSVGMEGVPGFNGAD---------------------------------GVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGE------KGDPLEVWVYMER-FRGDPGPAGFPGI------------------VGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKG---------------VKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAG-ARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGP---RGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLC----ECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPG-EGPVGEPG-------------------AKGYSGPPGRSGLIGPKG 583          

HSP 13 Score: 73.559 bits (179), Expect = 3.030e-12
Identity = 91/262 (34.73%), Postives = 112/262 (42.75%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE------PGTVGIDGKNGTHGTPGKIGDKGD-----------EGDRGPNGTFSI-GTRGDNGERGINGTQGINGTKGERGPKGFEG--TMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKI 1132
            KG  G  G  G NG DG  G  G  G  G  G  GC+G       PG  G++G  GT G PG  G+KGD            GD GP G   I G  GD G RG+ G QG  G +G +G KG +G  T  + G KG  G IGE G  G  +    I    +GEKG  G  G+                                 +G++G      ++G  G  G  G PG  G  G +GD GLPG  G  GR G+ GE G++
Sbjct:   99 KGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGD---------------------------------KGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGEL 327          

HSP 14 Score: 70.0922 bits (170), Expect = 3.429e-11
Identity = 94/264 (35.61%), Postives = 112/264 (42.42%), Query Frame = 2
Query:  455 GQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGD---EGDRGPNGTFSI-GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRG--LKGIKGDDGLPGEKGTPGRPGE--------QGEQGKIGDKGDRGLTGKNMERGERGDKGTA 1204
            G +G  G  GP G  G  G  GEPG  G  G  G HG  G +G KG    EG  G NG   + G  G +G RG  G  G NGT+G+ G  GF G  G  GT G  G  GEKG   +     +   GD G  G  G  G                                   G  G+PG  G  G  G KG +G  G+R   LKG+KG+ G  GE G PG   +        QGE+GK+G KGD+G  G    + E G  G A
Sbjct:   55 GARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDP------------------------------GYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFA 288          

HSP 15 Score: 64.3142 bits (155), Expect = 1.583e-9
Identity = 98/279 (35.13%), Postives = 122/279 (43.73%), Query Frame = 2
Query: 1622 KEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCE-----LDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIG-------YINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANG-----TNGVIGDRGDKGFSGEPGLHSNET-----IQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGK---MGVAGPVGPNGEKG 2383
            ++G RG PG    +G  G KG++G  G +G    K E        PKGS+G  G  G  G  G PG  G  GA+G+ G  G  G  G S  PG  G +G +G+ G  G KGE G       Y+ R   +      G  G  G  GP GD G +G+PG  G  G  G  G  G  G       GV G+ G+ G  G PG+ S  +      QG +G  G KGDKG+ G            A S V        N G  G+PG     G+ G  G NG KG
Sbjct:   53 EKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGD-----PGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLG-------YLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKG 319          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Zebrafish
Match: si:ch211-196i2.1 (si:ch211-196i2.1 [Source:ZFIN;Acc:ZDB-GENE-091204-150])

HSP 1 Score: 185.267 bits (469), Expect = 2.114e-46
Identity = 385/1143 (33.68%), Postives = 487/1143 (42.61%), Query Frame = 2
Query:  473 GYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQN------------------GTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGD---------RGDIGQKGIQGPSNPNATMGIPGSK------GLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSK------------GKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            GY GP G KG  G  G PG  G  G  G  G P     +    D      F   +       G    QG+ G +GE G  G +G  G  G +G  GR+G+ G +G         +G  G  G+ G+DGEN  D  +  +                     GI G  G  G  G++G+ GEKG EGI G  G  G KG  G  G KG PG PG  G  G  G +G  GL G     GE G  G+  +                G+ G+ G IG++G+ G+ G  G +G +GL GP GP G E   G +G PG+ G  G  G EG  G +G PG  G  G  G  G   EG  G +               G  G KG+ G + G  GP GD GD   +G  G +G  G +G +GE      +  P G  G RG  G +G  G  G+ G  G  G+ G+ G +G +G S KPG +G KG  G  G  G  G  G           G+ G +G +G  G  G++G  G+ GIPG  GQ+                  G  GE G  G  G+ G +G  G  G PG      ++G  G+ G +G+ G RGP+G  G          V         +G +G PG  G  GP GP G  G+ G IGK G  G  G  G+ G  G  G  G    NG  G  GE G+ GM G                             S GD G  GL+G QG  G  GL G  G  G  G  G IG  G  G KGD          G  G  G +G S P    G PGSK      G PG  G++G  G+ G  G     G  G+ G  G PG  G +G  G +G  G  G  G  GPDG  G++G TG  G  G  G              G EG+ G +G+ G              G IG  G +G+ G +G KG   PG+KGE   PGL+G  G +GVQG P   G  G+ G    G++G  G  G  G +G  G  G  G  G +G+ G NG  G  G  GRRGK G  G R               G  G KG++G +GEKG  +    G +G +G RG  G + +    G +G+KGD+GP G  G  G
Sbjct:  259 GYPGPKGDKGAFGVRGRPGRPGFLGSPGPPGLPSFYLWRNTPEDW---AAFQQTSFFQLLLAGWPRAQGLPGPEGEMGKPGAQGPPGEPGERGPPGRMGDMGDRGP--------KGVVGRAGVYGRDGENGLDGPQGPS---------------------GIPGPKGPLGYKGESGSHGEKGEEGITGSEGPCGDKGKPGEKGSKGAPGAPGAVGPPGPQGIRGMEGLEGHPGPDGEDGMNGSPGLPGAP------------GAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLE---GQIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGIRGDPG--FEGLKGVL---------------GTPGPKGFTG-IKGNRGPDGDQGDIGPKGNKGARGAAGVQGIQGEQGP---IGFP-GFPGIRGPPGPQGNQGEDGEAGPHGKVGKEGSTGSRGPEGLSGKPGPRGLKGRTGQRGHTGMPGPPGLPGPPGPFGAEGKPGTQGLQGLVGNAGNKGSTGLQGIPGERGQDGPPGTMGPPGREGPMGSPGPPGERGFGGKTGMKGPQGPVGMYGFPG---TVGMRGRPGHTGDRGEPGPRGPTGPIGKTGVPGPPGPVGEKGLPG-PQGRQGDPGHQGTDGPCGPPGRHGVSGVIGKPGPRGSIGPPGEPGPSGPPGIPGPQGENGVPGIDGEKGEKGMMG-----------------------------SPGDDGPLGLEGQQGLTGPAGLDGAPGRKGDKGDRGPIGTSGLQGPKGDIGPVGDKGPPGPPGLVGNEGDSGPAGVAGDPGSKGEKGDIGPPGFTGLEGPWGDTGEQGEKGIKGAKGQIGMQGEPGLVGGVGHPGLKGAEGVPGHPGLVGPDGPAGSKGKTGPSGSPGEPGN------------PGPEGIAGPKGVRGDTGKGGTQGGVGLVGPIGPLGPKGLSGPEGEKG--EPGDKGE---PGLEGPDGLQGVQGPPGLPGLEGSQG--EAGMRGPPGLPGAQGGVGKPGPDGREGMKGEKGDQGKNGAPGKLGHIGRRGKRGKAGLR------------ATRGPRGEKGEKGDVGEKG--LPGWGGSMGIQGPRGEPGDEGVK---GAEGEKGDQGPFGSPGRDG 1263          

HSP 2 Score: 163.696 bits (413), Expect = 1.043e-39
Identity = 352/1125 (31.29%), Postives = 461/1125 (40.98%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG------------IPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIG------LKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGK------------------------RGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGI---------------KGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW-----------AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNA---------TMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIG------------------DEGDKGMNGTIGLEGEIGNNGTIGDQGEKG 3499
            G QG PGE G  G  G+ G MG RGP G+ G  G  G  G  G+DG  G  G PG  G  G +G+ G        + G+ GE GI G++G  G KG+ G KG +G  G  G  G  G  G +G++G E +      G  GE GM+G  G              G+ G  G  G  G +G  G +GE G  G +G  G  G +GLEG            + G  GL G KG+ G  G  G  G PG +G +G +G  G +G TG    RG  GD+G                       G  G  G++G+ G  G+ G  G IG      ++GP GP G++   G  G  G++G +G  G+ G +G  G PG +G+ G+ G+ G             G  G  G +   G +G +G  GN        G+ G    +G+PG +G+                        RGF G  G       +  P+G +G  G  G  G  G PG  G +G  G  G  G                KG  G   + G+ G +G+ G  G  G  G  G I +     + G  G+ G  G PG  G QGE G+PGI   DG+ G  G MG+ G +G +G  G +G +G           GL G  G KGDKG+RGP G  G             +       +  NE      G  G PG  G  G +GP G  G+                                  G  G++GE G+ G+KG +G                            G  G+ GLKG +G  G  GL G  G  G  G TG  G  G  G  G  G  G KG++G +              +G  G KGL G +G +G+ G+ G  G     GL G +G PG PG  G+ G+ G RG  G  G  G  G  G +G  G+ GEKGD G NG                 G +G  G  G +GK G R  +G RG++G        EKG+VG  GL G+ G  G+QG   + G  G  G  A G KGD GP G  G  G                  D+G+ G +G  G  G  G  G  GD+G KG
Sbjct:  336 GAQGPPGEPGERGPPGRMGDMGDRGPKGVVGRAGVYGRDGENGLDGPQGPSGIPGPKGPLGYKGESG--------SHGEKGEEGITGSEGPCGDKGKPGEKGSKGAPGAPGAVGPPGPQGIRGMEGLEGHP-----GPDGEDGMNGSPG------------LPGAPGAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLEGQIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGIRGDPGFEGLKGVLGTPGPKGFTGIKGNRGPDGDQGDI---------------------GPKGNKGARGAAGVQGIQGEQGPIGFPGFPGIRGPPGPQGNQGEDGEAGPHGKVGKEGSTGSRGPEGLSGKPGPRGLKGRTGQRGHTGMPGPPG--LPGPPGPFGAEGKPGTQGLQGLVGNA-------GNKGSTGLQGIPGERGQDGPPGTMGPPGREGPMGSPGPPGERGFGGKTG-------MKGPQGPVGMYGFPGTVGMRGRPGHTGDRGEPGPRGPTGPIGKTGVPGPPGPVGEKGLPGPQGRQGDPGHQGTDGPCGPPGRHGVSGVIGKPGPRGSIGPPGEPGPSGPPGIPGPQGENGVPGI---DGEKGEKGMMGSPGDDGPLGLEGQQGLTGP---------AGLDGAPGRKGDKGDRGPIGTSGLQGPKGDIGPVGDKGPPGPPGLVGNEGDSGPAGVAGDPGSKGEKGDIGPPGFTGL---------------------------------EGPWGDTGEQGEKGIKGAKG-----------------QIGMQGEPGLVGGVGHPGLKGAEGVPGHPGLVGPDGPAGSKGKTGPSGSPGEPGNPGPEGIAGPKGVRGDTGKGGTQGGVGLVGPIGPLGPKGLSGPEGEKGEPGDKGEPGLEGPDGLQGVQGPPGLPGLEGSQGEAGMRGPPGLPGAQGGVGKPGPDGREGMKGEKGDQGKNGA---------------PGKLGHIGRRGKRGKAGLRATRGPRGEKG--------EKGDVGEKGLPGWGGSMGIQGPRGEPGDEGVKG--AEGEKGDQGPFGSPGRDGIKGSLGPLGPPGPPGPKGDQGNIGPSGPRGTPGIPGLPGLFGDKGLKG 1311          

HSP 3 Score: 162.155 bits (409), Expect = 2.495e-39
Identity = 358/1078 (33.21%), Postives = 457/1078 (42.39%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGL---KGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRG----PNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGE---QGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGS---IXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW-----------AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNA---------TMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG 3526
            +G +G  G  G  G DG+ G  G +GP G+   KG +G  GE G+ G  G+ G  G+ G  GDKG  G++G    P    ++G  G  G RG+ G +G  G  GE G  G  G  G  G  G  G IG +G  G      P    G  G +G  G +G+      R      G  GL G +G  G  G  GI+G+ G  G  G  GT G KG  GI G+RG  G +GD G  G KG  G  G    QGEQG IG  G  G+ G    +G +G+ G A                  G  G VG+ GS GS G  GL+G  G  GLKG  G       +G  G+PG  G  G  G  G +G  G  G +G+ G  G  G+     I GE G     G  G  G +G   + G  GE+G+ G   G +GP+G  G     G  G++G+ G  GD+GE         P+G  G  G  G  G  G  G+ G  G +G  G  G +G DG    PG        G +G++G+ G  G I         G  G  G +G              G+PG DG+ G  G MG+ G +G +G  G +G +G           GL G  G KGDKG+RGP G  G             +       +  NE      G  G PG  G  G +GP G  G+                                  G  G++GE G+ G+KG +G                            G  G+ GLKG +G  G  GL G  G  G  G TG  G  G  G  G  G  G KG++G +              +G  G KGL G +G +G+ G+ G  G     GL G +G PG PG  G+ G+ G RG  G  G  G  G  G +G  G+ GEKGD G NG                 G +G  G  G +GK G R  +G RG++        GEKG+VG  GL G+ G  G+QG   + G  G  G  A G KGD GP G  G  G +G  G  G  G  G  G+ G IG  G +G  G  GLPG
Sbjct:  359 RGPKGVVGRAGVYGRDGENGLDGPQGPSGIPGPKGPLGYKGESGSHGEKGEEGITGSEGPCGDKGKPGEKGSKGAPGAPGAVGPPGPQGIRGMEGLEGHPGPDGEDGMNGSPGLPGAPGAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLEGQIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGIRGDPGFEGLKGVLGTPGPKGFTGIKGNRGPDGDQGDIGPKGNKGARGAAGVQGIQGEQGPIGFPGFPGIRGPPGPQGNQGEDGEA------------------GPHGKVGKEGSTGSRGPEGLSGKPGPRGLKGRTG------QRGHTGMPGPPGLPGPPGPFGAEGKPGTQGLQGLVGNAGNKGSTGLQGIPGERGQDGPPGTMGPPGREGPMGSPGPPGERGFGGKT-GMKGPQGPVGMYGFPGTVGMRGRPGHTGDRGEPG-------PRGPTGPIGKTGVPGPPGPVGEKGLPGPQGRQGDPGHQGTDGPCGPPGR------HGVSGVIGKPGPRGSIGPPGEPGPSGPPGIPGPQGEN------------GVPGIDGEKGEKGMMGSPGDDGPLGLEGQQGLTGP---------AGLDGAPGRKGDKGDRGPIGTSGLQGPKGDIGPVGDKGPPGPPGLVGNEGDSGPAGVAGDPGSKGEKGDIGPPGFTGL---------------------------------EGPWGDTGEQGEKGIKGAKG-----------------QIGMQGEPGLVGGVGHPGLKGAEGVPGHPGLVGPDGPAGSKGKTGPSGSPGEPGNPGPEGIAGPKGVRGDTGKGGTQGGVGLVGPIGPLGPKGLSGPEGEKGEPGDKGEPGLEGPDGLQGVQGPPGLPGLEGSQGEAGMRGPPGLPGAQGGVGKPGPDGREGMKGEKGDQGKNGA---------------PGKLGHIGRRGKRGKAGLRATRGPRGEK--------GEKGDVGEKGLPGWGGSMGIQGPRGEPGDEGVKG--AEGEKGDQGPFGSPGRDGIKGSLGPLGPPGPPGPKGDQGNIGPSGPRGTPGIPGLPG 1302          

HSP 4 Score: 144.436 bits (363), Expect = 7.955e-34
Identity = 320/1050 (30.48%), Postives = 422/1050 (40.19%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGP---------KGFEGTMGVNGTKGSKGRIGEKGLKGKEANK----PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGD------------------------------IGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE----GETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKR-----GFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXD---QGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVA---------------------GPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGM 3316
            I+G +G  G  G +G DG  G        GL G  G  G  G +G  G NG+ G PG  G  G  G +GP G    IG  G  G  G++G +G++G KGE GP          GFEG  GV GT G KG  G KG +G + ++    PK  +G +G  G+ G  GE                                 QG IG PG           G+ G PG +G +G  G+ G  G+ G  G  G +G +G  G  G RGL G+  +RG  G  G   +         +G  G +G +G VG  G+KGS G  G+ G  G                                G+KGP GP+G                             G PG  GM G+ G  G   E    G TG IG+ G  G  G    +G+ G +G  G+    G +GP G PG     GV G  G R       +                G  G  G+ G+KG  G PG +G  G +G+ G  G  G DG   + G+KG +G  G++GL G KG+IG +         G  G +G+ G  G  GD   +GE+G  G PG  G  G  G+ G  G  G+ G +G  G  GEPGL       GL+G +G+ G  G  GP G  G           K       + GE G PG  G+A                     GP+GP G KG+                              +   G  GE G+ G+PG++G +G+                           G +G  GL G +G QG  G++G  G  G  G  G+ G DG  G KG++GD G+ G  G       +G  G +G  G++  +G RG  G  G+      +GE+G PG     G++G +G RGE GD             G +G  GEKGD G  G+                   G  GI GS G +G  G  G +GDQG  G S P  +G  G PGL G FG KG++G 
Sbjct:  448 IRGMEGLEGHPGPDGEDGMNGS------PGLPGAPGAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLEGQIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGIRGDPGFEGLKGVLGTPGPKGFTGIKGNRGPDGDQGDIGPKGNKGARGAAGVQGIQGE---------------------------------QGPIGFPGF---------PGIRGPPGPQGNQGEDGEAGPHGKVGKEGSTGSRGPEGLSGKPGPRGLKGRTGQRGHTGMPGPPGLPGPPGPFGAEGKPGTQGLQGLVGNAGNKGSTGLQGIPGERGQDGPPGTMGPPGREGPMGSPGPPGERGFGGKTGMKGPQGPVG---------------------------MYGFPGTVGMRGRPGHTGDRGEPGPRGPTGPIGKTGVPGPPGPVGEKGLPGPQGRQGDPGHQGTDGPCGPPGRHGVSGVIGKPGPRGSIGPPGEPGPSGPPGIPGPQGENGVPGIDGEKGEKGMMGSPGDDGPLGLEGQQGLTGPAGLDGAPGRKGDKGDRGPIGTSGLQGPKGDIGPVGDKGPPGPPGLVGNEGDSGPAGVAGDPGSKGEKGDIGPPGFTGLEGPWGDTGEQGEKGIKGAKGQIGMQGEPGLVGGVGHPGLKGAEGVPGHPGLVGPDGPAG----------SKGKTGPSGSPGEPGNPGPEGIAGPKGVRGDTGKGGTQGGVGLVGPIGPLGPKGL------------------------------SGPEGEKGEPGDKGEPGLEGPDGL--------------------------QGVQGPPGLPGLEGSQGEAGMRGPPGLPGAQGGVGKPGPDGREGMKGEKGDQGKNGAPGKL---GHIGRRGKRGKAGLRATRGPRGEKGEKGD------VGEKGLPGW---GGSMGIQGPRGEPGD------------EGVKGAEGEKGDQGPFGS------------------PGRDGIKGSLGPLGPPGPPGPKGDQGNIGPSGP--RGTPGIPGLPGLFGDKGLKGF 1312          

HSP 5 Score: 114.005 bits (284), Expect = 1.376e-24
Identity = 256/832 (30.77%), Postives = 331/832 (39.78%), Query Frame = 2
Query: 1619 GKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPK-GSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPG------IPGTDGQNGTNGEMGANGTNGVIGDRG---DKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW--------AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERG---FPGTPGDNGTIGDRGRRGE------------------------MGDNGTIGNTGPDGENGTRGLTGEKG------------------------DAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSS-------------PGEKGEVGSPGLKGY------FGGKGVQGMPAKDGRRGN---------------------TGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G  GP+GD G     G PG  G  G  G  G  +     + P+  +  ++         G+P   G  G +GE G  G +G       PGE G +G  G  G +G++G  G + R             G  G  G  G QG  GIPG        G  G +G  GE G  G+ G  GD+G   +KG  G PG        G QG +G++G +G+ GP GE G         A      + +   +  + ++GE G  G +G+ GP GP G +G                     + G  G++G    +G  G  G  G+PG  G  GI                           GD G +GLKG  G  G KG  G +G  G +G  G IG  GN   KG RG  G +GIQG   P    G PG +G PG +G QG+ G  G  G     G  G RG     G PG  G  G  G+RG                          G  G +GN G  G  G +G+ GE+G                        + G  G  G++GP G  G+ G  G +G RG     G  G RGE G RG  G  G +              PG +G  G PG +G        G  GV G+  K G RG+                      G+  I    G KG  G  GD+G +G EG +G+ G  GL+G  G  G   D+G++G  G +GL G +G IG  G  G  G  G  GN+GD G  G  GD      KGDIG  G  G  G        G+KG KG +G  G+ G  G V
Sbjct:  259 GYPGPKGDKGAFGVRGRPGRPGFLGSPGPPGLPSFYLWRNTPEDWAAFQQTSFFQLLLAGWPRAQGLPGPEGEMGKPGAQGP------PGEPGERGPPGRMGDMGDRGPKGVVGRAGVY---------GRDGENGLDGPQGPSGIPGPKGPLGYKGESGSHGEKGEEGITGSEGPCGDKGKPGEKGSKGAPGAPGAVGPPGPQGIRGMEGLEGHPGPDGEDGMNGSPGLPGAPGAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLEG---------------------QIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGI--------------------------RGDPGFEGLKGVLGTPGPKGFTGIKGNRGPDGDQGDIGPKGN---KGARGAAGVQGIQGEQGPIGFPGFPGIRGPPGPQGNQGEDGEAGPHGKVGKEGSTGSRGPEGLSGKPGPRGLKGRTGQRGHTGMPGPPGLPGPPGPFGAEGKPGTQGLQGLVGNAGNKGSTGLQGIPGERGQDGPPGTMGPPGREGPMGSPGPPGERGFGGKTGMKGPQGPVGMYGFPGTVGMRG---RPGHTGDRGEPGPRGPTGPIGKTGVPGPPGPVGEKGLPGPQGRQGDPGHQGTDGPCGPPGRHGVSGVIGKPGPRGSIGPPGEPGPSGPPGIPGPQGENGVPGIDGEKGEKGMMGSPGDDGPLGLEGQQGLTGPAGLDGAPGRKG---DKGDRGPIGTSGLQGPKGDIGPVGDKGPPGPPGLVGNEGDSGPAGVAGDPGSKGEKGDIGPPGFTGLEGPWGDTGEQGEKGIKGAKGQIGMQGEPGLV 1019          

HSP 6 Score: 107.071 bits (266), Expect = 1.594e-22
Identity = 155/391 (39.64%), Postives = 195/391 (49.87%), Query Frame = 2
Query: 2630 GDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD---IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT----AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIG---DQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G+KG KG+ G+ G  G  GL+G      Q G TG  G+DG  G KGD+GD   IG  G+QGP      +G  G  G PG+ G +GD G  G  G+  S G  G+ G PG  G  G  GD G +GE G  G  G  G  GE G   L G  G  GL G                EGV G  G+ G  G  G++G+ G  G        SPGE G   +PG +G  G KGV+G   K G +G  G+      +G KG SGP+G+ G  GD+G+ G+ G  GL+G  G  G  G    QGE G RG  GLPG +G +GK G  G  G  G    KGD+GK G  G       G IG++G RG  G ++     G+KG+KGD G  G+ G  G +
Sbjct:  882 GEKGEKGMMGSPGDDGPLGLEG------QQGLTGPAGLDGAPGRKGDKGDRGPIGTSGLQGPKGDIGPVGDKGPPGPPGLVGNEGDSGPAGVAGDPGSKGEKGDIGPPGFTGLEGPWGDTGEQGEKGIKGAKGQIGMQGEPG---LVGGVGHPGLKGA---------------EGVPGHPGLVGPDGPAGSKGKTGPSG--------SPGEPG---NPGPEGIAGPKGVRGDTGKGGTQGGVGLVGPIGPLGPKGLSGPEGEKGEPGDKGEPGLEGPDGLQGVQGPPGLPGLEGSQGEAGMRGPPGLPGAQGGVGKPGPDGREGMKG---EKGDQGKNGAPG-----KLGHIGRRGKRGKAGLRATRGPRGEKGEKGDVGEKGLPGWGGSM 1229          

HSP 7 Score: 90.1225 bits (222), Expect = 2.200e-17
Identity = 128/355 (36.06%), Postives = 161/355 (45.35%), Query Frame = 2
Query: 2750 NNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGE---QGIRGDQGIKGGSSP-GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHR------GNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            N G  G +GD G  G++G       +G PG  GLP    +  +   +      TS   +   G+P   G  G        GEMG  G  G  G  GE G  G  G+ GD G  G +G  G  GR G  G++G  G  GI G KG +G +GE    G +G++GI G   P G+KG+ G  G KG  G  G  G P   G RG       GL+G  GPDG++G  G  G  G  G  G  G IG  G  G +GE G  G  GLPG +G  G +G  G  G+ G  G  G  G  G KG+         +GD G +G +      G +GF  I    G  GD+GD GP G  G  G  
Sbjct:  257 NAGYPGPKGDKGAFGVRGRPGRPGFLGSPGPPGLPSFY-LWRNTPEDWAAFQQTSFFQLLLAGWPRAQGLPGP------EGEMGKPGAQGPPGEPGERGPPGRMGDMGDRGPKGVVGRAGVYGRDGENGLDGPQGPSGIPGPKGPLGYKGESGSHGEKGEEGITGSEGPCGDKGKPGEKGSKGAPGAPGAVGPPGPQGIRGME-----GLEGHPGPDGEDGMNGSPGLPGAPGAPGWTGLIGAQGANGSRGEPGPSGAVGLPGPQGPQGLEGQIGPPGQRGPPGLSGREGLHGPKGEPGPVGPVGIRGDPGFEGLKGVLGTPGPKGFTGIKGNRGPDGDQGDIGPKGNKGARGAA 599          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 209.149 bits (531), Expect = 1.601e-53
Identity = 403/1200 (33.58%), Postives = 510/1200 (42.50%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVG----------------LKGDIGC-DGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF----SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN---KPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGP--DGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRG------------DPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP----------KGSIGERGDLGDKGTTGFPGKNGTKG--------------AKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGR-----RGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXI--EGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            G  GFPGE G  G  G  G +  +GP G                +   I C  G+PG  G+ G  G +G  G+ G KGD+GD  P+         G  G  G  G  G  G+ G KG+RG  G++G  G  G +GS G +G  G KG+      +P+++ GDKGE G+ G  G      GR                        GI G+ G+PG  G  GT G KG +G+PGDRG  G  G+ G PG  GT G  G  GE+G+ G  G  G+ G    +GE G     +II  T      G  G  G  G  GE GS G  G PG  G  G+ GL G    GP G +  +G                       G PG  G  G +G +G   + G+ G                   KGE G     +G  GP+G            D G+  + GVPG +G  G  G  G       +  P           G  G++G  G +G +GFPG  G KG               KG+ G +G  G  G +  PG+ G  G +G  G  G KGE+G +    +                      G+ G PG PG  G+ G  G  G  G +G  G +G+KG     GEPG  S    + ++G KG KG++G  G SGEKG   D  +              G  G  G+ GV G  GP GEKG                      +G +G QG     GS+GE G  G  G KG  GI G  G+ G+ G KGEKG +G  G    G  G  G+KG+ GR G  GL GERG+ G  G  G  G  G+ G  G  G  G  G+ G      T G+    G+PG KG+ GD G  G  G+    G  G  G PG+PG+ G  G  GR      GE G+ G+ G+ G  G  G  G+ G KGD GL G  G +GP G  G  GI  EG  GE+G  G  G  G+ G  G+ G  G  G    GEKGE G PG  G+ G KG  G     G  G +GIT        G  GD G  G  G  G+ G++G+ GE G+ G   DQG  G +G  G PG                   +  KG+ G+ G +G S       +   KGD G  G  G  G   I   HG  G KG+ GPSG  G TGY
Sbjct:  382 GPPGFPGERGEKGQHGLPG-LALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLK-GDKGESGLPGHPGA----PGREGR--------------------PGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT-GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGK----AIIK-TGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQG---------------------MPGTPGQAGFPGPQGVDGLPGLRGDPGP------------------KGEPG-----LGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSI---------------------GQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSP-------------GTPGKDGQQGVQGESGPKGEKG---------------------SQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGL---VGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIK--GEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGIT--------GQKGDTGPPGIPGFPGLKGSLGISGEKGDRG---DQGITGPKGDLGPPGP--------------AGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGY 1420          

HSP 2 Score: 192.586 bits (488), Expect = 2.319e-48
Identity = 107/276 (38.77%), Postives = 145/276 (52.54%), Query Frame = 2
Query: 4598 TKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI---QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            T G++G+ G SGPTG    G  G  G+ G+PG  G+ G  +  +    L  RH Q     +T +CP GT  + +GYS +   GNE     DLG+  SCL KFS  P + C+    C+F  RN  SYWLS+  P+     P+  + +K  ISRC VC  PA V A H Q T+Q   CP+ W  LW GYS +M TS    GS Q  +SPGSCLE  R  P IEC+     C+ + +   ++L  +     F KP   T     +L   +SRC+VC++ 
Sbjct: 1402 TPGQKGETGPSGPTGQT--GYPGPPGSDGLPGPIGLPGSPSMAHG--FLVTRHSQT---TETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQ-TIQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGT-CNYYANTYSFWLATIEKNEMFKKPTPSTL-KAGDLRTHVSRCQVCMRR 1667          

HSP 3 Score: 190.274 bits (482), Expect = 1.160e-47
Identity = 403/1214 (33.20%), Postives = 517/1214 (42.59%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHG---------TPGKIGDKGDEGDRGPNG----TFSIGTRGDNGERGINGTQGI------------------------NGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP------KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGI------------------------------PGKLGKNG-----TDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRP-----GEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVM---------GKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW----AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLT---GEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEG 3739
            KG+ G PG  G  GT G  G  G+ G  GL G  G DG PG  GI G NGT G          PG IG  G  G  GP G       I      GE+G  G  GI                         G+ G  GPKG  G +   G KG +G  G  G   K + +P      ++  G+KGEKGM G++GE     G+    +KG  G  G  G +G+ G+ G QGE G+                              PG +  NG       G++GL G PG +G KG+KG  G PG  G+PG P     G  G  G+ G+KG  GL G  ++    G KG                      +   G+ G  G  GNPG NG  G+ G KG     G  C    +  PG  G  G +G  G++G  G+PG KG             G  G  G  G  G +G     G  G KG  G V          G+ G  G PG    EG PG+ G++G  G KG A T                +G KG  G PG  G+ G  GE G  G  G  GTS  PGEKG  G  G  G+ G  G  G   +  A I  G  G  G  G PG  GDQGE+G PG PG  G  G  GE G  G  G  G  G+KGF G PG        G QG  G+ G +G+ GP GE G      +                N G  G PG+ G +G  G  G KG       +  + G             G +G+  ++G  G SG  G  G+KG+ G  G  G         +          +TG  G  G  G +G  GF G KGE G +G  G+ G+ G  G+ G  G++GD G              G PG  G PG KG +G+ G  G  G  +       +G  G  G+ G IG  G +G +GD G+ G  G DG+ G +G +   GEKG  G+ G+ GL+G  G  G  G+ G  GE+G +G  G  G+ G  GI+G++G+KG       G  G PG+KG  G  G  G+P + G +G+ GI  +    G KG +G  G  G+ G  G+KG  GT GL G  G  G  GD G +G  G +G  GE             G  G  G+ G++G+ G  G  +    G+ G+KG +G+ GF       G  G KGD+G
Sbjct:   71 KGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMG-ISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGER----GQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQ----GPKGR-DGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDK---GDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKG-----------DRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGT----------------IGAKGEQGLPGDRGSPGNPGERGFPGPAG-TGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGK--AIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV-GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKG-------EAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAG------------PFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEP------------GYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQG 1209          

HSP 4 Score: 176.407 bits (446), Expect = 1.781e-43
Identity = 368/1201 (30.64%), Postives = 484/1201 (40.30%), Query Frame = 2
Query:  593 DEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGT-----DGEKGLEGIPGDRGLKGIKGDDG-----------LPGEKGTPGRPGEQGEQGKIGDKGD--RGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----------------IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG---------VKGKRGFKGDKGEAATKCELDCP----KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIK-------GKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL-----------------------HSNETIQGLQGYKGIKGDKGNRGPSGEKGWA----EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXX----XXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIG------MDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGL------MGERGFPGTPGDNGTI---------------GDRGRRGEM--------GDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXI---EGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTI--------------------GDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
              G  GP G   I   G  GERG  G  G    K    P+G E      G KG KG  GE G +G+     K ++G+ G  G  GK G++     +      G  G  G  G  G KGE+G  G  G PG +  NG       G++GL G PG +G KG+KG  G           LPG  G PG PGE+GE+G+ G  G   +G  G++   G  G  G    I+ +                  G+ G  G  GNPG NG  G+ G K   G  G  C    +  PG  G  G +G  G++G  G+PG KG  G  G +G                   +GE G +  E R            KGE G  G+  G  G  G PG D  +G+PG          KG++G  GD+G      E   P     G+ G  G+ G+ G  GF G  GT GAKGE G   IK       G  G    PG++G KGS G  G  G +GE G                          G  GE+G  G+PGT GQ G  G  G +G  G+   RGD G  GEPGL                            + G QG+ G+ G  G++G +G  G               K  +     +G  GFPG  GV G  G  G  G+     K                          + G  G +G  G+PG  G EG+ G  G  G +                   + G+KG+ G  G  G  G+ G KGE+GE G  G  G++       M G+ G KG+RG+IG  G +G      + G PG  G  G++G  G +G  G+ G   S GL      +GE G PG  G+ G                 G++G +GE+        G  G  G+ G DG +G  G  G+KGD G+ G  G  G  G  G  GI    G+ GE+G  G+ G +G  G++G+ GD G++G   PG  GE G PG           G+P   G +G  GI   GL G  G  G+ G+ GD G  G  G  G+ G  G+ G                      G +GEKG+ G+ G PG                     + G  G  G  G   +  KG+ G++G  G  GF+      G++G  GD GPSG+ G  G
Sbjct:  202 SHGAPGPKGEMGISFYGPKGERGDRGPPGAP-CKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKS-------------GQPGDPGLPGNPGQNGFQGERGQK---GDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGD--------KGESGLPGHP-GAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYP----------------GPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGL---RGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNI-------------------GSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQG--PPGHSGEKGEPGY---------DGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPG---------------------SPGPVGLPGHTGQ--DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKG 1304          

HSP 5 Score: 175.252 bits (443), Expect = 3.658e-43
Identity = 419/1266 (33.10%), Postives = 532/1266 (42.02%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKG----LKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGI--------------PGKLGKNGTD-----------GEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNM---------------ERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL-----------------DCPKGSIGERGDLG---------------DKGTTGFPGKNG----------TKGAKGENGTLGIKGKDGTSEKP---GEKGRKGSKGSNGLVGEKGEIGYINR--TAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMG-------------ANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGV------AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSS---TGDKGNKGLKGNQGRQGFKGL-----KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMG--DNGTI-GNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPA------------KDGRRGNTGITAIGL------KGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRG--NRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            KGE+G PG  G  G  G QG  G  GP+G KGD G  G PGT G  G  G+HG PG  G                G  G +G  G +G  G NGTKG+RGP G  G  G+ G  GS G+ G KG    + G + +        KGEKG  G +G   T     +    G  G  G  G  G  G  G +GE+GI              PG   K  T+           GEKG +G+PG+ G +G  G     GEKG PG  G +G+ GK GD+G++GL G                  E+GE G +G   I+                      E+  KG  G PG  G+ GD GLKG  G  G     G                 G  G  G PG +G  G+ G  G  ++G  G  G  G  G  G   A           ++  K G  GDPG   + G  G +G+RG KGDKG+A   C+L                     G  G +GD G                 G  G PG  G           KG KGE+G  G  G  G   +P   G++G  GSKG  G +G KGE G      +  N            G  G  G++GE G+PG  G  G  G  GE G               G  G  GD+G+KG  G PG   ++  +G  G  G+    G  GPSGEKG+             +      G+ GFPG  GV       G  GP GE G+    G  G  G +G  G  G  G++G  G +   G  G SG  G PG KG+ GI G  G  G  G  G         +     +G  G  G+KG +G  GF GL     KG++G IG  G TG  G+ G  G  G     G  G  GP      MG+PGS G PG  G  G  G  G  G     G  G  G+PGT G+ G  G RG  G+M   D  T+ G+ G  GE G  G++GEKG  G  G+             G  G  G++G+ G  G  G +G QGI+G QG++     G+KG +G  GL G  G KG  G+              + G +G  G+  IG+      KGD+G DG +G  G+ GDK   G +G+ G  G  G+ G  G  G  G  GLPGE+GA G  G+ G  G+ G +G+ G +G  G  G+      +   G  G+KG  G   RG       HG+KG KGD G  G  G +G 
Sbjct:   41 KGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLP--------------GIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSM------IKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQS-FKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI----------------EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPG-------------VPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDT--------SIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV----GYPGPSGEKGF-------------QGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKE---GLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAG---PFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGS------------PGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQ-----GQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDK---GDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGV 1201          

HSP 6 Score: 174.481 bits (441), Expect = 6.395e-43
Identity = 309/989 (31.24%), Postives = 401/989 (40.55%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGP--VGLKGDIGCDGEPGTVGIDGKNGTHGTPGKI-------------------------------GDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGR--IGEKGLKG-KEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPG-----------KLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNG------------------TKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG------FSGEPGLHSNETIQGLQGYKGIKGDKGN---RGPSGEKGWAEDCNATSKVKANEFKDR-NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKG---LKGERGEIGQNGTTGR------------------IGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIP-GSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAG 3082
            KGEQG PG+ G  G  G++GF G  G    GL G+ G  G PG VGI G  G  G PGK                                G  G +G++G  G   +G  G +GE+G  G  G  G  G  GP+G +G  G+ G  G KG   +G  G KG +    P    GDKG  G SG  GE          F         K  +          G +G+PG             G+ G+ G +GL G PG  G+KG +G  G PG       PG +G++G IG  G  G TG   + G  G +G                      KG +G +G  GSIG PG  G+ G +G KG  GP G   +                         G PG KG  G+EG     + GE G +    ++  KG       KGEKG  G + G  G +G  GD  S G PG  G++G +G+ G    K      KGS G +G  G  G  G PG  G                   KG KG  G +G+ G  G    PG KG  G  G +GL GE+G                              D+G+ GIPG+PG  G  G  G  G  G+ G+ G++G KG        G+ GL  +  +QG  G+ G KG+ G     G  GEKG A            E  ++ +KG+ GFPG  G++G  G  G++G+ GF G  G  G  G +G   E             G  G+ G+ G PG  G  G+ G  G                  +   G+KG +G  G  G QGFKG    +G  G+ G +G TG+                  +G+ G  G +GD+G  G KG  GP  P  T  +  G  G PG +G  G RG  G  G     G+ G  G PG  G  G  G  G++GE G +G  G TG  G  G+ GL G  G  G
Sbjct:  581 KGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQ--------GFSGVPGHPGHKGEA----------GIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLD----MPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPG---------------PKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGIS------------------------GYPGTKGEKGEEG-----LRGEPGKMSETDKETMKGS------KGEKGERGEI-GISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGI-KGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI-GIPGVPGVKGDAGRDGPHGLPGERG------------------------------DKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPME----------GPKGEKGQPGQAGYPGSPGPVGLPGHTGQ-----------------DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1437          

HSP 7 Score: 171.785 bits (434), Expect = 5.306e-42
Identity = 317/987 (32.12%), Postives = 404/987 (40.93%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKG-------------------FEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGL------------KGIKGDDGLPGEKG---TPGRPGEQGEQGKIG--------------------DKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW--------AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKG------LKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNC-TSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTG---PDGENGTRGLTGEKGDAGLNGTI 3097
            +KG++G  G  GH G  G++G  G  G  GL G  G  G   T+G  G+ G  G  G  G+ G+ G  GP GT + G  G+ GE G+ G  GI GT G +G  G                   F G  G  G+ G  GR G +G KG E   P +   G  GEKG  G  G     T   + F                    G QG  G+PG  G  G  GE GL G+PG +G+            KG  G  G+PGE+G    PG PG +GE G +G                      G +GL+G     G +G++G A                       +G  G  G+ G PG  G  G  GL G  GP G   V G                 G  G  G PG+ G  G++G  G      I G  G+                  KGEKG       +EG RG+PG  S      +KG +G KG++GE           G  GE+G LGD G+ G PGK+G +G +GE+G  G KG  G     G +G+KGS G  GL G  GE G    + +  + G  G KGEKG       +GE G+PGI G  G  G  G+ G +G +G+ G+RGDKG  G PG+      +G  G+ GI G  G  G  G KG          +     S V+       + GEKG PG  G+ G  G  GE GI G               K                G  G  G  G PG+KGD+G+ G  G  G  G  G  G          G  G  G  G+ G  G  G      +KGE+GE G  G  G  G  G+ G +G  GD G  GI G                  ++GI G KG  G +G+ G +G+ G  G   T     GE G PG  G +G  G +G  G  GD G  G +G   P G  G  G  G+KG+ G +G  
Sbjct:  538 LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAG---TIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKG-EPGLPGVGYPGPSGEKGFQGMPG-----TPGQAGF-------------------PGPQGVDGLPGLRGDPGPKGEPGL-GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGN-------IGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMG---------------MPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGT------------------KGEKG-------EEGLRGEPGKMSETDKETMKGSKGEKGERGEI----------GISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGL------KGEVGLPGI-GIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQG---PPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSK-------------GDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPT 1415          

HSP 8 Score: 170.629 bits (431), Expect = 1.018e-41
Identity = 308/901 (34.18%), Postives = 385/901 (42.73%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGF--MGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRG-----PNGT-------FSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKG-----------SKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCT-DTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--MGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGY--------------------KGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK---GVQGDRGNNGTDGNCTSLGLMGERGFPGTP 2953
            KG  G PG  G  G  G+ G   +GY GP G KG  G  G PG  G  G  G  G PG  GD G +G+ G     P G           G +G+ G  G+ G QG +G  G  G KG  G +GV G +G            +G  G +GL G          G KGE+G +G  G +     G   N                  G  G  G  GIPG+ G  G +G  G  G  G+ G+ G+ G  G PG  G+PG  GE+G+ G  G  G  G  G   E+GE G +G    ++ TD +  KG+KG KG +G +G  G KGS+G+ G  GT G  G +G  G  G +  KG                      +GI G++G+ G++G  G + + G TG  G+ G  G  G     G+KGEKG  G V       G PG     G+PGV G    KGD G        D P G  GERGD GD G  G PG  G+KGA G  G  G          PG  G KG+KG++GLVG  G+ G    +            G  G  G +G+ G  GIPG PG  G+ G  G    G  G +G  G +GD GF G PG+     I+G QG                     +G KG+KG  G +G  G             +  K   KGE+G+PG  G  G  G  G +G        G  G  G  G+ G+ G  G  G     GS+G SGE G    +GD+GI                          TG KG+ G  G  G       KGE GE G  G +G  G+ G  G KGD+G  G  G+ GPS      GIPG  G PG K   G  G  G  G  G   S GL G  G PG+P
Sbjct:  665 KGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPA-----GVKGERGYAGFPGLDMPGPKGDKGNI-----------------GSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKG---------------------SQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEV-------GLPGI----GIPGVPG---VKGDAGR-------DGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPG---------SPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQ---------GPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGE-KGERGWPGAPGFQGFKGDTGNQG------PSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGD---RGDQGI--------------------------TGPKGDLGPPGPAGTHTV--TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPS------GIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSP 1439          

HSP 9 Score: 114.005 bits (284), Expect = 1.790e-24
Identity = 217/663 (32.73%), Postives = 282/663 (42.53%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGL---KGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGING------TKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD---------RGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGS---IGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-------------IEGETGSIXXXXXXXXXXXXXXXXV-----KGEKGYYGNV--MGKEGPRGDPGDDSSEGV---------PGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDL------------GDKGTTGFPGKNGTKGAKGENGTLGIKGKDGT-------SEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGT------DGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL 2167
            KG  G PG  G  G  GQ G  G  G  G    KG++G  G PG++G   + G  G+PG +G+KGD G  GP G     GT+G+ GE G+ G  G          KG +G KG  G +G++G KGS G  G  G  GK+        G +G +G SG  GE  +   + S                      G+QG+ G  G++G  G  GEKG  GI G          +G KG+KG+ GLPG  G PG PG +G+ G+    G  GL G   ERG++GD G   +     +    G  G  GS G  GE G+KG+   +G PG  G TGD G++GP G  G +    G      I     E  E     RG+PG  G  G++G  G +             I+G+ G  G +G +G  G     G+     KGEKG  G     G  GP G PG    +G+         PG  G +GFKGD G      +   P G  G++GD             G  G +G  G  G +G  G  G LG  G  GT       S +PG +G  G +G  GL G KG+ G    +                        G  GIPGI GT       G +G  G+ G  G  G  G  G  G  G P +
Sbjct:  844 KGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIG---QPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKD--------GQQGVQGESGPKGEKGSQGIKGSQ---------------------GLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPG-IGIPGVPGVKGDAGR---DGPHGLPG---ERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEK----GEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAG-PSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGL---------------------PGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSM 1441          

HSP 10 Score: 87.8113 bits (216), Expect = 1.753e-16
Identity = 273/892 (30.61%), Postives = 340/892 (38.12%), Query Frame = 2
Query: 1721 TKCELDCPKGSIGERGDLGDKGTTGFPGK------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL---------------------------HSNETIQGLQG--YKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKG-----------------FPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGM-----------KGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGF--------------KGLKGERGEIGQNGTTGRI-------------------------------------GMDGNNGTKGDRGDIGQKGIQGPSNPNATM---------------GIPGSKGLPGIKGVQGDRGN------NGTDGNCTSLGLMGERGFPGTPG----DNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGS-----------------------KGKIGARGEQG-------------------IRGDQGIKGGS----SPGEKGEVGSPGLKGY-----FGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDN--GTIGDEG------------DKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINI--THGDKGDKGDEGPSGVNGTTG 3766
            +KC+    KG  GERG  G  G  GFPG        G  G KG+ G  G+ G  GT   PG  G  G+ G  G+ G+ G  G       N T G+ G  G  G PG  G          PG+ GQ G  GE G      V   +G+KGF G  G+                           H     +G  G  + G KG++G+RGP G       C  +++ + +E +    GEKG                 F G+ G  GP+GP G+ G      KDG  G KG  G  G  G  G  G   T G  GESG  G PG+           KGD G+                           G KG+KGLKG QG  G                G  GERGE GQ+G  G                                       G+ GN G  G +G+ GQKG +G + P+  +               G  G+ G+PGIK   GDRG+       G  G   S GLMG  G  G PG    +    GD+G  G  G  G  G  G  G +G +GL G KG A   GTIG +G  G  G +G  G  GERG  G                         G  GA+GE G                     GDQG KG       PG +GE G PGL G       G KG QGMP   G+ G  G   +    GL+GD GP G+   G  G +G            DKG  G  G+ GE G +G  G  G KG  G  G+PG +              +   G KG +G  G +G  ++   G  G KG RG  GF  +++    GDKG+ G  GP+G  G  G
Sbjct:   30 SKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIG---------YPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAP-----CKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPG------KDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGL-----------------------PGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIK---GDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVA---GTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQ----------GPPGVPGMGPKGQQGSSGPQG--LSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPG 860          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 209.149 bits (531), Expect = 1.601e-53
Identity = 403/1200 (33.58%), Postives = 510/1200 (42.50%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVG----------------LKGDIGC-DGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF----SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN---KPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGP--DGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRG------------DPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP----------KGSIGERGDLGDKGTTGFPGKNGTKG--------------AKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGR-----RGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXI--EGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            G  GFPGE G  G  G  G +  +GP G                +   I C  G+PG  G+ G  G +G  G+ G KGD+GD  P+         G  G  G  G  G  G+ G KG+RG  G++G  G  G +GS G +G  G KG+      +P+++ GDKGE G+ G  G      GR                        GI G+ G+PG  G  GT G KG +G+PGDRG  G  G+ G PG  GT G  G  GE+G+ G  G  G+ G    +GE G     +II  T      G  G  G  G  GE GS G  G PG  G  G+ GL G    GP G +  +G                       G PG  G  G +G +G   + G+ G                   KGE G     +G  GP+G            D G+  + GVPG +G  G  G  G       +  P           G  G++G  G +G +GFPG  G KG               KG+ G +G  G  G +  PG+ G  G +G  G  G KGE+G +    +                      G+ G PG PG  G+ G  G  G  G +G  G +G+KG     GEPG  S    + ++G KG KG++G  G SGEKG   D  +              G  G  G+ GV G  GP GEKG                      +G +G QG     GS+GE G  G  G KG  GI G  G+ G+ G KGEKG +G  G    G  G  G+KG+ GR G  GL GERG+ G  G  G  G  G+ G  G  G  G  G+ G      T G+    G+PG KG+ GD G  G  G+    G  G  G PG+PG+ G  G  GR      GE G+ G+ G+ G  G  G  G+ G KGD GL G  G +GP G  G  GI  EG  GE+G  G  G  G+ G  G+ G  G  G    GEKGE G PG  G+ G KG  G     G  G +GIT        G  GD G  G  G  G+ G++G+ GE G+ G   DQG  G +G  G PG                   +  KG+ G+ G +G S       +   KGD G  G  G  G   I   HG  G KG+ GPSG  G TGY
Sbjct:  382 GPPGFPGERGEKGQHGLPG-LALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLK-GDKGESGLPGHPGA----PGREGR--------------------PGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT-GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGK----AIIK-TGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQG---------------------MPGTPGQAGFPGPQGVDGLPGLRGDPGP------------------KGEPG-----LGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSI---------------------GQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSP-------------GTPGKDGQQGVQGESGPKGEKG---------------------SQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGL---VGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIK--GEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGIT--------GQKGDTGPPGIPGFPGLKGSLGISGEKGDRG---DQGITGPKGDLGPPGP--------------AGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGY 1420          

HSP 2 Score: 192.586 bits (488), Expect = 2.319e-48
Identity = 107/276 (38.77%), Postives = 145/276 (52.54%), Query Frame = 2
Query: 4598 TKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI---QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            T G++G+ G SGPTG    G  G  G+ G+PG  G+ G  +  +    L  RH Q     +T +CP GT  + +GYS +   GNE     DLG+  SCL KFS  P + C+    C+F  RN  SYWLS+  P+     P+  + +K  ISRC VC  PA V A H Q T+Q   CP+ W  LW GYS +M TS    GS Q  +SPGSCLE  R  P IEC+     C+ + +   ++L  +     F KP   T     +L   +SRC+VC++ 
Sbjct: 1402 TPGQKGETGPSGPTGQT--GYPGPPGSDGLPGPIGLPGSPSMAHG--FLVTRHSQT---TETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQ-TIQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGT-CNYYANTYSFWLATIEKNEMFKKPTPSTL-KAGDLRTHVSRCQVCMRR 1667          

HSP 3 Score: 190.274 bits (482), Expect = 1.160e-47
Identity = 403/1214 (33.20%), Postives = 517/1214 (42.59%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHG---------TPGKIGDKGDEGDRGPNG----TFSIGTRGDNGERGINGTQGI------------------------NGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP------KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGI------------------------------PGKLGKNG-----TDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRP-----GEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVM---------GKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW----AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLT---GEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEG 3739
            KG+ G PG  G  GT G  G  G+ G  GL G  G DG PG  GI G NGT G          PG IG  G  G  GP G       I      GE+G  G  GI                         G+ G  GPKG  G +   G KG +G  G  G   K + +P      ++  G+KGEKGM G++GE     G+    +KG  G  G  G +G+ G+ G QGE G+                              PG +  NG       G++GL G PG +G KG+KG  G PG  G+PG P     G  G  G+ G+KG  GL G  ++    G KG                      +   G+ G  G  GNPG NG  G+ G KG     G  C    +  PG  G  G +G  G++G  G+PG KG             G  G  G  G  G +G     G  G KG  G V          G+ G  G PG    EG PG+ G++G  G KG A T                +G KG  G PG  G+ G  GE G  G  G  GTS  PGEKG  G  G  G+ G  G  G   +  A I  G  G  G  G PG  GDQGE+G PG PG  G  G  GE G  G  G  G  G+KGF G PG        G QG  G+ G +G+ GP GE G      +                N G  G PG+ G +G  G  G KG       +  + G             G +G+  ++G  G SG  G  G+KG+ G  G  G         +          +TG  G  G  G +G  GF G KGE G +G  G+ G+ G  G+ G  G++GD G              G PG  G PG KG +G+ G  G  G  +       +G  G  G+ G IG  G +G +GD G+ G  G DG+ G +G +   GEKG  G+ G+ GL+G  G  G  G+ G  GE+G +G  G  G+ G  GI+G++G+KG       G  G PG+KG  G  G  G+P + G +G+ GI  +    G KG +G  G  G+ G  G+KG  GT GL G  G  G  GD G +G  G +G  GE             G  G  G+ G++G+ G  G  +    G+ G+KG +G+ GF       G  G KGD+G
Sbjct:   71 KGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMG-ISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGER----GQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQ----GPKGR-DGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDK---GDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKG-----------DRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGT----------------IGAKGEQGLPGDRGSPGNPGERGFPGPAG-TGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGK--AIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV-GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKG-------EAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAG------------PFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEP------------GYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQG 1209          

HSP 4 Score: 176.407 bits (446), Expect = 1.781e-43
Identity = 368/1201 (30.64%), Postives = 484/1201 (40.30%), Query Frame = 2
Query:  593 DEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGT-----DGEKGLEGIPGDRGLKGIKGDDG-----------LPGEKGTPGRPGEQGEQGKIGDKGD--RGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----------------IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG---------VKGKRGFKGDKGEAATKCELDCP----KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIK-------GKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL-----------------------HSNETIQGLQGYKGIKGDKGNRGPSGEKGWA----EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXX----XXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIG------MDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGL------MGERGFPGTPGDNGTI---------------GDRGRRGEM--------GDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXI---EGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTI--------------------GDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
              G  GP G   I   G  GERG  G  G    K    P+G E      G KG KG  GE G +G+     K ++G+ G  G  GK G++     +      G  G  G  G  G KGE+G  G  G PG +  NG       G++GL G PG +G KG+KG  G           LPG  G PG PGE+GE+G+ G  G   +G  G++   G  G  G    I+ +                  G+ G  G  GNPG NG  G+ G K   G  G  C    +  PG  G  G +G  G++G  G+PG KG  G  G +G                   +GE G +  E R            KGE G  G+  G  G  G PG D  +G+PG          KG++G  GD+G      E   P     G+ G  G+ G+ G  GF G  GT GAKGE G   IK       G  G    PG++G KGS G  G  G +GE G                          G  GE+G  G+PGT GQ G  G  G +G  G+   RGD G  GEPGL                            + G QG+ G+ G  G++G +G  G               K  +     +G  GFPG  GV G  G  G  G+     K                          + G  G +G  G+PG  G EG+ G  G  G +                   + G+KG+ G  G  G  G+ G KGE+GE G  G  G++       M G+ G KG+RG+IG  G +G      + G PG  G  G++G  G +G  G+ G   S GL      +GE G PG  G+ G                 G++G +GE+        G  G  G+ G DG +G  G  G+KGD G+ G  G  G  G  G  GI    G+ GE+G  G+ G +G  G++G+ GD G++G   PG  GE G PG           G+P   G +G  GI   GL G  G  G+ G+ GD G  G  G  G+ G  G+ G                      G +GEKG+ G+ G PG                     + G  G  G  G   +  KG+ G++G  G  GF+      G++G  GD GPSG+ G  G
Sbjct:  202 SHGAPGPKGEMGISFYGPKGERGDRGPPGAP-CKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKS-------------GQPGDPGLPGNPGQNGFQGERGQK---GDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGD--------KGESGLPGHP-GAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYP----------------GPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGL---RGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNI-------------------GSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQG--PPGHSGEKGEPGY---------DGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPG---------------------SPGPVGLPGHTGQ--DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKG 1304          

HSP 5 Score: 175.252 bits (443), Expect = 3.658e-43
Identity = 419/1266 (33.10%), Postives = 532/1266 (42.02%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKG----LKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGI--------------PGKLGKNGTD-----------GEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNM---------------ERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL-----------------DCPKGSIGERGDLG---------------DKGTTGFPGKNG----------TKGAKGENGTLGIKGKDGTSEKP---GEKGRKGSKGSNGLVGEKGEIGYINR--TAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMG-------------ANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGV------AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSS---TGDKGNKGLKGNQGRQGFKGL-----KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMG--DNGTI-GNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPA------------KDGRRGNTGITAIGL------KGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRG--NRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            KGE+G PG  G  G  G QG  G  GP+G KGD G  G PGT G  G  G+HG PG  G                G  G +G  G +G  G NGTKG+RGP G  G  G+ G  GS G+ G KG    + G + +        KGEKG  G +G   T     +    G  G  G  G  G  G  G +GE+GI              PG   K  T+           GEKG +G+PG+ G +G  G     GEKG PG  G +G+ GK GD+G++GL G                  E+GE G +G   I+                      E+  KG  G PG  G+ GD GLKG  G  G     G                 G  G  G PG +G  G+ G  G  ++G  G  G  G  G  G   A           ++  K G  GDPG   + G  G +G+RG KGDKG+A   C+L                     G  G +GD G                 G  G PG  G           KG KGE+G  G  G  G   +P   G++G  GSKG  G +G KGE G      +  N            G  G  G++GE G+PG  G  G  G  GE G               G  G  GD+G+KG  G PG   ++  +G  G  G+    G  GPSGEKG+             +      G+ GFPG  GV       G  GP GE G+    G  G  G +G  G  G  G++G  G +   G  G SG  G PG KG+ GI G  G  G  G  G         +     +G  G  G+KG +G  GF GL     KG++G IG  G TG  G+ G  G  G     G  G  GP      MG+PGS G PG  G  G  G  G  G     G  G  G+PGT G+ G  G RG  G+M   D  T+ G+ G  GE G  G++GEKG  G  G+             G  G  G++G+ G  G  G +G QGI+G QG++     G+KG +G  GL G  G KG  G+              + G +G  G+  IG+      KGD+G DG +G  G+ GDK   G +G+ G  G  G+ G  G  G  G  GLPGE+GA G  G+ G  G+ G +G+ G +G  G  G+      +   G  G+KG  G   RG       HG+KG KGD G  G  G +G 
Sbjct:   41 KGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLP--------------GIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSM------IKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQS-FKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI----------------EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPG-------------VPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDT--------SIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV----GYPGPSGEKGF-------------QGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKE---GLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAG---PFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGS------------PGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQ-----GQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDK---GDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGV 1201          

HSP 6 Score: 174.481 bits (441), Expect = 6.395e-43
Identity = 309/989 (31.24%), Postives = 401/989 (40.55%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGP--VGLKGDIGCDGEPGTVGIDGKNGTHGTPGKI-------------------------------GDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGR--IGEKGLKG-KEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPG-----------KLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNG------------------TKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG------FSGEPGLHSNETIQGLQGYKGIKGDKGN---RGPSGEKGWAEDCNATSKVKANEFKDR-NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKG---LKGERGEIGQNGTTGR------------------IGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIP-GSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAG 3082
            KGEQG PG+ G  G  G++GF G  G    GL G+ G  G PG VGI G  G  G PGK                                G  G +G++G  G   +G  G +GE+G  G  G  G  G  GP+G +G  G+ G  G KG   +G  G KG +    P    GDKG  G SG  GE          F         K  +          G +G+PG             G+ G+ G +GL G PG  G+KG +G  G PG       PG +G++G IG  G  G TG   + G  G +G                      KG +G +G  GSIG PG  G+ G +G KG  GP G   +                         G PG KG  G+EG     + GE G +    ++  KG       KGEKG  G + G  G +G  GD  S G PG  G++G +G+ G    K      KGS G +G  G  G  G PG  G                   KG KG  G +G+ G  G    PG KG  G  G +GL GE+G                              D+G+ GIPG+PG  G  G  G  G  G+ G+ G++G KG        G+ GL  +  +QG  G+ G KG+ G     G  GEKG A            E  ++ +KG+ GFPG  G++G  G  G++G+ GF G  G  G  G +G   E             G  G+ G+ G PG  G  G+ G  G                  +   G+KG +G  G  G QGFKG    +G  G+ G +G TG+                  +G+ G  G +GD+G  G KG  GP  P  T  +  G  G PG +G  G RG  G  G     G+ G  G PG  G  G  G  G++GE G +G  G TG  G  G+ GL G  G  G
Sbjct:  581 KGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQ--------GFSGVPGHPGHKGEA----------GIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLD----MPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPG---------------PKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGIS------------------------GYPGTKGEKGEEG-----LRGEPGKMSETDKETMKGS------KGEKGERGEI-GISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGI-KGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI-GIPGVPGVKGDAGRDGPHGLPGERG------------------------------DKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPME----------GPKGEKGQPGQAGYPGSPGPVGLPGHTGQ-----------------DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1437          

HSP 7 Score: 171.785 bits (434), Expect = 5.306e-42
Identity = 317/987 (32.12%), Postives = 404/987 (40.93%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKG-------------------FEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGL------------KGIKGDDGLPGEKG---TPGRPGEQGEQGKIG--------------------DKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW--------AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKG------LKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNC-TSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTG---PDGENGTRGLTGEKGDAGLNGTI 3097
            +KG++G  G  GH G  G++G  G  G  GL G  G  G   T+G  G+ G  G  G  G+ G+ G  GP GT + G  G+ GE G+ G  GI GT G +G  G                   F G  G  G+ G  GR G +G KG E   P +   G  GEKG  G  G     T   + F                    G QG  G+PG  G  G  GE GL G+PG +G+            KG  G  G+PGE+G    PG PG +GE G +G                      G +GL+G     G +G++G A                       +G  G  G+ G PG  G  G  GL G  GP G   V G                 G  G  G PG+ G  G++G  G      I G  G+                  KGEKG       +EG RG+PG  S      +KG +G KG++GE           G  GE+G LGD G+ G PGK+G +G +GE+G  G KG  G     G +G+KGS G  GL G  GE G    + +  + G  G KGEKG       +GE G+PGI G  G  G  G+ G +G +G+ G+RGDKG  G PG+      +G  G+ GI G  G  G  G KG          +     S V+       + GEKG PG  G+ G  G  GE GI G               K                G  G  G  G PG+KGD+G+ G  G  G  G  G  G          G  G  G  G+ G  G  G      +KGE+GE G  G  G  G  G+ G +G  GD G  GI G                  ++GI G KG  G +G+ G +G+ G  G   T     GE G PG  G +G  G +G  G  GD G  G +G   P G  G  G  G+KG+ G +G  
Sbjct:  538 LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAG---TIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKG-EPGLPGVGYPGPSGEKGFQGMPG-----TPGQAGF-------------------PGPQGVDGLPGLRGDPGPKGEPGL-GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGN-------IGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMG---------------MPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGT------------------KGEKG-------EEGLRGEPGKMSETDKETMKGSKGEKGERGEI----------GISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGL------KGEVGLPGI-GIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQG---PPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSK-------------GDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPT 1415          

HSP 8 Score: 170.629 bits (431), Expect = 1.018e-41
Identity = 308/901 (34.18%), Postives = 385/901 (42.73%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGF--MGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRG-----PNGT-------FSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKG-----------SKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCT-DTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--MGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGY--------------------KGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK---GVQGDRGNNGTDGNCTSLGLMGERGFPGTP 2953
            KG  G PG  G  G  G+ G   +GY GP G KG  G  G PG  G  G  G  G PG  GD G +G+ G     P G           G +G+ G  G+ G QG +G  G  G KG  G +GV G +G            +G  G +GL G          G KGE+G +G  G +     G   N                  G  G  G  GIPG+ G  G +G  G  G  G+ G+ G+ G  G PG  G+PG  GE+G+ G  G  G  G  G   E+GE G +G    ++ TD +  KG+KG KG +G +G  G KGS+G+ G  GT G  G +G  G  G +  KG                      +GI G++G+ G++G  G + + G TG  G+ G  G  G     G+KGEKG  G V       G PG     G+PGV G    KGD G        D P G  GERGD GD G  G PG  G+KGA G  G  G          PG  G KG+KG++GLVG  G+ G    +            G  G  G +G+ G  GIPG PG  G+ G  G    G  G +G  G +GD GF G PG+     I+G QG                     +G KG+KG  G +G  G             +  K   KGE+G+PG  G  G  G  G +G        G  G  G  G+ G+ G  G  G     GS+G SGE G    +GD+GI                          TG KG+ G  G  G       KGE GE G  G +G  G+ G  G KGD+G  G  G+ GPS      GIPG  G PG K   G  G  G  G  G   S GL G  G PG+P
Sbjct:  665 KGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPA-----GVKGERGYAGFPGLDMPGPKGDKGNI-----------------GSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKG---------------------SQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEV-------GLPGI----GIPGVPG---VKGDAGR-------DGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPG---------SPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQ---------GPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGE-KGERGWPGAPGFQGFKGDTGNQG------PSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGD---RGDQGI--------------------------TGPKGDLGPPGPAGTHTV--TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPS------GIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSP 1439          

HSP 9 Score: 114.005 bits (284), Expect = 1.790e-24
Identity = 217/663 (32.73%), Postives = 282/663 (42.53%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGL---KGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGING------TKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD---------RGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGS---IGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-------------IEGETGSIXXXXXXXXXXXXXXXXV-----KGEKGYYGNV--MGKEGPRGDPGDDSSEGV---------PGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDL------------GDKGTTGFPGKNGTKGAKGENGTLGIKGKDGT-------SEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGT------DGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL 2167
            KG  G PG  G  G  GQ G  G  G  G    KG++G  G PG++G   + G  G+PG +G+KGD G  GP G     GT+G+ GE G+ G  G          KG +G KG  G +G++G KGS G  G  G  GK+        G +G +G SG  GE  +   + S                      G+QG+ G  G++G  G  GEKG  GI G          +G KG+KG+ GLPG  G PG PG +G+ G+    G  GL G   ERG++GD G   +     +    G  G  GS G  GE G+KG+   +G PG  G TGD G++GP G  G +    G      I     E  E     RG+PG  G  G++G  G +             I+G+ G  G +G +G  G     G+     KGEKG  G     G  GP G PG    +G+         PG  G +GFKGD G      +   P G  G++GD             G  G +G  G  G +G  G  G LG  G  GT       S +PG +G  G +G  GL G KG+ G    +                        G  GIPGI GT       G +G  G+ G  G  G  G  G  G  G P +
Sbjct:  844 KGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIG---QPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKD--------GQQGVQGESGPKGEKGSQGIKGSQ---------------------GLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPG-IGIPGVPGVKGDAGR---DGPHGLPG---ERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEK----GEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAG-PSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGL---------------------PGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSM 1441          

HSP 10 Score: 87.8113 bits (216), Expect = 1.753e-16
Identity = 273/892 (30.61%), Postives = 340/892 (38.12%), Query Frame = 2
Query: 1721 TKCELDCPKGSIGERGDLGDKGTTGFPGK------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL---------------------------HSNETIQGLQG--YKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKG-----------------FPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGM-----------KGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGF--------------KGLKGERGEIGQNGTTGRI-------------------------------------GMDGNNGTKGDRGDIGQKGIQGPSNPNATM---------------GIPGSKGLPGIKGVQGDRGN------NGTDGNCTSLGLMGERGFPGTPG----DNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGS-----------------------KGKIGARGEQG-------------------IRGDQGIKGGS----SPGEKGEVGSPGLKGY-----FGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDN--GTIGDEG------------DKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINI--THGDKGDKGDEGPSGVNGTTG 3766
            +KC+    KG  GERG  G  G  GFPG        G  G KG+ G  G+ G  GT   PG  G  G+ G  G+ G+ G  G       N T G+ G  G  G PG  G          PG+ GQ G  GE G      V   +G+KGF G  G+                           H     +G  G  + G KG++G+RGP G       C  +++ + +E +    GEKG                 F G+ G  GP+GP G+ G      KDG  G KG  G  G  G  G  G   T G  GESG  G PG+           KGD G+                           G KG+KGLKG QG  G                G  GERGE GQ+G  G                                       G+ GN G  G +G+ GQKG +G + P+  +               G  G+ G+PGIK   GDRG+       G  G   S GLMG  G  G PG    +    GD+G  G  G  G  G  G  G +G +GL G KG A   GTIG +G  G  G +G  G  GERG  G                         G  GA+GE G                     GDQG KG       PG +GE G PGL G       G KG QGMP   G+ G  G   +    GL+GD GP G+   G  G +G            DKG  G  G+ GE G +G  G  G KG  G  G+PG +              +   G KG +G  G +G  ++   G  G KG RG  GF  +++    GDKG+ G  GP+G  G  G
Sbjct:   30 SKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIG---------YPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAP-----CKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPG------KDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGL-----------------------PGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIK---GDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVA---GTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQ----------GPPGVPGMGPKGQQGSSGPQG--LSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPG 860          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 208.764 bits (530), Expect = 2.301e-53
Identity = 403/1200 (33.58%), Postives = 510/1200 (42.50%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVG----------------LKGDIGC-DGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF----SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN---KPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGP--DGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRG------------DPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP----------KGSIGERGDLGDKGTTGFPGKNGTKG--------------AKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGR-----RGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXI--EGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            G  GFPGE G  G  G  G +  +GP G                +   I C  G+PG  G+ G  G +G  G+ G KGD+GD  P+         G  G  G  G  G  G+ G KG+RG  G++G  G  G +GS G +G  G KG+      +P+++ GDKGE G+ G  G      GR                        GI G+ G+PG  G  GT G KG +G+PGDRG  G  G+ G PG  GT G  G  GE+G+ G  G  G+ G    +GE G     +II  T      G  G  G  G  GE GS G  G PG  G  G+ GL G    GP G +  +G                       G PG  G  G +G +G   + G+ G                   KGE G     +G  GP+G            D G+  + GVPG +G  G  G  G       +  P           G  G++G  G +G +GFPG  G KG               KG+ G +G  G  G +  PG+ G  G +G  G  G KGE+G +    +                      G+ G PG PG  G+ G  G  G  G +G  G +G+KG     GEPG  S    + ++G KG KG++G  G SGEKG   D  +              G  G  G+ GV G  GP GEKG                      +G +G QG     GS+GE G  G  G KG  GI G  G+ G+ G KGEKG +G  G    G  G  G+KG+ GR G  GL GERG+ G  G  G  G  G+ G  G  G  G  G+ G      T G+    G+PG KG+ GD G  G  G+    G  G  G PG+PG+ G  G  GR      GE G+ G+ G+ G  G  G  G+ G KGD GL G  G +GP G  G  GI  EG  GE+G  G  G  G+ G  G+ G  G  G    GEKGE G PG  G+ G KG  G     G  G +GIT        G  GD G  G  G  G+ G++G+ GE G+ G   DQG  G +G  G PG                   +  KG+ G+ G +G S       +   KGD G  G  G  G   I   HG  G KG+ GPSG  G TGY
Sbjct:  369 GPPGFPGERGEKGQHGLPG-LALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLK-GDKGESGLPGHPGA----PGREGR--------------------PGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGT-GTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGK----AIIK-TGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQG---------------------MPGTPGQAGFPGPQGVDGLPGLRGDPGP------------------KGEPG-----LGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSI---------------------GQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSP-------------GTPGKDGQQGVQGESGPKGEKG---------------------SQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGL---VGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIK--GEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGIT--------GQKGDTGPPGIPGFPGLKGSLGISGEKGDRG---DQGITGPKGDLGPPGP--------------AGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGY 1407          

HSP 2 Score: 192.586 bits (488), Expect = 2.378e-48
Identity = 107/275 (38.91%), Postives = 145/275 (52.73%), Query Frame = 2
Query: 4598 TKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI---QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVK 5410
            T G++G+ G SGPTG    G  G  G+ G+PG  G+ G  +  +    L  RH Q     +T +CP GT  + +GYS +   GNE     DLG+  SCL KFS  P + C+    C+F  RN  SYWLS+  P+     P+  + +K  ISRC VC  PA V A H Q T+Q   CP+ W  LW GYS +M TS    GS Q  +SPGSCLE  R  P IEC+     C+ + +   ++L  +     F KP   T     +L   +SRC+VC++
Sbjct: 1389 TPGQKGETGPSGPTGQT--GYPGPPGSDGLPGPIGLPGSPSMAHG--FLVTRHSQT---TETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQ-TIQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGT-CNYYANTYSFWLATIEKNEMFKKPTPSTL-KAGDLRTHVSRCQVCMR 1653          

HSP 3 Score: 189.504 bits (480), Expect = 1.849e-47
Identity = 403/1214 (33.20%), Postives = 517/1214 (42.59%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHG---------TPGKIGDKGDEGDRGPNG----TFSIGTRGDNGERGINGTQGI------------------------NGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP------KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGI------------------------------PGKLGKNG-----TDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRP-----GEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVM---------GKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW----AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLT---GEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEG 3739
            KG+ G PG  G  GT G  G  G+ G  GL G  G DG PG  GI G NGT G          PG IG  G  G  GP G       I      GE+G  G  GI                         G+ G  GPKG  G +   G KG +G  G  G   K + +P      ++  G+KGEKGM G++GE     G+    +KG  G  G  G +G+ G+ G QGE G+                              PG +  NG       G++GL G PG +G KG+KG  G PG  G+PG P     G  G  G+ G+KG  GL G  ++    G KG                      +   G+ G  G  GNPG NG  G+ G KG     G  C    +  PG  G  G +G  G++G  G+PG KG             G  G  G  G  G +G     G  G KG  G V          G+ G  G PG    EG PG+ G++G  G KG A T                +G KG  G PG  G+ G  GE G  G  G  GTS  PGEKG  G  G  G+ G  G  G   +  A I  G  G  G  G PG  GDQGE+G PG PG  G  G  GE G  G  G  G  G+KGF G PG        G QG  G+ G +G+ GP GE G      +                N G  G PG+ G +G  G  G KG       +  + G             G +G+  ++G  G SG  G  G+KG+ G  G  G         +          +TG  G  G  G +G  GF G KGE G +G  G+ G+ G  G+ G  G++GD G              G PG  G PG KG +G+ G  G  G  +       +G  G  G+ G IG  G +G +GD G+ G  G DG+ G +G +   GEKG  G+ G+ GL+G  G  G  G+ G  GE+G +G  G  G+ G  GI+G++G+KG       G  G PG+KG  G  G  G+P + G +G+ GI  +    G KG +G  G  G+ G  G+KG  GT GL G  G  G  GD G +G  G +G  GE             G  G  G+ G++G+ G  G  +    G+ G+KG +G+ GF       G  G KGD+G
Sbjct:   58 KGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMG-ISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGER----GQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQ----GPKGR-DGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDK---GDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKG-----------DRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGT----------------IGAKGEQGLPGDRGSPGNPGERGFPGPAG-TGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGK--AIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV-GYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKG-------EAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAG------------PFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEP------------GYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQG 1196          

HSP 4 Score: 176.022 bits (445), Expect = 2.241e-43
Identity = 368/1201 (30.64%), Postives = 484/1201 (40.30%), Query Frame = 2
Query:  593 DEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGT-----DGEKGLEGIPGDRGLKGIKGDDG-----------LPGEKGTPGRPGEQGEQGKIGDKGD--RGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----------------IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG---------VKGKRGFKGDKGEAATKCELDCP----KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIK-------GKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL-----------------------HSNETIQGLQGYKGIKGDKGNRGPSGEKGWA----EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXX----XXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIG------MDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGL------MGERGFPGTPGDNGTI---------------GDRGRRGEM--------GDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXI---EGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTI--------------------GDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
              G  GP G   I   G  GERG  G  G    K    P+G E      G KG KG  GE G +G+     K ++G+ G  G  GK G++     +      G  G  G  G  G KGE+G  G  G PG +  NG       G++GL G PG +G KG+KG  G           LPG  G PG PGE+GE+G+ G  G   +G  G++   G  G  G    I+ +                  G+ G  G  GNPG NG  G+ G K   G  G  C    +  PG  G  G +G  G++G  G+PG KG  G  G +G                   +GE G +  E R            KGE G  G+  G  G  G PG D  +G+PG          KG++G  GD+G      E   P     G+ G  G+ G+ G  GF G  GT GAKGE G   IK       G  G    PG++G KGS G  G  G +GE G                          G  GE+G  G+PGT GQ G  G  G +G  G+   RGD G  GEPGL                            + G QG+ G+ G  G++G +G  G               K  +     +G  GFPG  GV G  G  G  G+     K                          + G  G +G  G+PG  G EG+ G  G  G +                   + G+KG+ G  G  G  G+ G KGE+GE G  G  G++       M G+ G KG+RG+IG  G +G      + G PG  G  G++G  G +G  G+ G   S GL      +GE G PG  G+ G                 G++G +GE+        G  G  G+ G DG +G  G  G+KGD G+ G  G  G  G  G  GI    G+ GE+G  G+ G +G  G++G+ GD G++G   PG  GE G PG           G+P   G +G  GI   GL G  G  G+ G+ GD G  G  G  G+ G  G+ G                      G +GEKG+ G+ G PG                     + G  G  G  G   +  KG+ G++G  G  GF+      G++G  GD GPSG+ G  G
Sbjct:  189 SHGAPGPKGEMGISFYGPKGERGDRGPPGAP-CKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKS-------------GQPGDPGLPGNPGQNGFQGERGQK---GDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGD--------KGESGLPGHP-GAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYP----------------GPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGL---RGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNI-------------------GSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQG--PPGHSGEKGEPGY---------DGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPG---------------------SPGPVGLPGHTGQ--DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKG 1291          

HSP 5 Score: 174.866 bits (442), Expect = 5.592e-43
Identity = 419/1266 (33.10%), Postives = 532/1266 (42.02%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKG----LKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGI--------------PGKLGKNGTD-----------GEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNM---------------ERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL-----------------DCPKGSIGERGDLG---------------DKGTTGFPGKNG----------TKGAKGENGTLGIKGKDGTSEKP---GEKGRKGSKGSNGLVGEKGEIGYINR--TAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMG-------------ANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGV------AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSS---TGDKGNKGLKGNQGRQGFKGL-----KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMG--DNGTI-GNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPA------------KDGRRGNTGITAIGL------KGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRG--NRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            KGE+G PG  G  G  G QG  G  GP+G KGD G  G PGT G  G  G+HG PG  G                G  G +G  G +G  G NGTKG+RGP G  G  G+ G  GS G+ G KG    + G + +        KGEKG  G +G   T     +    G  G  G  G  G  G  G +GE+GI              PG   K  T+           GEKG +G+PG+ G +G  G     GEKG PG  G +G+ GK GD+G++GL G                  E+GE G +G   I+                      E+  KG  G PG  G+ GD GLKG  G  G     G                 G  G  G PG +G  G+ G  G  ++G  G  G  G  G  G   A           ++  K G  GDPG   + G  G +G+RG KGDKG+A   C+L                     G  G +GD G                 G  G PG  G           KG KGE+G  G  G  G   +P   G++G  GSKG  G +G KGE G      +  N            G  G  G++GE G+PG  G  G  G  GE G               G  G  GD+G+KG  G PG   ++  +G  G  G+    G  GPSGEKG+             +      G+ GFPG  GV       G  GP GE G+    G  G  G +G  G  G  G++G  G +   G  G SG  G PG KG+ GI G  G  G  G  G         +     +G  G  G+KG +G  GF GL     KG++G IG  G TG  G+ G  G  G     G  G  GP      MG+PGS G PG  G  G  G  G  G     G  G  G+PGT G+ G  G RG  G+M   D  T+ G+ G  GE G  G++GEKG  G  G+             G  G  G++G+ G  G  G +G QGI+G QG++     G+KG +G  GL G  G KG  G+              + G +G  G+  IG+      KGD+G DG +G  G+ GDK   G +G+ G  G  G+ G  G  G  G  GLPGE+GA G  G+ G  G+ G +G+ G +G  G  G+      +   G  G+KG  G   RG       HG+KG KGD G  G  G +G 
Sbjct:   28 KGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLP--------------GIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGDITGIDVSM------IKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQS-FKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEI----------------EVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPG-------------VPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDT--------SIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGV----GYPGPSGEKGF-------------QGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGL----GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKE---GLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAG---PFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGS------------PGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQ-----GQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDK---GDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGV 1188          

HSP 6 Score: 174.481 bits (441), Expect = 7.520e-43
Identity = 309/989 (31.24%), Postives = 401/989 (40.55%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGP--VGLKGDIGCDGEPGTVGIDGKNGTHGTPGKI-------------------------------GDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGR--IGEKGLKG-KEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPG-----------KLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNG------------------TKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG------FSGEPGLHSNETIQGLQGYKGIKGDKGN---RGPSGEKGWAEDCNATSKVKANEFKDR-NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKG---LKGERGEIGQNGTTGR------------------IGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIP-GSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAG 3082
            KGEQG PG+ G  G  G++GF G  G    GL G+ G  G PG VGI G  G  G PGK                                G  G +G++G  G   +G  G +GE+G  G  G  G  G  GP+G +G  G+ G  G KG   +G  G KG +    P    GDKG  G SG  GE           +KG                    G +G+PG             G+ G+ G +GL G PG  G+KG +G  G PG       PG +G++G IG  G  G TG   + G  G +G                      KG +G +G  GSIG PG  G+ G +G KG  GP G   +                         G PG KG  G+EG     + GE G +    ++  KG       KGEKG  G + G  G +G  GD  S G PG  G++G +G+ G    K      KGS G +G  G  G  G PG  G                   KG KG  G +G+ G  G    PG KG  G  G +GL GE+G                              D+G+ GIPG+PG  G  G  G  G  G+ G+ G++G KG        G+ GL  +  +QG  G+ G KG+ G     G  GEKG A            E  ++ +KG+ GFPG  G++G  G  G++G+ GF G  G  G  G +G   E             G  G+ G+ G PG  G  G+ G  G                  +   G+KG +G  G  G QGFKG    +G  G+ G +G TG+                  +G+ G  G +GD+G  G KG  GP  P  T  +  G  G PG +G  G RG  G  G     G+ G  G PG  G  G  G  G++GE G +G  G TG  G  G+ GL G  G  G
Sbjct:  568 KGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEA------------------GIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLD----MPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPG---------------PKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGIS------------------------GYPGTKGEKGEEG-----LRGEPGKMSETDKETMKGS------KGEKGERGEI-GISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGI-KGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGI-GIPGVPGVKGDAGRDGPHGLPGERG------------------------------DKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPME----------GPKGEKGQPGQAGYPGSPGPVGLPGHTGQ-----------------DGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPG 1424          

HSP 7 Score: 171.4 bits (433), Expect = 6.850e-42
Identity = 317/985 (32.18%), Postives = 402/985 (40.81%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKG-------------------FEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGL------------KGIKGDDGLPGEKG---TPGRPGEQGEQGKIG--------------------DKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW--------AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKG------LKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNC-TSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTG---PDGENGTRGLTGEKGDAGLNGT 3094
            KGE G PG  G  G +G+ G  G +G  G KG  G      T+G  G+ G  G  G  G+ G+ G  GP GT + G  G+ GE G+ G  GI GT G +G  G                   F G  G  G+ G  GR G +G KG E   P +   G  GEKG  G  G     T   + F                    G QG  G+PG  G  G  GE GL G+PG +G+            KG  G  G+PGE+G    PG PG +GE G +G                      G +GL+G     G +G++G A                       +G  G  G+ G PG  G  G  GL G  GP G   V G                 G  G  G PG+ G  G++G  G      I G  G+                  KGEKG       +EG RG+PG  S      +KG +G KG++GE           G  GE+G LGD G+ G PGK+G +G +GE+G  G KG  G     G +G+KGS G  GL G  GE G    + +  + G  G KGEKG       +GE G+PGI G  G  G  G+ G +G +G+ G+RGDKG  G PG+      +G  G+ GI G  G  G  G KG          +     S V+       + GEKG PG  G+ G  G  GE GI G               K                G  G  G  G PG+KGD+G+ G  G  G  G  G  G          G  G  G  G+ G  G  G      +KGE+GE G  G  G  G  G+ G +G  GD G  GI G                  ++GI G KG  G +G+ G +G+ G  G   T     GE G PG  G +G  G +G  G  GD G  G +G   P G  G  G  G+KG+ G +G 
Sbjct:  529 KGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAG------TIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKG-EPGLPGVGYPGPSGEKGFQGMPG-----TPGQAGF-------------------PGPQGVDGLPGLRGDPGPKGEPGL-GLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGN-------IGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMG---------------MPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGT------------------KGEKG-------EEGLRGEPGKMSETDKETMKGSKGEKGERGEI----------GISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGL------KGEVGLPGI-GIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQG---PPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSK-------------GDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGP 1401          

HSP 8 Score: 170.244 bits (430), Expect = 1.418e-41
Identity = 308/901 (34.18%), Postives = 385/901 (42.73%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGF--MGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRG-----PNGT-------FSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKG-----------SKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCT-DTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--MGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGY--------------------KGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK---GVQGDRGNNGTDGNCTSLGLMGERGFPGTP 2953
            KG  G PG  G  G  G+ G   +GY GP G KG  G  G PG  G  G  G  G PG  GD G +G+ G     P G           G +G+ G  G+ G QG +G  G  G KG  G +GV G +G            +G  G +GL G          G KGE+G +G  G +     G   N                  G  G  G  GIPG+ G  G +G  G  G  G+ G+ G+ G  G PG  G+PG  GE+G+ G  G  G  G  G   E+GE G +G    ++ TD +  KG+KG KG +G +G  G KGS+G+ G  GT G  G +G  G  G +  KG                      +GI G++G+ G++G  G + + G TG  G+ G  G  G     G+KGEKG  G V       G PG     G+PGV G    KGD G        D P G  GERGD GD G  G PG  G+KGA G  G  G          PG  G KG+KG++GLVG  G+ G    +            G  G  G +G+ G  GIPG PG  G+ G  G    G  G +G  G +GD GF G PG+     I+G QG                     +G KG+KG  G +G  G             +  K   KGE+G+PG  G  G  G  G +G        G  G  G  G+ G+ G  G  G     GS+G SGE G    +GD+GI                          TG KG+ G  G  G       KGE GE G  G +G  G+ G  G KGD+G  G  G+ GPS      GIPG  G PG K   G  G  G  G  G   S GL G  G PG+P
Sbjct:  652 KGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPA-----GVKGERGYAGFPGLDMPGPKGDKGNI-----------------GSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKG---------------------SQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEV-------GLPGI----GIPGVPG---VKGDAGR-------DGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPG---------SPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQ---------GPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGE-KGERGWPGAPGFQGFKGDTGNQG------PSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGD---RGDQGI--------------------------TGPKGDLGPPGPAGTHTV--TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPS------GIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSP 1426          

HSP 9 Score: 113.62 bits (283), Expect = 2.260e-24
Identity = 217/663 (32.73%), Postives = 282/663 (42.53%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGL---KGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGING------TKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD---------RGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGS---IGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-------------IEGETGSIXXXXXXXXXXXXXXXXV-----KGEKGYYGNV--MGKEGPRGDPGDDSSEGV---------PGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDL------------GDKGTTGFPGKNGTKGAKGENGTLGIKGKDGT-------SEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGT------DGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL 2167
            KG  G PG  G  G  GQ G  G  G  G    KG++G  G PG++G   + G  G+PG +G+KGD G  GP G     GT+G+ GE G+ G  G          KG +G KG  G +G++G KGS G  G  G  GK+        G +G +G SG  GE  +   + S                      G+QG+ G  G++G  G  GEKG  GI G          +G KG+KG+ GLPG  G PG PG +G+ G+    G  GL G   ERG++GD G   +     +    G  G  GS G  GE G+KG+   +G PG  G TGD G++GP G  G +    G      I     E  E     RG+PG  G  G++G  G +             I+G+ G  G +G +G  G     G+     KGEKG  G     G  GP G PG    +G+         PG  G +GFKGD G      +   P G  G++GD             G  G +G  G  G +G  G  G LG  G  GT       S +PG +G  G +G  GL G KG+ G    +                        G  GIPGI GT       G +G  G+ G  G  G  G  G  G  G P +
Sbjct:  831 KGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIG---QPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKD--------GQQGVQGESGPKGEKGSQGIKGSQ---------------------GLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPG-IGIPGVPGVKGDAGR---DGPHGLPG---ERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEK----GEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAG-PSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGL---------------------PGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSM 1428          

HSP 10 Score: 87.4261 bits (215), Expect = 2.272e-16
Identity = 273/892 (30.61%), Postives = 340/892 (38.12%), Query Frame = 2
Query: 1721 TKCELDCPKGSIGERGDLGDKGTTGFPGK------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL---------------------------HSNETIQGLQG--YKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKG-----------------FPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGM-----------KGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGF--------------KGLKGERGEIGQNGTTGRI-------------------------------------GMDGNNGTKGDRGDIGQKGIQGPSNPNATM---------------GIPGSKGLPGIKGVQGDRGN------NGTDGNCTSLGLMGERGFPGTPG----DNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGS-----------------------KGKIGARGEQG-------------------IRGDQGIKGGS----SPGEKGEVGSPGLKGY-----FGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDN--GTIGDEG------------DKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINI--THGDKGDKGDEGPSGVNGTTG 3766
            +KC+    KG  GERG  G  G  GFPG        G  G KG+ G  G+ G  GT   PG  G  G+ G  G+ G+ G  G       N T G+ G  G  G PG  G          PG+ GQ G  GE G      V   +G+KGF G  G+                           H     +G  G  + G KG++G+RGP G       C  +++ + +E +    GEKG                 F G+ G  GP+GP G+ G      KDG  G KG  G  G  G  G  G   T G  GESG  G PG+           KGD G+                           G KG+KGLKG QG  G                G  GERGE GQ+G  G                                       G+ GN G  G +G+ GQKG +G + P+  +               G  G+ G+PGIK   GDRG+       G  G   S GLMG  G  G PG    +    GD+G  G  G  G  G  G  G +G +GL G KG A   GTIG +G  G  G +G  G  GERG  G                         G  GA+GE G                     GDQG KG       PG +GE G PGL G       G KG QGMP   G+ G  G   +    GL+GD GP G+   G  G +G            DKG  G  G+ GE G +G  G  G KG  G  G+PG +              +   G KG +G  G +G  ++   G  G KG RG  GF  +++    GDKG+ G  GP+G  G  G
Sbjct:   17 SKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIG---------YPGSPGQPGPKGEPGDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGISFYGPKGERGDRGPPGAP-----CKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPG------KDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGL-----------------------PGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIK---GDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVA---GTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQ----------GPPGVPGMGPKGQQGSSGPQG--LSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPG 847          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Xenopus
Match: med27 (mediator complex subunit 27 [Source:Xenbase;Acc:XB-GENE-6054175])

HSP 1 Score: 202.216 bits (513), Expect = 2.505e-51
Identity = 413/1303 (31.70%), Postives = 541/1303 (41.52%), Query Frame = 2
Query:  407 KGEQGFPGEMGH---NGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG--TFSIGT---RGDNGERGINGTQGI----------------------------NGTKGERGPKGFEGTMGVN-------GTKGSKG-------------RIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGE-NCTD---TGRSSNFYXXXXXXXXXXXXXXXXXXXX---IQGEIGIPGKLGKNGTDG---------------EKGLEGIPGDRGLKGIKGDDGLPGEKG---TPGRPGEQGE--QGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVK------------GGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGER--GDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGE---IGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQG------LQGYKGIKGDKGN------RGPSGEKGW--AEDCNATSKVKAN--------------EFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTG-RIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIG----------ARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGV---------------------QGMPAKDGRRGNTG-------ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXX-XXXXXNKGDRGKIGEKGDSVNSTKGDIGQK---------GHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +GE+G PG+ G     G  G++G  G+ G  G  G+ G  G  G +G  G NG  G PG  G KG+ GD GP G  TF  G    +G  GE G  G  G+                             G KG+RGPKG++G  G+        G  G+ G             RIG KGL G       +   G +G +G+ G+ GE  C +    GR      G  G  G +G  G KGE G   +QG  G PG +G  G  G               EKG +G  GD G  G+ G DG PG  G   +PG PG  G+  +G  G  G  GL G    RGE G  G                          G  GSKG  G PG  G +G  G+ G  GP G +C +             G  +       G  G  G  G+ GI G KG  G  G +G      I+G+ G+                 + G  G+     G+ G RG+ G     GVPG+ GK GFKG +GE          KGS+G+R     G++G TG PG  G KG +G+ G  G++GK GT   PG KG KGS G+ G+ G  G     G+        T G +G  G  G PG RGD+GE+G PG     G  G  GE+G  G  GV G  G+ G  G  G+H    ++G      ++G++G+KG KG       +GPSG  G+   +  N TS  K +              E     KGE G  G  G  G  G  G KG+ G  G+ G  G  G                   +   G+ GE G PG+ G++GI GE G                  +   G  G  G +G  G  GF G+ GERG+ G  G  G  I + G  GTKG  G               T G+PG +G+ G KG  GD G  G +G     G  GE+GFPG  G  G  G +G  G  G  G  G++G  G  G  G  G +G AGL+G +     +  +    I G+ G +G++G KG+ G            G +G  GDQG+ G    G  G VG  GL G+    G+                      G+P+K G +G  G         A G+ GD G  G  G  G  G KG+ G+ G +G +G +G  GDQG KG RG  G  G +G  G+ G   E      + G  G  G IG +G      +GD+G K         G  G  G   +       G +G++GP G  G  G+
Sbjct:  278 QGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGP-------------------------GFPGSKGLRGEPGNRGVSGFPGVPGLSGPQG-DCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGT---------------DSLPGPPGF----SGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGE----------KGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPG---PAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPG-----------------LRSFEFGDKGETGTPGVIGNQGILGEVGP-----------------DGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGG---------------TPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDG-LPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPG--LIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQG-----VQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGF 1465          

HSP 2 Score: 196.052 bits (497), Expect = 1.781e-49
Identity = 295/921 (32.03%), Postives = 383/921 (41.59%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE---PGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI--QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGE------IGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGM-FGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--------MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL-----HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG 3091
            I+G++GFPG  G +G  G +G  G RG   L G  G  G+    G  G+ G  G  G  GK G KG +G++G  G       G+ G  G+ G QG+ GT+G++G  G +G +G  GT G+KG  G  G  G     P I       G  GM G  G              G  G  G++G  G  G +G+ GE      IG+ G+ G  G  G  G+ G+PG +G+KG  G +G  G KG  GRP  +G +G  G+ G  G+ G N   G +GD+G                K  +      GE G +G  G  G++G  G  G+ GP G LG                             G+PG +   FG +G+ GT                        GV G +G  G V         G  GPRG PG     GVPG +GK G  G++G+      +D P    GERG  G  GT G PG+ G  G KG  G  G +G +G   + G+ G KG  G  GLVG                                   G QG PG+PG  G+ G++G  G  G +G  G RG  G  G PG           I GL+G+KG+ G KG     GE          +  K  E      G  G PG +GV G  G + + G+ G +G  G  G  G  G  G  G   + G     G +G  G  G  G+ GDEG                     +      G  G KGLKG+ G QGF G+ G RG+ G  G  G IG  G  G  G  G + +     P    A  G PG+ G+ G +GVQGD G  G  G   + G  G+ G PG PG     G RG +G M      G TGP+G  G  G+ G  G  G+ G
Sbjct:  699 IRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPG----VPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQG-------PPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLP---------------------------GLPGLRSFEFGDKGETGT-----------------------PGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDT-----IDLP----GERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFP---------------------------------GSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQ---PGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEG--------------------KVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSE-----PPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPM------GRTGPNGFKGASGVPGRAGLPGMPG 1482          

HSP 3 Score: 182.185 bits (461), Expect = 3.053e-45
Identity = 349/1111 (31.41%), Postives = 471/1111 (42.39%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDI------GCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPK-IQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG------IPG---------DRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDK--------GDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPL------GSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDP------GDDSSEGVPGVKG---KRGFKGDKGEAATKCELD-CPKGSIGERGDLGDKGTTGFPGKNGTKGAKG---ENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANG-TNGVIGDRGDKGFSGEPGL------HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGR-----QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPG---------------------------SKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIG 3463
            +G QG PG     GT G  G  G+ GP G KGD       G  G  G  G  G  G  G PG+ G  G  G  GP+G    G  G +G  G+ G  G  G  G  GP GF G+ G+ G  G++G  G  G+ G    +    QE D  E+   GK+G  C      +         +G  G  G  G  GI+G+ G PG  G +G  G KG++G      +PG         DRG  G+ G  G+PG  G PG  G QGE+G +GD+        G+ GL G    +G +GD+G   +                      G++G+ G+ GN G+ G+ G  G+ G  GP       G     G  G  G +G  G  G  G++G +G PG  GM G  G+ G      + G  G+ G  G  G  G    +G+KG  G  G   G +G +G P      G   + G PGVKG     G KGD+GE     +    P+  +  +G+ GD+G +GF G +G KG+KG     G LG+ G  G      E G KG  G+ G++G +G +G +                  G PG  G +G  GI G PG  G+ G  G++G  G T  + G+RG KG  G PGL      H  +   G +G++GI+G  G  G +GEKG+                   +G  GFPG  G  G  G  GEKG                                 ++G  G  G+ G PG++G  G+                           G  G KG+ G  G      +GFKGL G +G+ G+  T   +GM G  G+KG  GD G  G+ G        G+PG                             GLP   GV+G  G+ G  GN  + G+ G+ G  G PG  G  G +G +G  G  G +G +G  G+ G +GL G+ G+ GL G  G  GP+    L     +  E+G  G+ G IG +G QG  G +G+ G  +PG  G+ G  GL       GV G PA  G RG  G       G +GP+G  G  G  G  G+ G  G    IG
Sbjct:  523 RGVQGLPGA---PGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGP-GFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETD--EENEIGKEGTGCRLIAPPAP--------AGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGL---------------------QGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEG-FQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSF--EFGDKGETGTPGVIGNQGILGEVGPDGI------------IGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPG----------------QQGLVGFPGSQGFPGLPGVPGEKG---------------------------------SSGFPGLPGQHGFPGIRGIAGL--------------------------DGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTI--VGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPL-----ITAEQGYPGAHGIIGHQGVQGDMGPKGLVG--TPGAPGQTGKEGL------PGVPGWPAPPGSRGEQGPM-----GRTGPNGFKGASGVPGRAGLPGMPGRSVNIG 1488          

HSP 4 Score: 182.185 bits (461), Expect = 3.079e-45
Identity = 108/279 (38.71%), Postives = 145/279 (51.97%), Query Frame = 2
Query: 4586 LPGFTKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXX-XXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKNM 5416
            +PG+     G RG  GP G    G  G KG  G+PG  G+ G          L  +H Q  TD +   CP G   + TGYS +   G E     DLG   SCL++FS  P ++C+    C++  RN +SYWLS+  P+   PV   E++  ISRC VC APA   A H Q  +    CP+ W  LW GYS +MHT+   +GG Q LSSPGSCLE  R  P IECN     CH + +   ++L  + D    + P  +T    + +   ISRC+VC+KN+
Sbjct: 1441 VPGWPA-PPGSRGEQGPMGR--TGPNGFKGASGVPGRAGLPGMPGRSVNIGYLLVKHSQ--TDEEPM-CPVGMARLWTGYSLLYFEGQEKAHNQDLGLAGSCLQRFSTMPFLYCNPGDVCYYANRNDKSYWLSTTAPLPMMPVVEEEIRPYISRCSVCEAPAVAIAVHSQD-VSIPHCPDGWRSLWIGYSFLMHTAAGDEGGGQSLSSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTI-DEPFQSSPPADTLKAGL-IRTHISRCQVCMKNL 1710          

HSP 5 Score: 176.022 bits (445), Expect = 2.576e-43
Identity = 417/1351 (30.87%), Postives = 524/1351 (38.79%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGF---MGYRGPVGLKGDIGCDG---EPGTVGIDGKN---GTHGTPGKIGDKGDEGDR------------GPNGTFSI--------------------------------------GTRGDNGERGINGTQG---INGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLG---------------KNGT----DGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGK-------------IGDKGDRGLTGKNMERGERGDKGTASII----NCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGN---------PGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL---------IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGD----------KGEAATKCELDCPKGSIGERGDL------GDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIP---GTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQ--------------------------KGIQGPSNPNATMGIPGSKGLPGIKGVQ----GDRGNNGTDGNCTSLGLMGE---------------------RGFPGTPGDNGTIGDRGRRGEM----GDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT------AIGLKGDSGPDGDNGTIGD----------EGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKT------------------------GLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            G +G PG  G NGT G  G     G RGP G+ G  G  G   EP  V I+ KN   G  G+PG  G  G +G R            GP G   +                                      G +GD GE+G  G +G   + G KGE G  GF G  G  G  G+ G  GE G  G  AN      G KG+KG  G  G     T  +                   +  +G +GEIG PG  G               +NG+     G+ G  G+ G RG KG +GD GLP  +  PG PG  G  GK             IG KG  G  G++ +RG  G +G   I      C   + D+  +G  G  G VG  G +G  G           GL G  G +GL GP G  G    KG          KG +G +G+ G  G+PG  G  G+ G++G+          I+G  GS       G  G     G +GE G+ G    G +G RG+PG+    G PGV G  G +GD           G+  T C L  P    G  G        G +G  GFPG +G  G  G  G  G +G D     PG  G++G +G+ GL G  G  G   +         E          P G+QG  G+PG+    GT G  G  G  G  GT G  G++G KG  G PG+        L G+ G+ G+ G  G                 +  +      G KG PG++GV G +G  G  G                                   G  G  G  G PG+KG +G                          S G +G +G+KG +GR  ++GLKG  G IG  G  G    +G +GTKGDRG+ G                           KGI G        G PG  GLPG+ G++    GD+G  GT G   + G++GE                      GFPG PG+ G  GD G RG+     G+ GT G  G  G  G RG+ GEKG  G  G             +GIEGVIGE G  G KG  G +G  G  G QG  G    PGEKG  G PGL G  G  G++G+   DG  G  GI        IGLKG  G  G  G  G+           G KG  G  GL G IG  GT+G +G  G   KT                        GLP + G  G  G  G  G  G  G  GD GK+G     V    G  G KG +G+ GF+      G  G +GD+GP G+ G  G
Sbjct:  140 GPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPG--ANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQ-----------------QKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQ--PGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKG---DKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGS------HGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQ-GEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPG-PQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHG---------------------------------NPGIPGLVGMHGLPGVKGIKG--------------------------SPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGG---NGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGF------------RGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVG-----VPGLAGIPGAKGLKGSAGFQGFV---GVSGYRGDQGPKGLRGDIG 1376          

HSP 6 Score: 106.301 bits (264), Expect = 3.896e-22
Identity = 190/576 (32.99%), Postives = 244/576 (42.36%), Query Frame = 2
Query:  407 KGEQGFPGE--------MGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTH----------GTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEG----TMGVNGTKGSKGRIGEKGLKGKE-ANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGE---------------------------QGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSS-------EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI 1954
            +GEQG PG+        +   G  G QG  G++G  GLKG  G  G PG +G+ G  G            GTPG IG++G  G+ GP+G   IG  G  G RG  G  G  G  GERG  G  G    T+ + G +G+KG+ G  GL G+   +  K   GD+G +G+ G  GE+   TG                G +G  G  G QG  G+PG  G+ G+ G  GL G  G  G++GI G DGLPG KG  G+PG                             G  G  G +GD+GL G     G  G +G     N T    D G  G  G  G+ G IG  G    PG+ G  GD+GL+G  G  G    +G VG+PG                 GIPGAKG+ G  G  G + + G  G                   +G KG  G++   G +GP G PG  S        +G PG  G  G +G +G+         PKG +G  G  G  G  G PG  G     G  G  G  G+ G +   G  G  G  G  G+ G    IGY+
Sbjct:  969 RGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGI--IGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEH-GQTGEKGF-----------PGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLA---------------GIPGAKGLKGSAGFQGFVGVSGYRGD------------------QGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMG-------PKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVNIGYL 1490          

HSP 7 Score: 105.916 bits (263), Expect = 5.939e-22
Identity = 223/736 (30.30%), Postives = 289/736 (39.27%), Query Frame = 2
Query: 1688 RGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGT------------DGQNGTNGEM-GANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCT--SLGLMGE------RGFPGTPGDNGTIGD----RGRRGEMGDNGT-------------IGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQG--MPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKG-DIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            +G KGD+GE     +    KG     G+ G++G TGFPG+ G  G  G +G  G  G  G +  PG  G KG KG  G +G +G + ++N       +                 +GE G PG+ G              GQNG+     G  G  G+ G RG KG+ G+ GL + +                  GP G  G         +      +   KG  GFPG+ G  G  G  G +GIKG  G+     G                   A  G  GE G  G PG +G  G                          + G  G  G  G  G +G K    E+G  G  G +G  G+ G +G  G  G  G  G  GPS  +   G+PGS G PG+ G  G RG  G  G     S GL GE       GFPG PG +G  GD         E+G  GT              G  G  G NG RG  G  G  G +G  G            ++G+ G+RG +   G  G  G++G RG+ G+ G   PG  G  G PG KG  G KG  G  + A  G +GNTG+  +            G  G +GD+G+ G   L+G++G  GT G++G KG  G  G+PG        G     G  G  GN G  G  G  G      +  D G+KG  G  G K +    G  G  G  G  G  G  G V
Sbjct:  272 KGAKGDQGEKGNPGD----KGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGY-----------------EGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQP-----------------GPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDE-----------------AGRGPAGEPGPVGFPGFQGHAG--------RKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSG-DGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFG------------LKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPG--LPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGL-----------QGLKGTQGDQGIPG---LQGKVGTPGTPGNKGIKGSPGAPGVPG------IPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLV 909          

HSP 8 Score: 63.929 bits (154), Expect = 3.693e-9
Identity = 60/154 (38.96%), Postives = 75/154 (48.70%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMG---YRG---PVGLKGDI---GCDGEPGTVG-------IDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGI------NGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN 799
            + G  G PG  G  G+ G QGF+G   YRG   P GL+GDI   G  G PG  G       I  + G  G  G IG +G +GD GP G   +GT G  G+ G  G  G+       G++GE+GP G  G  G  G  G  GR G  G+ G+  N
Sbjct: 1335 VPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGL--VGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVN 1486          

HSP 9 Score: 63.5438 bits (153), Expect = 4.371e-9
Identity = 103/277 (37.18%), Postives = 138/277 (49.82%), Query Frame = 2
Query: 2717 NGTTGRIGMDGNNGTKGDRGDIGQKGIQGPS---NPNATMGIPGSKGLPGIKGVQGDRGNNGTDG-NCTS--LGLMGERGFPGTPGDNGTIGDRGRRGE-MGDNGTIGN--TGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQG------IKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKG 3499
            +G  G IG+ G  G KGD+G+ G  G+ GPS     +   G PG+ G+PG  G  G RG  G DG N T    G+ G  G  G PG +G  G +G++GE    +  + N   GP G  GT G  G +G  G  G  G  GP G +G +G+ G  GE+G  G  G  G +  QG R  +       ++   + G++GE G+PG K         G PA  G +G  GIT   G +G  G DG++G  G+ G  G NG  GL G  G  G +GD G +G
Sbjct:   85 SGPPGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGL-GYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDK---------GQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQG 351          

HSP 10 Score: 55.4546 bits (132), Expect = 1.363e-6
Identity = 125/444 (28.15%), Postives = 159/444 (35.81%), Query Frame = 2
Query: 2630 GDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNP-----------------NATMGIPGSKG-----------------------------LPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGI--------------KGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGD---IGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G +G+ G+ G+ G +G  G+ G  G  GQ G    + ++  N  +G RG  G  G  GP                    N  +G  G KG                               G KG QG++GN G  G     G  GE G  G PG  G  G+ G  G  G+ G  G  G  G  GT+G  GE GD G  G +                      +NG + + G  GE G  G  G+              + GS     G+ G  GLKG  G KG QG         +TG+ A       GP G +G  G EG  G  G     G IG  G  G  G  G+RG  G                        ++G RG  GE+G+     +GD    G  G  G  GF       G KG+ GD G  G+ G  G V
Sbjct:  152 GTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTF--------------------VNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQG---------DTGLPAF----QPGPPGIDGAPGKEGPPGQPGYP--GGRIGMKGLPGFPGRDGQRGAPG------------------------SRGLRGIKGEQGE-CRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTV 535          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Xenopus
Match: med27 (mediator complex subunit 27 [Source:Xenbase;Acc:XB-GENE-6054175])

HSP 1 Score: 201.445 bits (511), Expect = 4.201e-51
Identity = 388/1230 (31.54%), Postives = 512/1230 (41.63%), Query Frame = 2
Query:  422 FPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPG-------KIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGP-KGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNG---TDGEKGLEGIPGDRGLKGIKGDDGLPGEKG---TPGRPGEQGE--QGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVK------------GGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGER--GDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGE---IGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQG------LQGYKGIKGDKGN------RGPSGEKGW--AEDCNATSKVKAN--------------EFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTG-RIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIG----------ARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGV---------------------QGMPAKDGRRGNTG-------ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXX-XXXXXNKGDRGKIGEKGDSVNSTKGDIGQK---------GHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            FPG+ G  G  GQ+G  GY+G  GL        +PG  GIDG  G  G PG       +IG KG  G             G +G+RG  G++G+ G KGE+G  + +EG     G  G  G +G  G +G    K   + GD+G +G+ G  G                                G+ G  G PG  G+ G      EKG +G  GD G  G+ G DG PG  G   +PG PG  G+  +G  G  G  GL G    RGE G  G                          G  GSKG  G PG  G +G  G+ G  GP G +C +             G  +       G  G  G  G+ GI G KG  G  G +G      I+G+ G+                 + G  G+     G+ G RG+ G     GVPG+ GK GFKG +GE          KGS+G+R     G++G TG PG  G KG +G+ G  G++GK GT   PG KG KGS G+ G+ G  G     G+        T G +G  G  G PG RGD+GE+G PG     G  G  GE+G  G  GV G  G+ G  G  G+H    ++G      ++G++G+KG KG       +GPSG  G+   +  N TS  K +              E     KGE G  G  G  G  G  G KG+ G  G+ G  G  G                   +   G+ GE G PG+ G++GI GE G                  +   G  G  G +G  G  GF G+ GERG+ G  G  G  I + G  GTKG  G               T G+PG +G+ G KG  GD G  G +G     G  GE+GFPG  G  G  G +G  G  G  G  G++G  G  G  G  G +G AGL+G +     +  +    I G+ G +G++G KG+ G            G +G  GDQG+ G    G  G VG  GL G+    G+                      G+P+K G +G  G         A G+ GD G  G  G  G  G KG+ G+ G +G +G +G  GDQG KG RG  G  G +G  G+ G   E      + G  G  G IG +G      +GD+G K         G  G  G   +       G +G++GP G  G  G+
Sbjct:  411 FPGQTGDTGLKGQRGPKGYQGDTGLPAF-----QPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPG-----------FPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRK--GEAGDRGVQGLPGAPGT------------------------------VGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGP-------------------------GFPGSKGLRGEPGNRGVSGFPGVPGLSGPQG-DCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGT---------------DSLPGPPGF----SGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGE----------KGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPG---PAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPG-----------------LRSFEFGDKGETGTPGVIGNQGILGEVGP-----------------DGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGG---------------TPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDG-LPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPG--LIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQG-----VQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGF 1477          

HSP 2 Score: 196.052 bits (497), Expect = 1.921e-49
Identity = 295/921 (32.03%), Postives = 383/921 (41.59%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE---PGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI--QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGE------IGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGM-FGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--------MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL-----HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG 3091
            I+G++GFPG  G +G  G +G  G RG   L G  G  G+    G  G+ G  G  G  GK G KG +G++G  G       G+ G  G+ G QG+ GT+G++G  G +G +G  GT G+KG  G  G  G     P I       G  GM G  G              G  G  G++G  G  G +G+ GE      IG+ G+ G  G  G  G+ G+PG +G+KG  G +G  G KG  GRP  +G +G  G+ G  G+ G N   G +GD+G                K  +      GE G +G  G  G++G  G  G+ GP G LG                             G+PG +   FG +G+ GT                        GV G +G  G V         G  GPRG PG     GVPG +GK G  G++G+      +D P    GERG  G  GT G PG+ G  G KG  G  G +G +G   + G+ G KG  G  GLVG                                   G QG PG+PG  G+ G++G  G  G +G  G RG  G  G PG           I GL+G+KG+ G KG     GE          +  K  E      G  G PG +GV G  G + + G+ G +G  G  G  G  G  G  G   + G     G +G  G  G  G+ GDEG                     +      G  G KGLKG+ G QGF G+ G RG+ G  G  G IG  G  G  G  G + +     P    A  G PG+ G+ G +GVQGD G  G  G   + G  G+ G PG PG     G RG +G M      G TGP+G  G  G+ G  G  G+ G
Sbjct:  711 IRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPG----VPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQG-------PPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLP---------------------------GLPGLRSFEFGDKGETGT-----------------------PGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDT-----IDLP----GERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFP---------------------------------GSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQ---PGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEG--------------------KVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSE-----PPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPM------GRTGPNGFKGASGVPGRAGLPGMPG 1494          

HSP 3 Score: 186.037 bits (471), Expect = 2.246e-46
Identity = 369/1178 (31.32%), Postives = 464/1178 (39.39%), Query Frame = 2
Query:  407 KGEQGFPGEMGH---NGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG--TFSIGTRGDNGERGINGTQGINGTKGERG-------------PKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRG-LKGIKGDD---GLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGD----------KGEAATKCELDCPKGSIGERGDL------GDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDR-----GDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTG----EKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQG----MPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHR--GNRGFKSINITHGDKGDK----GDEGPSGVNGTTG 3766
            +GE+G PG+ G     G  G++G  G+ G  G  G+ G  G  G +G  G NG  G PG  G KG+ GD GP G  TF  G +   G  G  G  G+NG  G+ G             P  F G  G  G KG +G  G +G    +   P  Q G  G  G  GK+G                                G++G  G PG+ G+ G  G +GL GI G++G  +  +GD+   G  GE G  G PG QG  G+ G+ GDRG+ G     G  G  G A          DK             E GSKG+ G+ G  G  G  G  G +G  GS    G                    G +G+PG+ G  G  G  G                           +GE G+ G    G +G RG+PG+    G PGV G  G +GD           G+  T C L  P    G  G        G +G  GFPG +G  G  G  G   IKG  GT   PG  G  G +G                                       D+G  G+PG+PG  G +G  G  G  G  G +GDR     G++G +G PGL   +  QG QG  G++G  G  G  G KG                    KG  G PG  G+ GP    G  G+ G  G  G  G  G  G                 G  GE G  G  GMKG  G                            G  G  G++G  G  G  GL G  G  G  G  G  GM+G  G KG +G    +G++GPS     +G PG KG  G  G +GDRG  G  G+   +  M       T G+ G  G  G +G  G  G+ G  GP G+ G  GL G    E GD G  GT                GVIG +GI G  G  G  G  G  G +G     +PG  G  G PG +G +G  G +G    +P + G +G  G    GL G  G  G+ GT GDEG +G+ G IG  G+ G  G  G QG  G  G  G PG  G  G+KG +G  G  G+ G  G RG  G   D +  TKG  GQ G    G +GFK ++   G  G+     G  GP+G  G  G
Sbjct:  290 QGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQG----DTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRI--------------------GMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFAT---------EKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPG----------------PSGDGIKGLPGSHGFPGLPGNAG--------------------------ARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKG---IKGDRGTDSLPGPPGFSGQRG---------------------------------------DRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGI-------------------KGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPP------------GQRGDEGEKGPPGPAGMKGLPG--------------------------ELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPS---GNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLL----TKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGT---------------PGVIGNQGILGEVGPDGIIGFPGFTGPRG-----TPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTP--GLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGL--DGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEG 1262          

HSP 4 Score: 182.185 bits (461), Expect = 3.179e-45
Identity = 108/279 (38.71%), Postives = 145/279 (51.97%), Query Frame = 2
Query: 4586 LPGFTKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXX-XXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKNM 5416
            +PG+     G RG  GP G    G  G KG  G+PG  G+ G          L  +H Q  TD +   CP G   + TGYS +   G E     DLG   SCL++FS  P ++C+    C++  RN +SYWLS+  P+   PV   E++  ISRC VC APA   A H Q  +    CP+ W  LW GYS +MHT+   +GG Q LSSPGSCLE  R  P IECN     CH + +   ++L  + D    + P  +T    + +   ISRC+VC+KN+
Sbjct: 1453 VPGWPA-PPGSRGEQGPMGR--TGPNGFKGASGVPGRAGLPGMPGRSVNIGYLLVKHSQ--TDEEPM-CPVGMARLWTGYSLLYFEGQEKAHNQDLGLAGSCLQRFSTMPFLYCNPGDVCYYANRNDKSYWLSTTAPLPMMPVVEEEIRPYISRCSVCEAPAVAIAVHSQD-VSIPHCPDGWRSLWIGYSFLMHTAAGDEGGGQSLSSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTI-DEPFQSSPPADTLKAGL-IRTHISRCQVCMKNL 1722          

HSP 5 Score: 182.185 bits (461), Expect = 3.460e-45
Identity = 349/1111 (31.41%), Postives = 471/1111 (42.39%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDI------GCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPK-IQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG------IPG---------DRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDK--------GDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPL------GSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDP------GDDSSEGVPGVKG---KRGFKGDKGEAATKCELD-CPKGSIGERGDLGDKGTTGFPGKNGTKGAKG---ENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANG-TNGVIGDRGDKGFSGEPGL------HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGR-----QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPG---------------------------SKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIG 3463
            +G QG PG     GT G  G  G+ GP G KGD       G  G  G  G  G  G  G PG+ G  G  G  GP+G    G  G +G  G+ G  G  G  G  GP GF G+ G+ G  G++G  G  G+ G    +    QE D  E+   GK+G  C      +         +G  G  G  G  GI+G+ G PG  G +G  G KG++G      +PG         DRG  G+ G  G+PG  G PG  G QGE+G +GD+        G+ GL G    +G +GD+G   +                      G++G+ G+ GN G+ G+ G  G+ G  GP       G     G  G  G +G  G  G  G++G +G PG  GM G  G+ G      + G  G+ G  G  G  G    +G+KG  G  G   G +G +G P      G   + G PGVKG     G KGD+GE     +    P+  +  +G+ GD+G +GF G +G KG+KG     G LG+ G  G      E G KG  G+ G++G +G +G +                  G PG  G +G  GI G PG  G+ G  G++G  G T  + G+RG KG  G PGL      H  +   G +G++GI+G  G  G +GEKG+                   +G  GFPG  G  G  G  GEKG                                 ++G  G  G+ G PG++G  G+                           G  G KG+ G  G      +GFKGL G +G+ G+  T   +GM G  G+KG  GD G  G+ G        G+PG                             GLP   GV+G  G+ G  GN  + G+ G+ G  G PG  G  G +G +G  G  G +G +G  G+ G +GL G+ G+ GL G  G  GP+    L     +  E+G  G+ G IG +G QG  G +G+ G  +PG  G+ G  GL       GV G PA  G RG  G       G +GP+G  G  G  G  G+ G  G    IG
Sbjct:  535 RGVQGLPGA---PGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGP-GFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETD--EENEIGKEGTGCRLIAPPAP--------AGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGL---------------------QGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEG-FQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSF--EFGDKGETGTPGVIGNQGILGEVGPDGI------------IGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPG----------------QQGLVGFPGSQGFPGLPGVPGEKG---------------------------------SSGFPGLPGQHGFPGIRGIAGL--------------------------DGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTI--VGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPL-----ITAEQGYPGAHGIIGHQGVQGDMGPKGLVG--TPGAPGQTGKEGL------PGVPGWPAPPGSRGEQGPM-----GRTGPNGFKGASGVPGRAGLPGMPGRSVNIG 1500          

HSP 6 Score: 176.022 bits (445), Expect = 2.750e-43
Identity = 375/1205 (31.12%), Postives = 479/1205 (39.75%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGF---MGYRGPVGLKGDIGCDGE------------------PGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFS------------IGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGD--RGDKGFSGEPGLHSNETIQGLQGY--------KGIKGDKGNRGPSGEKGWA------EDCNATSKVKANEFKDRN--------------------------KGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDK--GNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGT------DGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS---SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            G +G PG  G NGT G  G     G RGP G+ G  G  G+                  PG  G +G  G  G+PG  G  G +G RGP G               +G  G+ GE G  G  G    +GER  K  +  + +   KG+KG  GEKG             GDKG+  ++G+ GE                                 +G  G PG+             G PG+ G  G  G+ G PG  G PG PG +G++G++GD G +G        G++  KG    I     +   G  G  G  G+ G+ GS          G TGD GLKG  GP G +   G                       G PG  G  GKEG  G                         G+KG  G+     G++G RG PG          +G RG KG++GE    C   C +G    RG  G+ G  GFPG  G  G KGE G  G++G  G    PG  G  G  G  G  GEKG+  +     +                   G QG+ G PG+PG DG  G NG  G+ G  G  GD  +G  G  G PGL  N   +G  G+        KG++G+ GNRG SG  G         DC   +  + NE                               +G+KGFPG  G  G  G  G KG           G     G  G  G++G++G     G  G  G  GKPG KG +G                          S GD+     G +GN G  G +GLKG +G+ G  G  G++G  G  G KG +G  G  G+ G   P A  G PG  G PG  G QG  G  G       +G     G  G +G PG  G  G IG RGR G  G  G +G  G  G  G +G  G +G  G+ G  G     G KG  G  G  G +G NG+ G  G RGEQG  GD          + GE G+ G  G KG  G KG +GMP   G+ G  G+  +    + G  G+ GT G  G++G+ G +G +G IG  G  G +G  G  G  G+PGER                     G  G IGE+GD+++   G+ G KG  G  G       HG+KG  GDEG  G+ G  G
Sbjct:  140 GPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGDPGEAGFNGIQGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQK-HKIEILLLQYKGAKGDQGEKG-----------NPGDKGQPAVTGEKGE---------------------------------EGITGFPGQ------------RGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPV--TFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSR-----FPGQTGDTGLKGQRGPKGYQGDTG-----------------LPAFQPGPPGIDGAPGKEGPPGQPGYPGG----------------RIGMKGLPGF----PGRDGQRGAPGS---------RGLRGIKGEQGE----CR--CYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGA---PGTVGLAGPAGFPGPAGEKGDKVFATEKGSK------------------GAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETD-EENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKG---------DRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQG-----------------------EKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGL-RSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGER---------------------GKYGDIGERGDTID-LPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIG 1151          

HSP 7 Score: 112.079 bits (279), Expect = 7.234e-24
Identity = 283/948 (29.85%), Postives = 370/948 (39.03%), Query Frame = 2
Query: 1088 GTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEK-----GYYGNVMGKEG-------PRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGT------------DGQNGTNGEM-GANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCT--SLGLMGE------RGFPGTPGDNGTIGD----RGRRGEMGDNGT-------------IGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQG--MPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKG-DIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G PG  G  G QG+ GDKG+RG  G     G++G  G                          G+ G +G  G+ G NGT GD G+ G  G  G   + GG G  G+ G       E +   RG PG  G  G +G  G+   G  G IG +G +G +G     G +G +     GYYG              PR    +   +    +   +G KGD+GE     +    KG     G+ G++G TGFPG+ G  G  G +G  G  G  G +  PG  G KG KG  G +G +G + ++N       +                 +GE G PG+ G              GQNG+     G  G  G+ G RG KG+ G+ GL + +                  GP G  G         +      +   KG  GFPG+ G  G  G  G +GIKG  G+     G                   A  G  GE G  G PG +G  G                          + G  G  G  G  G +G K    E+G  G  G +G  G+ G +G  G  G  G  G  GPS  +   G+PGS G PG+ G  G RG  G  G     S GL GE       GFPG PG +G  GD         E+G  GT              G  G  G NG RG  G  G  G +G  G            ++G+ G+RG +   G  G  G++G RG+ G+ G   PG  G  G PG KG  G KG  G  + A  G +GNTG+  +            G  G +GD+G+ G   L+G++G  GT G++G KG  G  G+PG        G     G  G  GN G  G  G  G      +  D G+KG  G  G K +    G  G  G  G  G  G  G V
Sbjct:   86 GPPGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPGH------------TGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGDPGEAGFNGIQGPRGS--PGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGD----KGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGY-----------------EGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQP-----------------GPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDE-----------------AGRGPAGEPGPVGFPGFQGHAG--------RKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSG-DGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFG------------LKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPG--LPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGL-----------QGLKGTQGDQGIPG---LQGKVGTPGTPGNKGIKGSPGAPGVPG------IPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLV 921          

HSP 8 Score: 106.686 bits (265), Expect = 3.745e-22
Identity = 190/576 (32.99%), Postives = 244/576 (42.36%), Query Frame = 2
Query:  407 KGEQGFPGE--------MGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTH----------GTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEG----TMGVNGTKGSKGRIGEKGLKGKE-ANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGE---------------------------QGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSS-------EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI 1954
            +GEQG PG+        +   G  G QG  G++G  GLKG  G  G PG +G+ G  G            GTPG IG++G  G+ GP+G   IG  G  G RG  G  G  G  GERG  G  G    T+ + G +G+KG+ G  GL G+   +  K   GD+G +G+ G  GE+   TG                G +G  G  G QG  G+PG  G+ G+ G  GL G  G  G++GI G DGLPG KG  G+PG                             G  G  G +GD+GL G     G  G +G     N T    D G  G  G  G+ G IG  G    PG+ G  GD+GL+G  G  G    +G VG+PG                 GIPGAKG+ G  G  G + + G  G                   +G KG  G++   G +GP G PG  S        +G PG  G  G +G +G+         PKG +G  G  G  G  G PG  G     G  G  G  G+ G +   G  G  G  G  G+ G    IGY+
Sbjct:  981 RGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGI--IGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEH-GQTGEKGF-----------PGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLA---------------GIPGAKGLKGSAGFQGFVGVSGYRGD------------------QGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMG-------PKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVNIGYL 1502          

HSP 9 Score: 67.3958 bits (163), Expect = 2.787e-10
Identity = 105/289 (36.33%), Postives = 137/289 (47.40%), Query Frame = 2
Query: 2717 NGTTGRIGMDGNNGTKGDRGDIGQKGIQGPS---NPNATMGIPGSKGLPGIKGVQGDRGN------NGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGR------------RGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQG------IKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKG 3499
            +G  G IG+ G  G KGD+G+ G  G+ GPS     +   G PG+ G+PG  G  G RG       NGT G+    G  G RG PG  G  G  G +G             RG+ G+ G  G  GP G  GT G  G +G  G  G  G  GP G +G +G+ G  GE+G  G  G  G +  QG R  +       ++   + G++GE G+PG K         G PA  G +G  GIT   G +G  G DG++G  G+ G  G NG  GL G  G  G +GD G +G
Sbjct:   85 SGPPGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGDPGEAGFNGIQGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGL-GYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDK---------GQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQG 363          

HSP 10 Score: 63.929 bits (154), Expect = 3.729e-9
Identity = 60/154 (38.96%), Postives = 75/154 (48.70%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMG---YRG---PVGLKGDI---GCDGEPGTVG-------IDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGI------NGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN 799
            + G  G PG  G  G+ G QGF+G   YRG   P GL+GDI   G  G PG  G       I  + G  G  G IG +G +GD GP G   +GT G  G+ G  G  G+       G++GE+GP G  G  G  G  G  GR G  G+ G+  N
Sbjct: 1347 VPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGL--VGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVN 1498          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Mouse
Match: Col4a6 (collagen, type IV, alpha 6 [Source:MGI Symbol;Acc:MGI:2152695])

HSP 1 Score: 223.402 bits (568), Expect = 6.446e-58
Identity = 395/1223 (32.30%), Postives = 494/1223 (40.39%), Query Frame = 2
Query:  431 EMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVG---IDGKNGTHGTPGKIGDKGDEGDRGPN------GTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKG-----------MSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-----------VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATK-----------CELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDG---------TSEK-----------PGEKGRKGSKGSNG---LVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGI---PGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXX-----XXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIG---DRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK-------IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG----------------ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDR----------GKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            E G  G  G++G +G  GP G  G  G  G PG  G     G  G +G PG  G+KGD G RGP+      G    G  GD G  G+ G +G  G +G+RGP G  G   + G  G+ G  G  GLKG + N  +   G+ G  G                     +TG  SN                         E G PG  G+ G  G +GL+G+ GD G    +G     G  G PG PG QG  G  G KG +G  G     G  G  G       T     KG           G+ G  G  G PGL GT G  G  G  G  G +   G                       G PG +G+ G  G+ G         IG  G  G +G    +GV G  G  G            + G  GP G PG   + G PG KG RG  G  G+  T              L    G  G RG+ G  G  G PGK+G  G  G  G  G KG  G         + E+           PG+ G  G KG NG   ++G KGE G    +      G  G     G  G  G  G  G+PGI   PG  GQ G  G+ G+ G  G+ G +G  G  G PG   +  + G+ G  GI+G KG +G SG  G+           A    D  KG  G  GK+G  G  G +GEKG           G  G  G +  +            GS G +G DG PG +GD+G  G  G  G  G  G+               S G +G  GLKG+ G  GF G+ G+ G  G  GT+G +G  G  G KGD+G     GI G   P    G  G KG+ G  G+ GDRG  G  G+   +G+ G+ GFPG+PG  G  G   D G  G  G  G+IG  GP G  G +G  G  G  GLNG +             I GV G  G+ G KG+       IG  G+QG +G +G +G  SPG +G  G+PG  G      + G P   GR G  G                 +  G  GDSG  G  G  G +G++G+ G  GL GE+G  G  G+ G  G  GK G PG+ G  G KG  G  G  G  G  G            G +G  G D +    GD G +G  G +G K +    G  G  G  GPSG+ G  G 
Sbjct:  280 EFGSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNI------------------------EPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGG----------------------SGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPG---APGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGA----DGLKGFSGSFGKVGQPGQTGTSGEKG---------DRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQT--LGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNG-LPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQG--SPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGL 1435          

HSP 2 Score: 183.341 bits (464), Expect = 1.032e-45
Identity = 107/286 (37.41%), Postives = 142/286 (49.65%), Query Frame = 2
Query: 4586 LPGFTKGKQGDRGGSGPTGLR-------IKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSF-TKPLGETFGTQMELEKTISRCRVCVKN 5413
            LPG   GK G  G  GP+G+        ++G  G +G PG  G  G  G      R      +H Q         CP G + +  GYS +   G E     DLG   SCL +FS  P I+C+    CH+  RN +SYWLS+  PI   PV   ++   ISRC VC AP+   A H Q  +    CP  W  LW GYS +MHT+  ++GG Q L SPGSCLE  R  P IEC+     CH + +   ++L  V +   F  +P+ ET  T  +L   +SRC+VC+K 
Sbjct: 1411 LPGI-PGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGVRVGYTLVKHSQ---SEQVPLCPTGMSRLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVGQTQIPQYISRCSVCEAPSQAIAVHSQDIIVPQ-CPLGWHSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERGQFREEPVSETLKTG-QLHTRVSRCQVCMKT 1690          

HSP 3 Score: 181.03 bits (458), Expect = 5.201e-45
Identity = 339/1087 (31.19%), Postives = 433/1087 (39.83%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFM------------------GYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG--TFSIGTR--GDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK------------------PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGE---------KGLEGIPGDR------GLKGIKGDDGLPGEKGTPGRP-----------------GEQGEQGKIGDK---------GDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-------------IEGE------TGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--------MGKEGPRGDP------------------GDDSSEGVPGVKGKRGFKGDK---------------GEAATKCELDCPKGSIGE---------RGDLGDKGTTGFPGKNGTKGAKGENG----------------TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI-NRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGD---------RGDKGFSGEPGLHSNETIQGLQGYKGIKGDK--GNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGE------RGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGI-------PGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG 3091
            ++GEQG  G  G  G  G  GF                   G +GP+GL+G  G  G+PG+    G +G  GTPG  G +G  G +G  G  T S G++  GD G+ G  GT G+ GT G+ G  G  G  G+ G  GS G  GE+GL G    K                  P+   GDKG  G+ G+ G              GS G SG  G+ G  G +G +G  GIPGK G +G+ G           GL G PG R      G  G+ G DG PG+ G+PG P                 GEQG QG  GDK         G +GL GK    G +G++G              G  G  GS    G  G+ G  G PGL G +G  G KG  G +G     G                      RG+PG KG+ G +G  G L             IEG+      +G +G  G  G  G   A G+KG  G +G V         G++G RGDP                  G+  S G  G  G  G +GDK               G+  T   L+   GS G          +G LG  G  G PGK+G++G  G +G                TLGI G  G   +PGE G KG KG +GLVG++G  G   +     IT                   G+ G PG PG  G +G NG+ G  G++G +G           G KGF G PGLH    + G +G  G  G    G  GP+G  G   +      V  +  K  +KG+KG  G  G+ GP G  G  GI                              +  +   G+ G+ G+PG+ G+                          +   G  G +G KGNQG  GF GL GE      RGE G  GT G+IG  G+ G  G +G  G +G  GP        I       PG  GLPGI G+ G  G+ G+ G   S+GL G +G PG PG +G  G  G  G +GD G  G  GP G  G  G  G  G  G+ G
Sbjct:  460 LQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGS---RGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGS-GFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPP------GQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTG---------------------KRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGIT-------------------GDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGI------------------------------SLPSVIAGQPGDPGRPGLDGER--GRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQG---SVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPG 1461          

HSP 4 Score: 180.644 bits (457), Expect = 6.820e-45
Identity = 361/1118 (32.29%), Postives = 464/1118 (41.50%), Query Frame = 2
Query:  404 IKGEQGF---PGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG--TFSIGTR--GDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK------------------PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGE---------KGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE-GETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL--------DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKP--------GEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKG----IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQ--GRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGP---------SNPNATMGIPGSKGLPGIKGV------------------QGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIE-GVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGR 3502
            +KG+ GF    G   + G  G+ G  G +GP+GL+G  G  G+PG+    G +G  GTPG  G +G  G +G  G  T S G++  GD G+ G  GT G+ GT G+ G  G  G  G+ G  GS G  GE+GL G    K                  P+   GDKG  G+ G+ G              GS G SG  G+ G  G +G +G  GIPGK G +G+ G           GL G PG RG KG+ G  GLPG+ G PG+ G  G  G  G  GD     +N   GE+G +G                          G+ G  G  G PG  G  G  G+ GP G  G+    G  G PG  G+    G +G  G  G PG  G+ G  GK G   + G+ GS                   G++G  G + G  GP+G PG   S G+ GV G  G +G KGE  +   +            G+ G +G  G  G  G PG+ GT G KG+ G  G  G   +S +P        GEKG +GS GS+G  G +G+     +    I                +G  G  G PG  G  G  G  G +G  G  G+ G  G +G +G  GL     I GL+G +G    I G  G +G  GE G+          K  + KD   G++G+PG  G  G VG  G+ G  G  G  G  G  GD G  G  G  G  G+   +G +G  G  G PG+ G  G+                           G KG  G  G    G  G  GL G +GE G  G    IG  G  G+KG +GD G  G+QGP         S P+   G PG  G PG+ G                   QGD G++G  G     G  G +G PG  G +G +G +G RGE G  GT G  G  G+ G  G+ G+ G  G +G  G  G         +  G +G  GI+G  G IG  G QG  G QG                        KG+ G+P KDG               SG  G +G +GD G  G+ G  G EG  GN G IG  G  G 
Sbjct:  475 VKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGS---RGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGS-GFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDI-FGAENGASGEQGLQGLP------------------------GDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGST------------------GKRGLPG-IKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGI--SSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGD-----KGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGF----------KGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGL--------------------------PGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIV--IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQG-----------------------SKGLPGIPGKDG--------------PSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGH 1462          

HSP 5 Score: 62.7734 bits (151), Expect = 5.711e-9
Identity = 97/303 (32.01%), Postives = 120/303 (39.60%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGT-----FSIGT-----------------------------------RGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGEN-CTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPG---------------DRGLKGIKGDDGL---PGEKGTPGRPGEQGEQGKIG 1135
            + G  G PG  G +GT G     G  GP GL G  G  G PG V   G  G  G+ G+ GD+G  G +GP GT      S+ +                                   +GD G+ G  G  G+ G KG +G  GF G  G  G KG +G  G  G  GK       Q GD G  GM GK G    +    +      +  +    G  G  G  GI G IG PG  G  G  G KGL GIPG               D GL G++G  G    PG +G  G+PG  G   ++G
Sbjct: 1173 LHGLNGLPGTKGTHGTPGAS-ITGVPGPAGLPGPKGERGVPGIV--IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIG-----QPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGVRVG 1467          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Mouse
Match: Col4a6 (collagen, type IV, alpha 6 [Source:MGI Symbol;Acc:MGI:2152695])

HSP 1 Score: 223.402 bits (568), Expect = 6.446e-58
Identity = 395/1223 (32.30%), Postives = 494/1223 (40.39%), Query Frame = 2
Query:  431 EMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVG---IDGKNGTHGTPGKIGDKGDEGDRGPN------GTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKG-----------MSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-----------VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATK-----------CELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDG---------TSEK-----------PGEKGRKGSKGSNG---LVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGI---PGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXX-----XXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIG---DRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK-------IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG----------------ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDR----------GKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            E G  G  G++G +G  GP G  G  G  G PG  G     G  G +G PG  G+KGD G RGP+      G    G  GD G  G+ G +G  G +G+RGP G  G   + G  G+ G  G  GLKG + N  +   G+ G  G                     +TG  SN                         E G PG  G+ G  G +GL+G+ GD G    +G     G  G PG PG QG  G  G KG +G  G     G  G  G       T     KG           G+ G  G  G PGL GT G  G  G  G  G +   G                       G PG +G+ G  G+ G         IG  G  G +G    +GV G  G  G            + G  GP G PG   + G PG KG RG  G  G+  T              L    G  G RG+ G  G  G PGK+G  G  G  G  G KG  G         + E+           PG+ G  G KG NG   ++G KGE G    +      G  G     G  G  G  G  G+PGI   PG  GQ G  G+ G+ G  G+ G +G  G  G PG   +  + G+ G  GI+G KG +G SG  G+           A    D  KG  G  GK+G  G  G +GEKG           G  G  G +  +            GS G +G DG PG +GD+G  G  G  G  G  G+               S G +G  GLKG+ G  GF G+ G+ G  G  GT+G +G  G  G KGD+G     GI G   P    G  G KG+ G  G+ GDRG  G  G+   +G+ G+ GFPG+PG  G  G   D G  G  G  G+IG  GP G  G +G  G  G  GLNG +             I GV G  G+ G KG+       IG  G+QG +G +G +G  SPG +G  G+PG  G      + G P   GR G  G                 +  G  GDSG  G  G  G +G++G+ G  GL GE+G  G  G+ G  G  GK G PG+ G  G KG  G  G  G  G  G            G +G  G D +    GD G +G  G +G K +    G  G  G  GPSG+ G  G 
Sbjct:  280 EFGSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNI------------------------EPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGG----------------------SGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPG---APGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGA----DGLKGFSGSFGKVGQPGQTGTSGEKG---------DRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQT--LGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNG-LPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQG--SPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGL 1435          

HSP 2 Score: 183.341 bits (464), Expect = 1.032e-45
Identity = 107/286 (37.41%), Postives = 142/286 (49.65%), Query Frame = 2
Query: 4586 LPGFTKGKQGDRGGSGPTGLR-------IKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSF-TKPLGETFGTQMELEKTISRCRVCVKN 5413
            LPG   GK G  G  GP+G+        ++G  G +G PG  G  G  G      R      +H Q         CP G + +  GYS +   G E     DLG   SCL +FS  P I+C+    CH+  RN +SYWLS+  PI   PV   ++   ISRC VC AP+   A H Q  +    CP  W  LW GYS +MHT+  ++GG Q L SPGSCLE  R  P IEC+     CH + +   ++L  V +   F  +P+ ET  T  +L   +SRC+VC+K 
Sbjct: 1411 LPGI-PGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGVRVGYTLVKHSQ---SEQVPLCPTGMSRLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVGQTQIPQYISRCSVCEAPSQAIAVHSQDIIVPQ-CPLGWHSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERGQFREEPVSETLKTG-QLHTRVSRCQVCMKT 1690          

HSP 3 Score: 181.03 bits (458), Expect = 5.201e-45
Identity = 339/1087 (31.19%), Postives = 433/1087 (39.83%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFM------------------GYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG--TFSIGTR--GDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK------------------PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGE---------KGLEGIPGDR------GLKGIKGDDGLPGEKGTPGRP-----------------GEQGEQGKIGDK---------GDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-------------IEGE------TGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--------MGKEGPRGDP------------------GDDSSEGVPGVKGKRGFKGDK---------------GEAATKCELDCPKGSIGE---------RGDLGDKGTTGFPGKNGTKGAKGENG----------------TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI-NRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGD---------RGDKGFSGEPGLHSNETIQGLQGYKGIKGDK--GNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGE------RGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGI-------PGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG 3091
            ++GEQG  G  G  G  G  GF                   G +GP+GL+G  G  G+PG+    G +G  GTPG  G +G  G +G  G  T S G++  GD G+ G  GT G+ GT G+ G  G  G  G+ G  GS G  GE+GL G    K                  P+   GDKG  G+ G+ G              GS G SG  G+ G  G +G +G  GIPGK G +G+ G           GL G PG R      G  G+ G DG PG+ G+PG P                 GEQG QG  GDK         G +GL GK    G +G++G              G  G  GS    G  G+ G  G PGL G +G  G KG  G +G     G                      RG+PG KG+ G +G  G L             IEG+      +G +G  G  G  G   A G+KG  G +G V         G++G RGDP                  G+  S G  G  G  G +GDK               G+  T   L+   GS G          +G LG  G  G PGK+G++G  G +G                TLGI G  G   +PGE G KG KG +GLVG++G  G   +     IT                   G+ G PG PG  G +G NG+ G  G++G +G           G KGF G PGLH    + G +G  G  G    G  GP+G  G   +      V  +  K  +KG+KG  G  G+ GP G  G  GI                              +  +   G+ G+ G+PG+ G+                          +   G  G +G KGNQG  GF GL GE      RGE G  GT G+IG  G+ G  G +G  G +G  GP        I       PG  GLPGI G+ G  G+ G+ G   S+GL G +G PG PG +G  G  G  G +GD G  G  GP G  G  G  G  G  G+ G
Sbjct:  460 LQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGS---RGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGS-GFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPP------GQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTG---------------------KRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGIT-------------------GDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGI------------------------------SLPSVIAGQPGDPGRPGLDGER--GRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQG---SVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPG 1461          

HSP 4 Score: 180.644 bits (457), Expect = 6.820e-45
Identity = 361/1118 (32.29%), Postives = 464/1118 (41.50%), Query Frame = 2
Query:  404 IKGEQGF---PGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG--TFSIGTR--GDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK------------------PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGE---------KGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE-GETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL--------DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKP--------GEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKG----IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQ--GRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGP---------SNPNATMGIPGSKGLPGIKGV------------------QGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIE-GVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGR 3502
            +KG+ GF    G   + G  G+ G  G +GP+GL+G  G  G+PG+    G +G  GTPG  G +G  G +G  G  T S G++  GD G+ G  GT G+ GT G+ G  G  G  G+ G  GS G  GE+GL G    K                  P+   GDKG  G+ G+ G              GS G SG  G+ G  G +G +G  GIPGK G +G+ G           GL G PG RG KG+ G  GLPG+ G PG+ G  G  G  G  GD     +N   GE+G +G                          G+ G  G  G PG  G  G  G+ GP G  G+    G  G PG  G+    G +G  G  G PG  G+ G  GK G   + G+ GS                   G++G  G + G  GP+G PG   S G+ GV G  G +G KGE  +   +            G+ G +G  G  G  G PG+ GT G KG+ G  G  G   +S +P        GEKG +GS GS+G  G +G+     +    I                +G  G  G PG  G  G  G  G +G  G  G+ G  G +G +G  GL     I GL+G +G    I G  G +G  GE G+          K  + KD   G++G+PG  G  G VG  G+ G  G  G  G  G  GD G  G  G  G  G+   +G +G  G  G PG+ G  G+                           G KG  G  G    G  G  GL G +GE G  G    IG  G  G+KG +GD G  G+QGP         S P+   G PG  G PG+ G                   QGD G++G  G     G  G +G PG  G +G +G +G RGE G  GT G  G  G+ G  G+ G+ G  G +G  G  G         +  G +G  GI+G  G IG  G QG  G QG                        KG+ G+P KDG               SG  G +G +GD G  G+ G  G EG  GN G IG  G  G 
Sbjct:  475 VKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGS---RGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGS-GFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDI-FGAENGASGEQGLQGLP------------------------GDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGST------------------GKRGLPG-IKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGI--SSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGD-----KGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGF----------KGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGL--------------------------PGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIV--IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQG-----------------------SKGLPGIPGKDG--------------PSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGH 1462          

HSP 5 Score: 62.7734 bits (151), Expect = 5.711e-9
Identity = 97/303 (32.01%), Postives = 120/303 (39.60%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGT-----FSIGT-----------------------------------RGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGEN-CTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPG---------------DRGLKGIKGDDGL---PGEKGTPGRPGEQGEQGKIG 1135
            + G  G PG  G +GT G     G  GP GL G  G  G PG V   G  G  G+ G+ GD+G  G +GP GT      S+ +                                   +GD G+ G  G  G+ G KG +G  GF G  G  G KG +G  G  G  GK       Q GD G  GM GK G    +    +      +  +    G  G  G  GI G IG PG  G  G  G KGL GIPG               D GL G++G  G    PG +G  G+PG  G   ++G
Sbjct: 1173 LHGLNGLPGTKGTHGTPGAS-ITGVPGPAGLPGPKGERGVPGIV--IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIG-----QPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGVRVG 1467          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Mouse
Match: Col4a2 (collagen, type IV, alpha 2 [Source:MGI Symbol;Acc:MGI:88455])

HSP 1 Score: 192.586 bits (488), Expect = 1.846e-48
Identity = 111/279 (39.78%), Postives = 147/279 (52.69%), Query Frame = 2
Query: 4586 LPGFTKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXX-XXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKNM 5416
            +PGF +G QG  G  GP G     + G  G PG PG  G+ G   +I     L  +H Q  TD +   CP G N + +GYS +   G E     DLG   SCL +FS  P ++C+    C++  RN +SYWLS+  P+   PV   E+K  ISRC VC APA   A H Q T     CP  W  LW GYS +MHT+   +GG Q L SPGSCLE  R  P IECN     CH + +   ++L  + + N  + P  +T    + +   ISRC+VC+KN+
Sbjct: 1443 VPGF-RGDQGPMGHQGPVG-----QEGEPGRPGSPGLPGMPGRSVSIG---YLLVKHSQ--TDQEPM-CPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEEEIKPYISRCSVCEAPAVAIAVHSQDTSIPH-CPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQSTPSADTLKAGL-IRTHISRCQVCMKNL 1707          

HSP 2 Score: 158.303 bits (399), Expect = 4.306e-38
Identity = 262/764 (34.29%), Postives = 341/764 (44.63%), Query Frame = 2
Query: 1607 GNVMGKE-GPRGD---PGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPG------TDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKG-----------------IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPV-GPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDN--------GTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGG----SSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGE----KGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            G V+G + G RGD   PG    +G+PG  G  GF+G +G           KG  G  G  G  G +G PG++G  G  G  G LG  G  G    PG++G  G  G  G VG KG  G  +R  A ++       GE+G PG  G +G  G+PGIPG      + G +G  G +G  G  G  G +G+ GF G PGL       G++G +G                 IKG+KG+ GP G KG+         +K  +      G  GFPG  G  G + G  G+ G+ G  G  G  G  G  G  G  G  G +G+  T G  G  GE G  G  GD G                   + +    S G KG +G+ G  G +GF G KG  G+IG  G TG  G  G+ G KG  G  G  G+QGP      +GIPG KG  G  GV G  G  G  G     GL G +GFPG+PG +        G  GDRG RGE   N   G  G  G+ G RG  GE+G AG  G             +G  G+     I+GS G +GA G  G++G QG  G     + PG KG+ GS G  G+ G KG  G P   G+ G      +GL G+ GP G+ G +G+ G  G  G  G +G  G+ G  G  G  G  G  G+P        + I  + G +G  G +G  G +GE            +G  G+ G +G  G  ++    GD+G  G +GP G  G  G
Sbjct:  769 GEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGL----KGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSG--DRGDAGMS-------GERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYL-------GLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIG-------------------DTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEA--NTLPGPVGVPGQKGERGTPGERGPAGSPGL------------QGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPG-----VLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIP--------QKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPG 1466          

HSP 3 Score: 157.147 bits (396), Expect = 1.218e-37
Identity = 294/895 (32.85%), Postives = 375/895 (41.90%), Query Frame = 2
Query: 1013 KGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKN-----------------------------MERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGDKGTTGFPGKNG--------TKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG----FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGN-----QGRQGFKGLKGERGEIGQN----GTTGRIGMDGNNGTKGDRGDIGQKGIQ---GPSNPNATMGIPGSKGLPGIKGVQGDR------------GNNGTDGNCTSLGLMGERGF---PGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIG 3481
            KG+ G+P   G  G  G+ GL G  G PGR G  G  G +G +G +G TG                                + G RGD G            + GA G++GS+G  G  G KG  G PG +G  G  G  G  G  G+   +G +G PG  G  G  G+ GE G  G+PG  GM G  G  G   + GE G               + G KG  G  G + G++G RG PG D  +G+ G+KG++GF G KGEA        P  KG  GE G  G++G  G PG            KG KG+ G +G+KG  G     G +G  G  G +G  G  G  G+I     +I  G  G  G  G PG  G  G  G PG  G+ G+ GT G  G  G  G  GD GD G      G PGL     I G+ G KG  G+KG  G  G  G        + +   +     KG+ GFPG  G+ GP G  G  GI                                  G  G  G  G PG  G  GI                       +   G  G KG  G+      G  GF G  G+RG+ G+     G  G  G  G  GT G+RG  G  G+Q   G S P+   G PG  G PGI G+QG +            G  G +G+  + G  G++G+   PG  G  G +G  G +G  G+ G +GNTGP G  G RG  G KGD G  G                 G +G  GI G   KI    + G  G QG +G   PG  GE+G    +G  G  G +G P K G +G  G++A+ G +GD GP G  G +G EG+ G  G+ GL G  G + +IG
Sbjct:  696 KGVRGMP---GFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGH------------PGSPGFKGMAGMPG-IPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGF---FGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLK---GIQGMPGVPGVSGFPGLPGRPGFIKGVKGDI--GVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPG-------ITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGI------------------------------PGDKGDFGWPGVPGLPGFPGIRGI-----------------------SGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGA---------------PGSMGSPGIPGIPQKIAV--QPGTLGPQGRRG--LPGALGEIGP---QGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIG 1484          

HSP 4 Score: 142.124 bits (357), Expect = 4.586e-33
Identity = 221/711 (31.08%), Postives = 288/711 (40.51%), Query Frame = 2
Query: 1814 TKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKV--KANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRG-------------DI-GQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCT----SLGLMGERGFPGTPGDNGT---------IGDRGRRGEMGDNGTIGNTGPDGE----------NGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPD-----GDNGTIGDEGDKG----MNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSI------NITHGDKGDKGDEGPSGVNGTTGYV 3772
             KG +G  G  G  G+ G    PG+ GR+G  G  G +G +G  G       +   G  G  G  G PG RG  GE  +   PGT G  G  G+    G  G+ G+ G  GF G  G+     ++G  G+ G  G  G  GP G+ G+         +    +       G++G PG  GV GPVG  G  G                                   G  GE G  G PG KG  G+ G  G  G                 S G  G +G+ G +GRQGF G KGE G  G  G  G  G  G  G +GDRG             DI G+KG +GP      +G+ G +G+PG+ GV G  G  G  G        +G+ G  G PG PG +G           G RG +G  G  G  G TGP G+           G+ GL GE+G  G+ G  G  G  G  G  G  G+ G  G  GS G  G  G  G+ G QG +G     E G +G PG KG FG  GV G+P   G RG +G+  +    G  G  G D     G  G  GD GD+G    + G +G+ G+ G  GT G++G  G  G  G PG                                  +++ + GD+G  G  G +G++        N   G KGD+G  G +G  G  G+V
Sbjct:  695 AKGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEV-LGAQPGTRGDAGLPGQ---PGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSG------------------------------DRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGD--------------RGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQG-----EPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPP-----------------------------SNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWV 1323          

HSP 5 Score: 140.584 bits (353), Expect = 1.132e-32
Identity = 269/864 (31.13%), Postives = 340/864 (39.35%), Query Frame = 2
Query:  473 GYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGT---DGEKGLEGIPGDRGLKGIKGDDGL---PGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNME--RGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG----TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYG--NVMGKEGPRGDPGD--DSSE--GVPGVKGKRG------FKGDKGEAATKCELDCP--KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGI---KGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRG---DKGFSGEPGLHSNETIQGLQGYK------------GIKGDKGNRGPSG---EKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLK-------GNQGRQGFKGLKGERGEI------------GQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKG 2866
            G RG  GL G  G  G PG  G  G  G+ G PG  G KG  G  GP+G          G+ G  G  G  GT G  GP G  G+ G+ G  G +G  G+ G+ G    K     GD+G+ GMSG+ G        S  F                   +G+ G  GIPG+ G  G+   DG +G+ G+ G +G  G KG+ G    PG KG PG PG +G +G  G  G   L    M+  +GE+GD+G   +                      G +G KG  G PG+ G +G  GL G  G +  + VKG +                     G+PG  G+ G  G +G    T   G TGS                  +GEKG  G   V G+ GP GD GD  D+ +  G PG+KG+RG       KG  GE     ++  P   G  G +G  G KG TGFPG  G +G +GE G +GI   KG  G    PG  G  G +G +GL G  G  G+      +             R          G  G+PG  G+ GT GE G  G+ G+ G  G       SG PG      I GLQGY+            GIKGD+G+ G +G   +KGW  D                 G +G PG +G+ G  GP GE+G                                   G  G  G+ G  G KGD+G  G                       S G  G  G+        G  G QG +GL G  GEI            G  G  G  G  G +   G RGD G  G QGP       G PGS GLPG+ G
Sbjct:  777 GTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSG--------QPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMK--GLSGDRGDAGMSGERGHPG-----SPGF-------------------KGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGL---------------------KGYLGLKGIQGMPGVPGVSGFPGLPGRPGFI--KGVKGDI---------------------GVPGTPGLPGFPGVSGPPGITGFPGFTGS------------------RGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGD----------------PGPQGQPGVLGLPGEKGPKGEQGFM------------------------------GNTGPSGAVGDRGPKGPKGDQGFPGA--------------------PGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPG 1478          

HSP 6 Score: 125.946 bits (315), Expect = 3.540e-28
Identity = 199/651 (30.57%), Postives = 255/651 (39.17%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGD----------KGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKC-ELDCP-----KGSIGERGDLGDKGTTGFPG------KNGTKGAKGENGTLGIKGKD------GTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDR------GDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKG 2254
             KG  G PG  G  G  G  G  G++G +GLKG  G  G  G  G  G  G  G PG+ G KG+ GDR                  + G + I G KG+ GP G +G +G+ G +G  G  G  G  G    +P   +G KG+                                             IG+PG  G  G  G  G  GI G  G  G +G+ G PG  G  G  G  G+ G IGD          KG+RG+TG    +G  G+KG A  I                     G  G  G+ G+PGL G TG  GL G  GP G                          G  GIPG KG FG  G  G  + G  G                  ++G  G +G + G +G  G PG D + G PG  G  G +GD+GEA T    +  P     +G+ GERG  G  G  GFPG       +G+ G  G  G  G++G        G +  PG KG +GS G+ G  G+KG +G                          G QG+ G+ G+PG  G  G  G MG  G +G +GDR      GD+GF G PG   +  I G+   + I    G  GP G +G
Sbjct:  901 FKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDR---------GPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGL-PGRPGFIKGVKGD---------------------------------------------IGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFP------------------GITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEP------------------------GRIGIPGDKGDFGWPGVPG--LPGFPG------------------IRGISGLHG-LPGTKGFPGSPGVD-AHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVG------------------------DPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIP--QKIAVQPGTLGPQGRRG 1406          

HSP 7 Score: 73.1738 bits (178), Expect = 3.890e-12
Identity = 172/577 (29.81%), Postives = 223/577 (38.65%), Query Frame = 2
Query: 1622 KEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKG------------AKGENGTLG------IKGKDGTSEKPGEKGRKGSKGS------------NGLVGEKGEIGYINRTAANITHXXX------XXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVI-------------------GDRGDKGFSGEPGLHS--NETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGN-KGLKGNQGRQGFKGLKGERGE-----------------------------IGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG 3091
            ++G RG PG    +G  G  G +GF G +G    K E   P G  G +GD+G +G +GFPG +G  G              G NGT G        G  G    PG +G KG KG              G  GE G +GY          G+       G+ G  G PGP+G  G +G+    G  GQ G  G++G  G NG+                    G++GD+G  G PG+ S   E I G  G +G  G  G +G  G+KG                   ++G  GF    G +GP GP GE+G      +            +  KG +G+ G    +G  G  GE G+PG  G  G                          S GD+ + +GL G  G +GF G  G                                  G  G+ GR+G  G +G  G RG  G KG  G       +G  G  GLPG KG  G  G  G  G+    GL G  GFPG  G  G  G  G +G  GD+ TI   G  G+ G  G+ G KGD G+ G
Sbjct:   56 EKGARGQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVP-GPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGL----GFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKG-------------------SRGLDGF---QGPSGPRGPKGERG-----EQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPG-------------------------PSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIG--GLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVPG 573          

HSP 8 Score: 72.7886 bits (177), Expect = 4.802e-12
Identity = 199/615 (32.36%), Postives = 253/615 (41.14%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGING------------TQGINGTKGER---GPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIP----------------------GDRGLKGI-----KGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGP-LGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKC--------ELDCPK------GSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNG 2083
            G Q +P E G  G  G  G  GY GP GL+G       PG  G  G  G  G PG  G KGD G R        G  G  G  GI G              G NGT+G+    GP G  G  G+ G +G KG+ GE     KE        G+ GE G+ G  G              G+ G  G  G  G KG+ G +G +G  G+ G+ G  G+ G  GIP                      GD G +GI     KG++G+ G  G  G PG  GE+G +G KG RGL G     G RG KG               +     +KG  G+ G +G+ G PG  G  G+ G  GP GP +G E                          RG+PG  G  G  G+ G+      G  G +GR G +G     G  G  G+   + G EG  G PG     G PG +G++G+KG+ G+   +C         L  PK      G +G++GD GD G  G PG  G KGA G  G  G KG  G S     KG +G  G  G+ G KG+ G   R   +               G +G  G+ G+PG+PGT G  G
Sbjct:   50 GCQCYP-EKGARGQPGAVGPQGYNGPPGLQG------FPGLQGRKGDKGERGVPGPTGPKGDVGAR--------GVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDR--DKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRG-LGFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERG--EQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDE-----------------------DSMRGLPGEMGPKGFSGEPGSPAR-YLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPG---PSGFPGTRGQKGWKGEAGDC--QCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFP----GLPGPPGDGIKGPPGDAGLPGVPGTKGFPG 611          

HSP 9 Score: 69.707 bits (169), Expect = 4.113e-11
Identity = 100/330 (30.30%), Postives = 131/330 (39.70%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGP-----NGTFSIGTRGDNGERGINGTQG-----------------------INGTKGERGPKGFEGTMG--------------------------------VNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGE-NCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGL---PGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTA 1204
            +GEQG PG +   G +G  GF G RG  GL G+ G  G+ G+ G+DG  G  G  G  G++G++G  GP     + + + G RGD G +G +G  G                       + G  GE GPKGF G  G                                + G KGS+GR+G  G  G          G +G+KG  G+ G+  C                              I G  G+PG  G  G +GE G +G  GD GL GI G  G    PG  G PG  G +G+   I  KG+RG  G     G +GD G  
Sbjct:  279 EGEQGIPGVI-SKGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFP--------GTRGQKGWKGEAGDCQCGQV---------------------------IGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVP 572          

HSP 10 Score: 65.0846 bits (157), Expect = 1.145e-9
Identity = 137/475 (28.84%), Postives = 179/475 (37.68%), Query Frame = 2
Query: 2681 KGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDR------------GNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGR------------RGEMGDNGTIGN--------------------------------------TGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXI----EGVIGERGING--SKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-----------AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEG-----EIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXN-----------KGDRGKIGEKGDS-VNSTKGDIGQKGHRGN----------------RGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            KG +G+ G +G  G  G  G+ G  G +G +GD G++G+ GP+ P   +G  G  G PG  G+ G              G NGT G+    G  G  GFPG PG  G  G +G             RGE G+ G +G                                        G  G+ G +G  G+ G  G+   I L GP        +    +G  GE+GI G  SKG+ G  G  GIRG  G+      GEKG VG  G +G  G +G  G     G RG  G             A G +GD G  G +G  G  G+ G  GT G  G     E    G  G+ G KG  G+ G P                 +                KG  G++G  G S    T+G  G KG  G+                +GF  +N   G KGD+GD G  G+ G  G+
Sbjct:   57 KGARGQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPGIRGFPGLD-----GEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGF 526          

HSP 11 Score: 55.4546 bits (132), Expect = 1.049e-6
Identity = 159/534 (29.78%), Postives = 207/534 (38.76%), Query Frame = 2
Query:  959 QGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGD---------DGLPGEKG------------TPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXX--------------------VGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIG-YINRTAANITHXXXXXXXXXXXXXXXX-------DQGEQGIP---GIPGTDGQNGTNGEM----------------GANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAG 2356
            +GE G+PG  G  G  G +G+ G PG  G+ G  G          DG  G +G             PG PG QG +G+ G+        ++  RGE G+ G              G  G  G+ G                      G+ G KG IG PG NG   DI L GP     +  +   +                        G KG  G++G  G + +GE G +      G  G +   G+ GEKG    V+G++G R   G D  +G  G +G +G +G++G          P  + G RGD G +G  G P   G++G  GE GT G  G     E    +G  G  G  G  GE G    Y+    A+   G +G  G  G PGP G        +G  G P   G PGT GQ G  GE                 G  G  GV G+ G KG  G+PGLH    I G  G+KG  G  G  GP G             +K +      KGE+G PG  GV G
Sbjct:   90 KGERGVPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKGEKGDIGQPGPNGIPSDITLVGPT----TSTIHPDLYK----------------------GEKGDEGEQGIPGVISKGEEGIM------GFPGIRGFPGLDGEKG----VVGQKGSR---GLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEP---GSRGEPGEPGTAGPPGPSVGDED-SMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHG---IPGFPGFKGAPGVAGAPGPKG-------------IKGDSRTITTKGERGQPGIPGVHG 564          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Mouse
Match: Col4a3 (collagen, type IV, alpha 3 [Source:MGI Symbol;Acc:MGI:104688])

HSP 1 Score: 187.963 bits (476), Expect = 4.510e-47
Identity = 108/280 (38.57%), Postives = 151/280 (53.93%), Query Frame = 2
Query: 4589 PGFTKGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINRSE-ILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLS--SLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            P  TKG +G +G  GP GL         G PG+ G+ G +G  A   R    +F RH Q         CPEGT  + +G+S +   GN+     DLG+  SCL++F+  P + C+    C+F  RN  SYWLS  +L+P+   P+    ++  ISRC VC  PA   A H Q+T    PCP+ W  LW+G+S IM TS  S+G  Q L+SPGSCLE  R +P IEC+     C+ + ++  ++L  +     F KP+  T     +LEK ISRC+VC+K 
Sbjct: 1402 PAGTKGNKGLKGQQGPPGL--------DGLPGLKGNPGDRGTPATGTRMRGFIFTRHSQTTA---IPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTT-AIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGT-CNYYSNSYSFWLASLNPERMFRKPIPSTV-KAGDLEKIISRCQVCMKK 1667          

HSP 2 Score: 80.4925 bits (197), Expect = 2.468e-14
Identity = 202/595 (33.95%), Postives = 241/595 (40.50%), Query Frame = 2
Query: 1775 GDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR----NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGT-TGRIGMDGNNGTKGDRGDIGQKGIQG---------PSNPNATMG-----------IPGSKG---LPGIKG-----------------------------------VQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLK 3370
            G +G+ G PG  G KG  G  G  G KGK G S+    KG KG  G  G VG  GE G           G EG  G  G PGPRGD G +G PG PG  G  G+ G MG      V G +G KG SG PGL       GL G  G +GDKG      E G++E           +         KGE+G PG  G +GP GP+G                                      GS G  G  GKPG  GD G+KG+ G  G  G  G  G          G  G  G++G+QGR G  G  GE+GE G  G   G  G  G  G KGDRG  G  G+ G         P  P  T G           IPG KG   LPG++G                                     GD G  G  G   + GL G RG PG PG  G  G++G  G +G    IG+ GP G  G  G  G+ G   +    G  GP G  G  G++G  G  G+ G  G  G RG+ G  G  G     +PG  G  G+ GLKG  G  G+ G+P   G  G+ G  A G +
Sbjct:  911 GQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMG------VPGPKGRKGTSGLPGLAGRP---GLTGIHGPQGDKG------EPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDG------------------------------------APGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGP-----PGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLG---PIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPGIPGPCGPRGKPGKDGKPG-----TPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGTPATGTR 1441          

HSP 3 Score: 77.411 bits (189), Expect = 1.945e-13
Identity = 230/658 (34.95%), Postives = 292/658 (44.38%), Query Frame = 2
Query:  437 GHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGT----------FSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP-----KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLT--------------GKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEG--------VPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI--------------------NRTAANIT-HXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRG 2236
            G  GT G  G  G +G  G +GD G  G+PG  G+D ++G  G PG  G  G  G+ GP G              G +G+ G  G  GT G  G  G+ G +G  G++G+ G KG KGR G KG +G E  KP      + +GDKGE G+ G  G       R +    G  GL G  G  G  G RG  G  G PG+ G +G  G  G+ G+PG +G KG  G  GL G      RPG  G  G  GDKG+ G +              G   ++G++G++G       +                  G  GS GS G+PG  G  GD+GLKG  G  G     G  G PG  G  G  G  G++G  GIPG  G  G+ G  G    G  GS G  G KG++G     G+ G KG    VMG  GP+G PG     G        +PG KG RG  G +G                 +G  GDKG  G PG  G  G  G+ G  G  G  GT   PG +G  G  G  G+ GEKG  G++                      T   I+  G  G  G  G+PG +GD G  G+PGIPG  G  G  G+ G  GT G  G +G+KG  G+      +   GL G  G+KG+ G+RG
Sbjct:  810 GPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMD-RSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERG-EKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAG------RPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPD------------GAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGA-YPGPKGSPGVPGAKGDRGVPGLSGLPGRKG----VMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPG--PPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQ------QGPPGLDGLPGLKGNPGDRG 1434          

HSP 4 Score: 68.5514 bits (166), Expect = 9.914e-11
Identity = 172/511 (33.66%), Postives = 221/511 (43.25%), Query Frame = 2
Query: 1007 GEKGLEGIPGDRGLKGIKGDDGLPGEKGTP--GRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEI--GSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE-GETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPG---DDSSEGVPGVKGKRGFKGDKGEAATKCELDCP--KGSIGE---------------------RGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGV---------IGDRGDKGF------------SGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKG 2383
            G KG  G PG+ G  G  G+ G+PG KG P  GRPG+ G+ G  G++G+ G  G     G  G  GT           D G  G  G+KG  G    G +G+ G PGLNG  G  G +G  GP G   + G +   G  G+ G  G  G  G  G PG KG  G  G  G   E GE G +G  G  G  G     G +G++G  G + G +G +G PG   +   +G PG       KGDKGE   K  +  P  KG+ G                      RGD G +G  G PG +G  G+ G  G  G KG+ GTS  PG  GR G  G +G  G+KGE GY           +        +      +GE+G+PG PG  G  G +G  G+ G+ G          +G +G KGF             G PGL     ++G QG  GI G  G +G +G  G       +  V   +      G  G PG+ GV G VGP G  G
Sbjct:  713 GTKGSPGCPGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPG-MDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLG-IPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKG----KKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPG 1217          

HSP 5 Score: 68.5514 bits (166), Expect = 9.998e-11
Identity = 142/438 (32.42%), Postives = 178/438 (40.64%), Query Frame = 2
Query: 2624 STGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXI--------EGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKG---------------------------YFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGR-----------------RGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQ------------KGHRGNRGFKSINITHGDKGDKGDEGP 3742
            S G +G+ G+ G +G +G  G KGERGE G+ G +    +      KGD+G+ G KG  G  NP       G++G PG+ G +G  G  G  G     G  G RG PG PG +G  G  G  G  G  G  G +G  G  G  GLTG  G  G  G  G                     +G  GERG+ G  G+ G  G  G  G  G  G   PG+ G  G  GLKG                             G +G  G+P   G +G TG+    L    GP G  G  G +GD+G+ G  GL G  G  G +G QG  G                  +G  GLPG RG  G+ G  G  G IGK     D+G +G  G      T GD+G              G RG+ GF       G+KG+ G  GP
Sbjct:  909 SQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLL------KGDKGEPGLKGFVG--NPGEK----GNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPG--HPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGL----LGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKG-DKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKGNPGFLGP 1327          

HSP 6 Score: 62.3882 bits (150), Expect = 7.586e-9
Identity = 228/786 (29.01%), Postives = 277/786 (35.24%), Query Frame = 2
Query: 1583 VKGEKGYYGNVMGKEGPRGDPG-----DDSSEGVPGVKGKRGFKGDKGEAATKCELDC-----------------------------PKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSE-----------------------KPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKA-----NEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGD---------------------------RGDIGQKGIQGPSNPNATMGI----PGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGN--------TGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEG--------VIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDG---------------------------RRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGER 3532
             KG  G  G  MGK G  G+PG      + S G PG  GK GF G++G A    ++                                KGS G R   G +GT G PG NG KG  G  G  G KG  G                           PG+KG  G+ G  G  GEKGE+G +         G  GK G +G       +G  GIPG+ G  G+ G  GE G  G  G       KG  GEPGL      +G  G  G KG++GN G  G KG                  +       G  G PG MG+ G  GP G KG                                 T+G  G +G  G  G+ G +G KGE G                      G KG +G+ G  G+ G  G  G  G  G  G  G+ G  G+ G KG                            RGD G+ GI GP       G+    PG KG PG+ G +GDRG  G  G                PG  G +GD G +G  G  G  G          GP G+ G  GL G  G+ G  G  G  G   +     +           +G+ G  G  G  G  G  G+RGD G  G   PG KGE G+PG  G  G  G  G     G                            +G+ G   +GL G  GP G  G  G +G  G  G  G +G  G  G  G  G  G  G  G PG+R
Sbjct:  714 TKGSPGCPGE-MGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPG-RCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGPPGLPGKPGSQG------QRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGL------KGFVGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKG---------------------------------TSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSG---------------LPGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPG--FPGIKGEKGNPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPG--PLGLPGIPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDR 1433          

HSP 7 Score: 60.8474 bits (146), Expect = 2.067e-8
Identity = 132/392 (33.67%), Postives = 162/392 (41.33%), Query Frame = 2
Query: 2633 DKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGR------RGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGD---------QGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTT 3763
            +KG  G+ G  G  G  GL G+ G  GQ G+ G  GM G  G  G +G+ G+KG  GPS    T  + G KG PG+KG  G+ G  G  GN            PG PG  G  G  G       RG+ G  G  G  GP G  G+ G+ G  G  G  GT             G+ G+ G  G+ G  G  G +GE G               KG+ G PG KG  G +GV G P + G  G  G  A G  G  G  G  G  GD G KG  G  G  G  G  G  G          +G++GR G  G PGE                     KG+ G +G    +    KG  G  G +G+RG   ++   G KG  GD GP G  GT 
Sbjct:  885 EKGEVGMMGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQ---TTLLKGDKGEPGLKGFVGNPGEKGNRGN------------PGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGT------------SGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGP---KGDPGLPGDKGKKGERGVPGPPGQSGPAGPDG--APGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGE---------------------KGETGLLG----AYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGTA 1219          

HSP 8 Score: 58.151 bits (139), Expect = 1.285e-7
Identity = 218/680 (32.06%), Postives = 277/680 (40.74%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNG-------ERGINGTQGINGTKGE--RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGM--SGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIG---------DKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGE--------------RGDLGDKGTTGFPGKNGTKGAKGENGTLG-IKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPG-----------------------------------TDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRG 2236
            KG  G PGEMG  G  G+ G  G +G            EP +VG  GK G  G PG+ G+ G+ GD G  G   +      G       + G  G+ G  G+ G    GP+G +G  G+NG KG  GR G+ G KG           D G  GM  SG  G+             G  G  G  G+ G  G  G +GE+G+   +G  GT G  GL G PG +G +G  G  G+ GEKG PG  GE+GE+GK G         DKG+ GL G     GE+G++G   +         +G  G  G  G  G+ GS+G+ G PG +G  G +G+ G  GP G +   G                    G  G PG  G+ G +G  G     E    G  G KG+ G    +G KGE+G  G   G+ GP G  G   S G PG  GK G  GD G    K     P  +                 RGD G  G  G PG+      KGE G LG   G  G+   PG KG +G  G +GL G KG +G +       T                G +G++G+PG+ G                                   T G  G  G  GA GT G+ G RGD GF                G+ GIKG+KGN G
Sbjct:  715 KGSPGCPGEMGKPGRPGEPGIPGAKG------------EP-SVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKG-----------DPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGM---MGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGL---PGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSG------------------LPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPP-GQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGE------KGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDVGPQGPPGT-AGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPIGKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFP---------------GFPGIKGEKGNPG 1323          

HSP 9 Score: 56.6102 bits (135), Expect = 4.621e-7
Identity = 85/254 (33.46%), Postives = 100/254 (39.37%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-----QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDR 1150
            +KGE+G PG  G  G  G+ G         LKGD G  G  G VG  G+ G  G PG  G KG EG          G RGD G R         G  G  GP G  G+MG+ G  G KGR G  GL G  A +P +      +GDKGE G S                                                G  G  GE+   G+PG  G  G  G DG PG  G+PG PG+ G  G +G KG +
Sbjct:  921 MKGEKGRPGAKGERGEKGKPGPSQT---TLLKGDKGEPGLKGFVGNPGEKGNRGNPGLPGPKGLEGLP--GLPGPPGPRGDTGSR---------GNPGRPGPHGMPGSMGIMGVPGPKGRKGTSGLPGL-AGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPG-------------------------------LPGDKGKKGER---GVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQK 1125          

HSP 10 Score: 55.4546 bits (132), Expect = 8.616e-7
Identity = 175/549 (31.88%), Postives = 221/549 (40.26%), Query Frame = 2
Query:  509 GCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE-----------------------------------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGM--SGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKI---------GDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGE--------------RGDLGDKGTTGFPGKNGTKGAKGENGTLG-IKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI 1954
            G  G PG  G  GK G  G PG  G KG+          S+G  G  G+ G  G +G  G  G+                                          GP+G +G  G+NG KG  GR G+ G K           GD G  GM  SG  G+             G  G  G  G+ G  G  G +GE+G+   +G  GT G  GL G PG +G +G  G  G+ GEKG PG  GE+GE+GK          GDKG+ GL G     GE+G++G   +         +G  G  G  G  G+ GS+G+ G PG +G  G +G+ G  GP G +   G                    G  G PG  G+ G +G  G     E    G  G KG+ G    +G KGE+G  G   G+ GP G  G   S G PG  GK G  GD G    K     P  +                 RGD G  G  G PG+      KGE G LG   G  G+   PG KG +G  G +GL G KG +G +
Sbjct:  713 GTKGSPGCPGEMGKPGRPGEPGIPGAKGEP---------SVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTPGRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPK-----------GDPGIPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGM---MGYPGTTGPPGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGFVGNPGEKGNRGNPGL---PGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGVPGPKGRKGTSG------------------LPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKKGERGVPGPP-GQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPPGLPGLPGPMGMRGDQGRDGIPGPPGE------KGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGLPGRKGVMGDV 1210          

HSP 11 Score: 53.1434 bits (126), Expect = 5.355e-6
Identity = 94/318 (29.56%), Postives = 124/318 (38.99%), Query Frame = 2
Query: 2618 NSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDR-----GNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE-----------------------------------MGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLE 3451
            +S   +KG  G  G +G+ G  G  G  G  G  G  G  G+ G  G KG +GDIG  G  GP+         G +G+PG+ G +G R                L   G RG  G PG  G+ G+RG  G+                                    G++G  G+TGP    G  GL G KG+ G   T             G  GV G  G++G KG  G RG  G++G+        PG  G  G PG  G+    G QG P   G +G+T +          P G  G  GD G +G+ G  G +
Sbjct:  281 DSYGSEKGAPGEPGPRGKPGKDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPGLPGPKGARGPQGPSGPPGVPGSPGLSRPGLRGPIGWPGLKGSKGERGPPGKDTVGPPGPLGCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPP---GVPGLDGPKGEPGSPCT-------ECHCFPGPPGVPGFPGLDGIKGIPGGRGVPGLKGN--------PGSPGSAGLPGFAGF---PGDQGHPGLKGDKGDTPL----------PWGQVGNPGDPGLRGLPGRKGFD 567          
BLAST of Collagen alpha-1(IV) chain vs. Ensembl Mouse
Match: Col4a1 (collagen, type IV, alpha 1 [Source:MGI Symbol;Acc:MGI:88454])

HSP 1 Score: 186.422 bits (472), Expect = 1.268e-46
Identity = 95/229 (41.48%), Postives = 124/229 (54.15%), Query Frame = 2
Query: 4739 ILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI---QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
             L  RH Q  T +D   CP GT ++  GYS +   GNE     DLG+  SCL KFS  P + C+    C+F  RN  SYWLS+  P+     P+  + ++  ISRC VC APA V A H Q T+Q   CP  W+ LW GYS +MHTS    GS Q  +SPGSCLE  R AP IEC+     C+ + +A  ++L  +     F KP   T     EL   +SRC+VC++ 
Sbjct: 1446 FLVTRHSQ--TTDDPL-CPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQ-TIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT-CNYYANAYSFWLATIERSEMFKKPTPSTL-KAGELRTHVSRCQVCMRR 1668          

HSP 2 Score: 147.132 bits (370), Expect = 1.247e-34
Identity = 323/995 (32.46%), Postives = 398/995 (40.00%), Query Frame = 2
Query:  971 GIPGKLGKNGTDGEKGLEGIPG----DRGLKGIKGDDGLPGEKGTPGR------------PGEQGEQGKIGDKGDRGLTGKNMERGERGD-----------------KGTASIINCTXXXXXXXXXXXXXXXXXV-GEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLG-----------------------------------------DKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKG------------VQGDRGNNGTDGNCTSLGLMGERGFPG--TPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLT--------------------GEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG----GSSPG---EKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI--------------------------------GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGK 3511
            G+PG  G  G  G+ G +G PG    D  LKG KGD G PG+ G PGR            PG +G  G IG KG+RG  G     G RGD                 KG A       +    G KG  G    + G  G+ G  G+PG  G  GD G  G  G  G    KG VG PG                 G+PG KG+ G        + GE G  G  GR G  G     G +G+KG  G  +G  G +G PG     G PG KG  G  G  GE      L  P G  G RGD G                                         +KG  GFPG +   G KG+ G+ G+ G  G S  PG  G++G+ G  G  G KGE+G +                        G  G  G PG+PG  G +G  G  G  G  G  GD+GD G  G PG   +  +  ++G KG +G+KG  GP+G+KG   D   T  V     KD   G  G PG  G  G  G  G  G+                                  GSVG  G  G PG KG  GI G  G  G  G KG KG++G  G    G  G  G KG+QG  GF G  GE+GE G  GT G   M G+ G +G  G+IG  G  G        G+PG  G+PG+KG              G +G  G+DG   S G  GE+G PG   PG  G+ GD+G +GE+G  G  G+ G  G  G +G                      G KGD G  G  GL G  G  G  G  G+ G +G  G++G  GA G  G +GD G +G    G SPG    KG++G PG+ G+ G KG+ G+    G +G+ G+                                   GL+G  GP G  G  G  G  G  G  G +G  G  G  G  G  G RG 
Sbjct:  510 GLPGPQGSPGLIGQPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIG-------------FPGLPGPKGVDG--------LPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPG--IGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQG----LTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLD-MPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQP------------------GSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGD-PGTPGVPG---KDGQAGHPGQPGPKGDPGLSGTPGSPGLP------------------------------GPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPG---MPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGSVGLPGPPGVPGFDGAPGQKGETGPFGPPGPRGF 1421          

HSP 3 Score: 139.428 bits (350), Expect = 2.735e-32
Identity = 245/733 (33.42%), Postives = 307/733 (41.88%), Query Frame = 2
Query: 1757 GERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPG--EKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNG-----TNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRN----------KGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEI------GQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMG---ERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDG------RRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGD-----------------QGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIG------EKGDS-------------VNSTKGDIGQKG---HRGNRGFKSINITHGDKGDKG 3730
            G  G  G  G+ GFPG  G +G  G  G  GI G+ G   +PG    G  G KG +GL GE G  G   R   N                        G+PG PG  GQ G       G  G  G  G+ G  G+KG  G PG+   + + G  G +GI+GD G  G  G  G                  +           KGEKGFPG  G+  P GP G+KG +G  G  G  G  G  G+ G  G  G  G     G +G  G+ G PG  G  G+ GE G  G+                S+G +G+ G KG++G  G  G+ G    +      GQ G  G  G  G  G KG RGD G  G+ G        G PG KG PG+ G  G  G  G  G+   +GL G   E+G PG PG  G  G  G +G  G+ G  G  G     G  G  G+KGD GL G  G  G  G KG  G  G+ G  G  GS G IG  G  G+ G++G KG       PG KGE G PG  G  G  G +G P  DG       +G  G+   G  G  G  GD G+ G+ G  G+ G+ G+ G  G  G +G                  +G KG RG  G PG  G  G  G  G  G  G  G+KG++G  G       KGD              +  +KGD+G  G    +G +G   +    GD+GD+G
Sbjct:  646 GPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFN------------------------GLPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMP-GPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGL--------------PGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPG----IGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQG 1335          

HSP 4 Score: 137.887 bits (346), Expect = 8.625e-32
Identity = 275/842 (32.66%), Postives = 355/842 (42.16%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGT--VGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPG-----KLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKG------------KDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPG-----IPGTDGQNGTNGEMG---ANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR--NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGF----------------------------------KGLKGERGEIGQNGTTG 2731
            G  G PG  G  G  G +GF G  G  G+ G+ G  G+PG    G+ G  G  G PG+IG  G  G  G NG   + G +G  GE GI    G+ G KG+ G  G  GT G  G+ G  G  GE+GL G     P +Q   GD G  G+ G  G               + G  G +G  G  G  GI+GE G PG       G  G  G +GL G+ G  GL G+ G  G PG  G PG  GE G  G  G  G  G  G     GE+GD G                             GS G  G+PG  G  GD+GL G  G +    +    G  G+ G KG+ G  G+KG RG PG  G+ GK+G+      G  G  G +G  G  G   + G+ G KG  G   + G  G +G PG   S+GVPG  G++G KG+KG++          G  G  GD GD+G  GFPG  G KG KG  GT G+ G              G+   PGEKG KG  G +G+ G KGE G           G++G+ G  G PG  G++GEQG+PG      PG+ G  G+ GE+G     G+ G+ G +G++GF G PG      + G  G+  ++G KG+RGP G+ G                     +KG +G+PG  GV GP G  G +G+ G  G                             GS G+ G  G PG +G +G+                              G +G+KG+QG QG                                   KGL+G  G  GQ G TG
Sbjct:  649 GAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI----GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGP----PGLQGIRGDPGPPGVQGPAGPPGVPGIGPPG----AMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLP---------------------------GSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQ-----AGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPG-----IGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHP-VEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSP------------------------GITGSKGDMGLPGVPGFQGQKGL-----------------------------PGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTG 1387          

HSP 5 Score: 133.265 bits (334), Expect = 2.047e-30
Identity = 208/603 (34.49%), Postives = 263/603 (43.62%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQG------INGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--EANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSI-GERGDLGDKGTTGFPGK------------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGF 2149
            + G+ G PG  G  GT G  GF G       KG++G  G PG  G  G  GT G PG+ GD G  G  GP G    G +GD G+ G+ G  G      +   KG++G +G +G +G  G KGS+G  G  G+ GK  +A  P  Q G KG+ G+SG  G                                G+ G  G  G +G  G+ GEKG+ GIPG +G+ G  G+ G  GEKG  G PG  G  G+ GDKGD+GL G     GE+G+KG+A       +   +            G  G+ G  G+PGL G  GD GL G DG  G   VKG  G+PG  G  G  G +GE G  GIPG+ G  G++G  G    G  GS                  KG+KG  G V       G PG   S G+PGVKG++GF G  G          P   + G +GD G +G  G PG             NG KG KG  G  G  G  G    PG +G  G  GS G+ G KG++                                 G+PG+PG  GQ G        G  GV GD+GD+G 
Sbjct:  853 LTGQSGLPGLPGQQGTPGVPGFPGS------KGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRG--DPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPG-QPGPKGDPGLSGTPGSP------------------------------GLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPG-IGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPR------------GSPGNIGHPGSPGLPGEKGDKGLPGLDGVPG---VKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGS------------------KGDKGSKGEV-------GFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDM---------------------------------GLPGVPGFQGQKGL------PGLQGVKGDQGDQGV 1336          

HSP 6 Score: 128.257 bits (321), Expect = 6.098e-29
Identity = 143/392 (36.48%), Postives = 186/392 (47.45%), Query Frame = 2
Query: 2627 TGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGT------------IXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGE------VGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGT---IGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEG 3739
            TG  G  GL G QG  G  G  G +GE+G  GT G+ G  G  GT G  G+ G  G+ G S P         +G PG KG +GD G  G  G+   + +   +G  G  G+ G IG  G +G  GD GT G  G DG+ G  G  G KGD GL+GT            +G  G  G  G KG+ G+ G +G+ GS G+ GA+GE+G  G  GI     PG+KG+       GSPG KG  G  G  GMP   G RG+ G   IG  G  G  G+    GD+G  G++G  G++GE G  GT    G  G+KG  G  G+PG                     + G++G+ G  G       G  G KG +G  GF  +  + G  G KG++G
Sbjct:  854 TGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGP---------RGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPG--NIGHPGSPGLPGEK---GDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPG---------------------SAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQG 1210          

HSP 7 Score: 114.775 bits (286), Expect = 9.043e-25
Identity = 148/408 (36.27%), Postives = 187/408 (45.83%), Query Frame = 2
Query: 2639 GNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMG-----------------------IPGSKGLPGIKGV--QGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIG---DRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP-GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            G  GLKG  G  G  G  GE+G IG  G  G  G+ G  G +G RGD G  G+QGP+ P    G                       I G KG PG  G+   G +G+ G+ G     GL G+ G PG PG  GT G     G +GEMG  GT G  G  G  GT GL GEKGD GL G+ G RG  G KG    +G +G  G+ GS   +     +G +GDQG KG   P G+KG  G PG  G  G  G  G P + G +G+ G++   G  G  GP G  G +G  G  G  G  G+ G  G  G+ G++G KG +G++GLPG                       G  G+ G+KGD  +    G  G+KG +G         + G  G  G  GP G  G  G+
Sbjct:  737 GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQG---LPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGD---KGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPG----------------------IGIPGRPGDKGDQGLAGFPGSPGEKGEKG---------SAGTPGMPGSPGPRGSPGNIGH 1107          

HSP 8 Score: 104.375 bits (259), Expect = 1.176e-21
Identity = 216/598 (36.12%), Postives = 265/598 (44.31%), Query Frame = 2
Query: 2624 STGDKGNKGLKGNQGRQGFKG------LKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKG-----------DAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKG--KIGARGEQGIRGDQGIKGGSS-PGEKGEVGSPGLKGYFGGKG---VQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKG---------------MNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVL-XXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKGE 4279
            + G  G+ G  G QG +GF G      + GE+G +GQ G  G  G+ G  G  G  G+IG+ G         + G PG  GLPG  G QG +G  G       +GL G +G PG PG  GT G++G  G  G  G  G TGP G  G RG  G  G             G  G +G  G  G  G  G  G+ GE+G  G  G    G +G++G +G  G+ G S  PG  G+ G+PG+ G+ G KG   V G P + G  G  G   +       GL G SGP GD G  GD+GD G               M G  G +GE G  G  GD+G +G  G  G+PG+ G  G  G  G  G  G SG  G  G  G KG SV    G  G  G +G  G        G  G+KG +G  G +G  G                                      G+PG+ G  GD GL+G PG  G    +   G  G  G PG +G  G  G  G  GL G+KG+ G P L G  G KG  G  G  G TGP G +GE G +G  G  GE GE G  G RG PG  G KG+ G KGE
Sbjct:  650 AAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGI-GFPGLPGPKGVDGLPGEIGRPG---------SPGRPGFNGLPGNPGPQGQKGEPG-------IGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKG-SVGGM-GLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGI-------------------------------------GIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPG-RGFPGFPGSKGDKGSKGE 1190          

HSP 9 Score: 98.5969 bits (244), Expect = 7.022e-20
Identity = 198/556 (35.61%), Postives = 249/556 (44.78%), Query Frame = 2
Query: 2639 GNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNAT---MGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDI-GQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGD------KGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKG 4276
            G  G  G  G  GF G +G+RG     GT GR G+ G  G  G  G IG  G+ GP   +     +G PGS G PG  G+ G+ G  G  G    +GL G +G PG PG  GT G++G  G  G  G  G TGP G  G RG  G  G  G  G  G+ G      +         +G  GS G  G +GE+G  G  G+     PG KG+ GS GL G  G  G+ G+P   G++G  G+   G  G  G  G  GT G  G  G  GT GL GE G++G  G  G +G  G  G                        +KGD G  G  G   +   G + GQKG +G +G   I  T GDKG +GD G  GV G  G                                      G PG+ GP GD GLSG PG       KG+  G  + G  G +G PG  G +G  G  G  G +G+KG++G P +G  G+ G +G +G  G  G  G++GE G  GT G+ G  G  G+ G  G PG  GL GE G+KG
Sbjct:  646 GPPGAAGLPGSPGFPGPQGDRGF---PGTPGRPGIPGEKGAVGQPG-IGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGE-PGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPG----GQGPPGSSGPPGIKGEKGFPGFPGL---DMPGPKGDKGSQGLPGLTGQSGLPGLP---GQQGTPGVP--GFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKG------------------------DKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKG--QIGPT-GDKGSRGDPGTPGVPGKDGQA------------------------------------GHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKG 1121          

HSP 10 Score: 53.9138 bits (128), Expect = 2.531e-6
Identity = 107/321 (33.33%), Postives = 129/321 (40.19%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDK------------------GDEGDR-----GPNGTFS--------IGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKG---------------------RIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGK--LGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGK---NMERGERGDKG 1198
            KGE+G PG  G  G  G QG  G  GP G KGD G  G PGT G  G  G  G PG  G                    G +G+R          FS         G +GD GE  I G       KGER   GF G  G+ G+ G  G                       GEKG  G     PK   GDKGE+G+SG  G       +    +  +                  +GE G PG    G+ G  G++G  G PG  G KG +G  G+PG+ G PG PG QG QG+ G+ G  G  G     M  GE+GD+G
Sbjct:   48 KGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGE--ILGHVPGTLLKGER---GFPGIPGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPK---GDKGEQGVSGPPGVPGQAQVKEKGDFAPTGEKGQ-------------KGEPGFPGVPGYGEKGEPGKQGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTMPLGEKGDRG 347          
BLAST of Collagen alpha-1(IV) chain vs. UniProt/SwissProt
Match: sp|P08120|CO4A1_DROME (Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3)

HSP 1 Score: 262.692 bits (670), Expect = 4.194e-69
Identity = 424/1181 (35.90%), Postives = 532/1181 (45.05%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGE---PGTVGIDGKNGTHGTPGKIGDKGDEGDRG-PNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGS----IGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMF---------------GKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVM----GKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLK--GNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGI---------QGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP-------GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----------VNSTKGDIGQKGHRGNRGFKSINITHGD-KGDKGDEGPSGVNGTTG 3766
            KGE+G PG  G  G  G QG  G  G  G+ G  GCDG+   PG  G+ G  G  G  G++G KG++G+    NG ++ G +G+ G RG  G  G  G  GE+G +G  G  G  G +G  G  GEKG       KP       G  G+ G+ GE       +S+F                K    + G  G  G+ G+ G  G KG  G  GD GL G KG+ GLPG  G  GR G  G  G  G KGDRG  G N   G  G KG       T      G  G  G                 +G PG  G  G  GL GP G  G    KGG G+PG  GN+G  G +GEKG  G+ G KG                 G  G  G  I+G  G  G  G  G KG K  RG KG  G  G+      G  G  G PG     G PG  G++G  G KG+   KC   C     G +GD G  G  G PGK+G +G  GE G  G +G DG + +   PGEKG  G  G  G  GE G+    + +      G++G  G  G  G +G +G +G+PGIPG  G+ G  GE G +G  G  G  G  G  G PG+   S +   G  G  G KGDKG+ G SGEKG    C        +E K   KG KG PG+ G+ GP G +G  G +G+ G  G+ G +G  G  G +G  G +G+    G+VG  G  GK G++G  G                        N   G +G  G+   G  G  G  GL+GE+G+ G  G  G  G DG+ G  GDRGD G  G+         +G   P    G+ G  G+PGI GV   RG +G  G   S GL+   G PG  GD G  G+ G +G  G  G  G  GP G  G  G  G+KG  GL G  G  G  G  G  G+ G+ G++G+ G+ G+ G  G  G +G+QG  G   P        EKG+ G PG  G  G  G  G P   G +G  G+   G  G  G  GD G  G +G  G+NG    +GE G  G  G  GEKG  G  G+PG  G  G  G  G  G +G  G++GD+G+ G  G            +    G  G KG RG RG   +  T  D +GDKG +G  G  G  G
Sbjct:  133 KGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKP-------GAPGIKGEKGEP------ASSF--------------PVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQ---KGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS-SC---RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC------ALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPG-----------------------RNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGV---RGRDGAKGEPGSPGLV---GMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGE---KGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKG 1241          

HSP 2 Score: 249.595 bits (636), Expect = 3.790e-65
Identity = 421/1290 (32.64%), Postives = 552/1290 (42.79%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLK-----------------------------------------GDIGCDGEPGTV------------GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE----------------------------------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLE---GIPGDRGL--KGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG--VKGKRGF------KGDKGEAAT--------KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--------MGANGTNGVIGDRGDKGFSGE------------PGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGI--------KGVQGDRGNNGTDGNCTSLGLMGERGFPGT---PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIG-----LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXX---XXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G QGFPGE G  G  G  G  G RG  GLK                                         GD+G  GEPG V            G+DG+ G  G PG  GD+G +G+ GP G  S G +GD GE G+NG  G  G KGE                                         GP+G  G  G+ G +G  G+ G  GL G+  N+ P  ++G+KG  G++G  G      G   +           +      G +G +G+ GIPG  G  G+ GE+G +   G PGD  L   G  G  G PG+KG  GRPG  G++G +G KGD G    +   G +GDKGT+ +             G  G++G  GE G  G  G+ G+NG TG  G KG DG  G     G  G P        E  +G+KG+ G PGAKG+ G +G  G   I G  G                 G KGEKG  G   G +G  G  G D   G+PG  +KG+ GF      KGDKG             C LD  K  +  +G+ G+ G TG PG  G  G+ GE G  G+KG  G    PG +G +G  G  G  G +G +G                           + G+ G+ GIPG +GQ G  GE        MG  G NG+ G++GD+G +G             PG   +  + G+ G  GI G+KG+ GP G  G A        +     +D  KGE G PG +G+ G  G  G  G                          G +G     G+ G+ G  G PG+ G +G   +  T          G          G KG++GL G  G+QG  G+ GE+G  G  G  G  G+ G+   KG +G+ G  G++G + P  T G PG KGLPG+         G +GD+G +G DG     G  GE+G  G    PG+ G++G  G  G  G +G  G  G  G  G  G  G+KG+ GL+G              G++G  G  G+ G  G  G +GE+GIRG  G+   + P  +G+ GS G +GY G KG Q      G RG TG   +       GL+G  G  G NG  G +GD G  G IG     ++GE G  G  G  G +G  G  GL GERG  G  G     G  G IG +G+KG+RG  G  G             KGD G +G +G RG        GDKGD+G +GPSG+ G  G
Sbjct:  225 LAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPG--STGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG----SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIP---------GKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEF---------------GFKGEKGLSG-APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK--MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPG------------------------NPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVA-GPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG------------------------NDGPKGFAGVTGAPGKRGPAGIPGVSGAKG--DKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGL------------PGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLP-ATVPDIRGDKGSQGERGYTGEKGEQ------GERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVG 1411          

HSP 3 Score: 246.514 bits (628), Expect = 3.647e-64
Identity = 415/1244 (33.36%), Postives = 546/1244 (43.89%), Query Frame = 2
Query:  404 IKGEQG-----FPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERG----------------------------------------PKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEG---IPGDRGL--KGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG--VKGKRGF------KGDKGEAATK--------CELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE--------MGANGTNGVIGDRGDKGFSGE------------PGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK--------GVQGDRGNNGTDGNCTSLGLMGERGFPGT---PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIG-----LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXX---XXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IKGE+G     FP +  H    G +G MG +G  GL G  G  G  G  G+DG+ G  G PG  GD+G +G+ GP G  S G +GD GE G+NG  G  G KGE G                                        P+G  G  G+ G +G  G+ G  GL G+  N+ P  ++G+KG  G++G  G      G   +           +      G +G +G+ GIPG  G  G+ GE+G +G    PGD  L   G  G  G PG+KG  GRPG  G++G +G KGD G    +   G +GDKGT+ +      D  +G           GE G  G  G+ G+NG TG  G KG DG  G     G  G P        E  +G+KG+ G PGAKG+ G +G  G   I G  G  G                KGEKG  G   G +G  G  G D   G+PG  +KG+ GF      KGDKG             C LD  K  +  +G+ G+ G TG PG  G  G+ GE G  G+KG  G    PG +G +G  G  G  G +G +G                           + G+ G+ GIPG +GQ G  GE        MG  G NG+ G++GD+G +G             PG   +  + G+ G  GI G+KG+ GP G  G A        +     +D  KGE G PG +G+ G  G  G  G                          G +G     G+ G+ G  G PG+ G +G   +  T          G          G KG++GL G  G+QG  G+ GE+G  G  G  G  G+ G+   KG +G+ G  G++G + P  T G PG KGLPG+         G +GD+G +G DG     G  GE+G  G    PG+ G++G  G  G  G +G  G  G  G  G  G  G+KG+ GL+G              G++G  G  G+ G  G  G +GE+GIRG  G+   + P  +G+ GS G +GY G KG QG       RG TG   +       GL+G  G  G NG  G +GD G  G IG     ++GE G  G  G  G +G  G  GL GERG  G  G  G     G IG +G+KG+RG  G  G             KGD G +G +G RG   +N   G KGDKGD G  G +G  G V
Sbjct:  274 IKGEKGEPASSFPVKPTHT-VMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPG--STGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG----SIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGP---------PGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFG---------------FKGEKGLSG-APGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIK--MPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPG------------------------NPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPG-IDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG------------------------NDGPKGFAGVTGAPGKRGPAGIPGVSGAKG--DKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGL------------PGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPA-TVPDIRGDKGSQGERGYTGEKGEQG------ERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERG---LNGFEGQKGDKGDRGLQGPSGLPGLV 1410          

HSP 4 Score: 229.565 bits (584), Expect = 6.548e-59
Identity = 408/1166 (34.99%), Postives = 527/1166 (45.20%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG----TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--------EANKP-----KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSEC---VKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-----VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKG------IXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGR-------QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKG---------LPGI-----KGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNG------TIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGE------KGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHG 3712
            KG+ G PG  G  G+ G++GF G  G  G    +G  G PG  G  G+ G  G PG  G KGD G +G  G    +   G +GD G  G+ G  G +G +G  G +G+ G  G +G  G  G  GEKG  G+        E  KP      + E  KG+KG  G  G       + +                        +G  GIPG  G+ G  GEKGL G PG+ G  G  G DG PG  G   + GE G  G+ G KGD+G  G++ E+GE G        +C   +    AKG KG  G  G  G  G  G+PG  G TG  G  GP GP G E    + G  G  G  G  G  GN G+ G RGIPG  G  G  G+ G    G  G                 G++GEKG  G        G +G  G PGD    G+PGV G+ G  G+KG+         P G  G  G  G  G  G  G++G KG  G  G +G+ G  G    PG  G KG  G  G  G++G  G    + A    G  G  G  G  G RG  G  G+ GI G  G  G  G+ G +G  G  G++G  G  G PGL  + + +G +G  G  G +G+ GP+G  GW  +        A   +    GEKG  G+ G+ G  G NGEKG      + G  G+ GS+G  G  G  G  G  G  G     G  G+ G+ G+PG+ G  G+KGE G +G+ G              + G KG +G++G  G        +G KG +GERG  G+ G  G  G+ G  G  G +GD   +G+QGP   +   GIPG+KG          PG+     KG+ G  G NG  G   + GL+GERG PG  G+ G       IG  G +GE G  G+ G  G DG  G  GL G+      KG+ GLNG                EG  G++G  G +G  G  G  G +GD G  G +  G  G VG+PG +G+ G KG      +DGR G  G+   G KG+ G     G  G+ G  G NG  G  G  G  G IG QGE+G +G+ GL GE            TG +G+ G KGDRG+ GE+G       G IGQKG  G     +++   G
Sbjct:  498 KGDAGIPGYPGLKGSKGERGFKGNAGAPG-DSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGA------------------------EGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIK-GEPGFHGRDGAKGDKGSFGRSGEKGEPG--------SCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGP------------PGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVG-------PIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGL--AVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGF-----------TGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGD---RGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNG---------------FEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLN--GNDGPVGAPGERGFTGPKG------RDGRDGTPGLP--GQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGE------------TGNVGRPGPKGDRGEPGERG--YEGAIGLIGQKGEPGAPAPAALDYLTG 1555          

HSP 5 Score: 224.942 bits (572), Expect = 1.404e-57
Identity = 425/1235 (34.41%), Postives = 542/1235 (43.89%), Query Frame = 2
Query:  419 GFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGD------------EGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGT-----MGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN---VMGKEGPRGDPGDDSSEGVP---GVKGKRGFKGDKGEAATKCE--LDCPKGSIGERGDLGDKGTTGF---PGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGI---PGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSST-GDKGNKGLKGNQGRQGFKGL--KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIK------------GVQGDRGNNGTDGNCTSLGLMGE---------------------RGFPGTP-------GDNGTIGDRGRRGEMGDNGTIGNTGP---DGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVI--GERGI------NGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGP---------DGDNGTIGDEGDKGMNGTIGLEGEI------------GNNGTIGDQGEK---------GRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G PG  G NG DG  G  GY G    KG  G  G PG  G  GK G  GT G  G KG             EG +G  G    G +G  G+ GI G  G+ G+KGERG KG  G      +G  GT G+ G  G+KG  G+         G KG+ G+ G  G  C+                         G +G +G  G+PG  GK+G  G  G  G PG+RG  GI G  G PGEKG  GR    G  G  G+ G   L   ++    +GDKG                          G  G KG+ G PG+ G  G+ G KG  G  G+                         G+ G PG  G  G  G  G  I+GE G  GR+G KG+KG     G KGE G        M  +G +G+PG     G P   G  G+RG+ G KG    +    ++ P+G  G RG+ G++G  G    PGK+G +G  G NG  G +G+ G S +PG  G  G  G  G  G++G  G I    A+            G  G  GD+G+ G+PG+   PG  G+ G  G +G  G  G  G  G  G  G  G        GL G  G KGD+G  G  G KG+A                   G  G PGK G AG  G +G KG KG  G  G+ G  G  G  G  G  G +G     G+ G+ G DG PG KG++G  G +G  G+ G   EKG +G  G S   GD G  G  G  G +G  GL   G  G  G+ G  GR G+DG +G  G++G+ G +G+ G      ++G PG  G PG+             G  GDRG+ G  G     GL GE                     RG PG P       GD G+ G+RG  GE G+ G  G TGP    G  G RGL G  G +GLNG  G +G +G +G  G  GV   GE+G+      NG +G IGA G  G RG  G+      GE G VG PG  G  G KG +G+    G+ G  G   A GLKGD+GP         +G  G  GD+GD+G+ G  GL G +            GN+G +G  GE+         GR G  GLPG++G  G     G  G+ G+ G  G +G+ G  G+  +   +G+ G+KG RG  G        G KGD+G+ G  G  G  G +
Sbjct:  413 GAPGPQGLNGVDGLPGPQGYNG---QKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTP-----GQKGDMGIKGDVGGKCSSC---------------------RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGR---TGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAK------------------GVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAP------------------------GNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGAD------------GSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFA-------------------GVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLA-----GEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLI 1536          

HSP 6 Score: 213.001 bits (541), Expect = 5.990e-54
Identity = 347/1027 (33.79%), Postives = 447/1027 (43.52%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGE-------------RGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDR--------------GLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDK---GFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGF---KGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGY------FGGKGVQGMPAKDGRRGNTGI 3352
            +KG++G+PG  G  G  G +G  G  G  G KG+ G  GE    G+ G  G  GTPG+ G  G  G  G +     G  G +G +G  G+ G +G KGE             +G KG  G  G+ G  G  G  GE+G  G + N  P+   G +G +G++G  GE                                 QG +G+PG  GK+G  G  G  G PG R              GL G++G+ G  G  G  G PG  G  G  GD+GD GL G +   G  G+KG    I         G  G  G +G  G  G  GS G  G+ G  GD G  G DGP G   V G                 G++G  GIPG  G  G +G  G      TG+ G  G +G  G     G+KG++G  G   G++G  G PG+  ++G PG+ G  G  GD  E   K E     G  G RGD G  GT G+PG+ G  G       L + G+ G   + G++GR G  G +G+ GEKGE G                          G++G  G PGIPG  G +G  G  GA G  G  GDRGDK   G SG PGL       GLQG+ G  G KG RG  G+ G           K ++ +    GEKG  G+ G+ GP G  G KG                                   G  G SG +G PG KGD G +GE G  G+     +        N   G  G  GL G +G  G     GL G  G IG  G+ G  G+ G+ G  G  G  G  G++G + P    G  G +GL G +G +GD+G+ G  G     GL+G++G  G PG NG  G  G  GE G  G  G    DG +GT GL G+KG+ G+   +   GP G  G  G  G  GE G  G +G IG +GE+G +G++G+ G +     PG KG+ G PG +GY       G KG  G PA       TGI
Sbjct:  652 LKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGE---KGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGN------------------------------QGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTG---------------APGKRGPAGIPGVSGAKGDKGATGL-----TGNDGPVGGRGPPGAPGLMGIKGDQGLAG-APGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGE----PGPSGLRGDTGPAGTPGWPGEKGLPG-------LAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWG------------------QPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKG------------------------------DRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQ---GFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGR---DGRDGTPGLPGQKGEPGM---LPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGI 1556          

HSP 7 Score: 192.971 bits (489), Expect = 9.124e-48
Identity = 106/275 (38.55%), Postives = 148/275 (53.82%), Query Frame = 2
Query: 4601 KGKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAINR-SEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLS--SLLPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKN 5413
            +G+ G+RG  G  GL     +G KG PG P         AA++  + IL  RH Q  T      C  G   + TGYS +   GN++    DLGSP SC+ +FS  PV+ C +   C++  RN +++WL+  + +P+  PV+  E++  ISRCVVC APANV A H Q T++   CP  W  LW GYS +MHT+   GG  Q   SPGSCLE  R  P IECN     CH +     +++  +     F +P  +T     E +  +SRC+VC+KN
Sbjct: 1521 RGEPGERGYEGAIGL-----IGQKGEPGAPAP-------AALDYLTGILITRHSQSET---VPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPMM-PVENIEIRQYISRCVVCEAPANVIAVHSQ-TIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTI-KAGERQSHVSRCQVCMKN 1777          

HSP 8 Score: 192.971 bits (489), Expect = 9.599e-48
Identity = 376/1178 (31.92%), Postives = 492/1178 (41.77%), Query Frame = 2
Query:  644 DNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK--------EANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIP---------GDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNME----------------RGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXX----------------VKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSI-----------------------GERGDLGDKGTTGFPGKNGTKGAKGENGTLGIK-----GKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGA---------NGTNGVIGDRGDKGFSGEPGL---HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGL-------KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLM---------GERGFPGT--PGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-------AIGLKGDSGPDGDNGT---------------------IGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G RG+ G  G  G KGE G  G EG  G  G KG  G  G++G KG+        +A  P +Q   G+ G  G++GKDG +  D                        G  G++G  G+PG  G  G  G KG +G P         G++G  G +G  GL G +G PG  GE+G+ G  G KG RG  G   E                +GE+G+  ++  +  T            G +G +G+ G  G +G  G  G  GD GL   DG  G + + GG G  G  GN G  G+ G+KG RG PG  G+ G  G+ G    G  G+ G+ G  G  G                        G +G  G V G  GP+G  G     G+PG  G  G  G KGE  T   L+ PKGSI                       G +G  GD G  G+PG  G+KG +G  G  G       G+ GT    G  G+KG  G  G  G+KG++G         +           R GP+GD+G  G+PGIPG DG  G  GE G          NG  G  G++G+ G +G PG         +  L   + +KGDKG  G  G KG               F    KG +G PG  G  G  G  GEKG+                            G    +G+ G +G DG PG+ G                  +        + + GDKG+ G  G +G  G   L       KG +GE GQ G  G  G DG+ G +G  G  G  G QGP       G+ G +GL G +G +G++G  G  GN    GL          G RG PG   PG  G  G  G +GE GD G  G  G  G +G+ G  G++GDAGL G              G  G++GE+G  G  G  G  G  G+ G  G++G    G KGE GSPGL G  G KG +G P  DG +G  G+T         G+ G SG  GD G                      +G +GD+G+ G  G +G  G  G  G+QG  G  G  GLPG+    G+KG  G +G  G +G  G  G  GEKG    +  G  G  G +G++G   I+   G  G+KG++G  GV G  G
Sbjct:   87 EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQD------------------------GIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPT--------HTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGL---DGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGE--PGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNG-VDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGT-AGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSS---------CRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKG------------VQGF----KGAEGLPGIPGPKGEFGFKGEKGL---------------------------SGAPGNDGTPGRAGRDGYPGIPGQS---------------IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPP------GVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGV------------SGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRD--GAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPG 1138          

HSP 9 Score: 177.563 bits (449), Expect = 4.246e-43
Identity = 353/1012 (34.88%), Postives = 464/1012 (45.85%), Query Frame = 2
Query: 1586 KGEKGYYGNV----------MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEF----------------KDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDG--KPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNS-STGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKG------------------DRGDIGQKGIQGPSNPNATMGIPGSKG---LPGIKGVQGDRGNNGTDGN------------CTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVI-----------GERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFG---------GKGVQGMPAKDGRRGNTGITAI-GLKGDSGP---DGDNGTIGDEGDKGMNGTIGLEGEIGN-NGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGE------------------NGTIGERGSPGDRGLKGEMGEKGE 4279
            KGE+G+ GN            G  G  G PG     G PG  G++G  G KG+   KC   C     G +GD G  G  G PGK+G +G  GE G  G +G DG + +   PGEKG  G  G  G  GE G+    + +      G++G  G  G  G +G +G +G+PGIPG  G+ G  GE G +G  G  G  G  G  G PG+   S +   G  G  G KGDKG+ G SGEKG    C A  ++K                    +D + GE+G+ G  G  GP GP G +G +G  G  G  G +G  G  G  G+ G +G    NG  G  GE G  +PG  G  G+ G  G  G  G  G  G  G  G+    GD+G+ GL G  GR G  G KG+ G IG  G  G  G+ G +G +G                  ++GD G  G  GP       G PG +G   +PG+ G +GD+G  G  GN               +G+ G++G  G PG  G  G  G +G  G  G  G  G  G+   +G  GE G +GL G  G  G  G  G KG+ G+            G++G +G  G+ G  GE+G +G QG+ G   PGEKG VG+PG+ G  G           G  G P   G +G  G++ + GLKG++GP    G  G  G +G++G+ G  GL   + +  G  G QGE+G  G+ G  GERG  G  G+ G          KGDRG  G  G S    +   KGDIG +G  G  G  +I    G  G  G  G  G+ G  G +G+ G  G  G  G +G  G  G  G+ G  G  G  G PG+ G  G  GL GD G +G    R ++GF G +G  GD+G +G  G+    GL GQKG+ G P L  +               G  G +G  G++GT G+ G+ GE                  NG  GE G PG+RGL G  GE+GE
Sbjct:  513 KGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCS-SC---RAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSC-ALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWG--QPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGA---------KGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGV-TIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLP---GLVGQKGDTGYPGLNGNDGPVGAPGE-----RGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGE 1499          

HSP 10 Score: 142.51 bits (358), Expect = 2.404e-32
Identity = 278/831 (33.45%), Postives = 351/831 (42.24%), Query Frame = 2
Query: 1598 GYYGNV---MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNK--GLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGP-----------------------------SNPNATMGIPGSKGLPGIKGVQGDRGNN-----------GTDGNCTSLGLMGERGFPGTPGDNGTIGDRG---------RRGEMGDNGTIGNTGPDGENGT------RGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGE---------------RGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDS------GPDGDNGTIGDEGDKGMNGTIGLE-------------GEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG----DSVNSTKGDIGQKGHRGNRGFKS--------INITHGDKGDKGDEGPSGVNGTTGYV 3772
            GY G V   + ++G RG PG     G  G+KG+ GF G +G +  K +    KG  G  G  GDKG  G PG +G  G  G  G  G  G  G + K G  G+ G  G  GL G  G  GY  +  +    GE  K+      G +G+ G +G  G+ G  G  G  GE G +G  G  G RG+ G  GE G      ++   G  GIKG+K      GE   +     T  V        + G+KG PG +G  G  GP G+ G+ G  G+ G  GG GD G+ G  G  G  G+    G  G +G  G PG KG+ G  G  G  G++G  G  G                  G  G QG  G  GL G +G  GQ G  G  G  GN G  G +G+ G  G+ GP                                    GIPG  GL G KG +G +GN            GT G   + G  G+ G PGTPG  G +G +G         R G  GD GT G  G  G++G       RG  GE+G  G+NG  G  G  G  G  G+ G  GE               +G  G  G  GA+G QG +G +G+ G   PG KGE G  G KG  G  G  G P + GR G  GI    +KG+       G  GD G+ G  G+KG  G+  L+             G+ G  G  G+ G  G RG TGL G  G  G  G+ G  G  G  G KG++G +G  G    D +    G  GQ G RG  G           +N   G+KGD+G  GP G  G  G V
Sbjct:   76 GYAGCVPKCIAEKGNRGLPG---PLGPTGLKGEMGFPGMEGPSGDKGQ----KGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMK--PGAPGIKGEK------GEPASSFPVKPTHTVMGPRG---DMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPG--IPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSV 886          
BLAST of Collagen alpha-1(IV) chain vs. UniProt/SwissProt
Match: sp|Q5UQ13|COLL2_MIMIV (Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R196 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 1.182e-65
Identity = 415/1123 (36.95%), Postives = 547/1123 (48.71%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKN--GTHGTPGKIGDKGDEGDRGPNGTF----SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGK----------------DGT--------------SEKPGEKGRKGSKGSN---------------GLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGE---RGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYF------------------------GGKGVQGMPAKDGRRGNTGITAIGLKGDSGP-----DGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPG 3526
            +G+QG+ G+ G  G  GQ+G  G  G  G KGD+G  GE G  G  G    G+ G+ G +G+KGD+G++G  G      S G +GDNG +G NGT+G NGTKG+ G KG +G +G NG KG KG IG+ G+KG + NK     GDKG KG  G  G+                                 +G  G  G +G  G  G+KG++G  GD G KG+KGD+   G+KG  G  G++G+ G  GDKGD G  G N + G +GDKG   I            KG KG KG  G+ G KG+ G+ G  GT GD G+KG  G +G + +KG            + G   +KG +GI G KG  G        I+G+ GS                  KG+KGY G +       G  GD+  +G  G KG  G KGDKGE          KG IGE+GD G+KG  G  G  G+KG KGE G+  + G+                D T              ++  GEKG KG  G +               G  G+KG  G I         G+ G KG KG  G +GD+G +G  G  G +G  G  G  G  G  G IG +G KG SG      ++  +G +G KG KG+KG++G +G+KG                   NKG+KG  G  G  G  G  G+KG KG  G  GS G KGD G +G+KG++G++G     G  G+ G  G  G KGD+GIKG  G+ G  G              S GDKG KG KGN+G +G KG KGE+G  G+ G+ G  G  G+ G KGD G  G  G++G    +   G  G KG  G KG++GD+GN G  G+  + G  G RG  G  G  G  GD+G +G  GD G  G +G  G+ G +G  G KGD G  G +G++G  G KG+KG++G  G+   +G+ G+KG  G +G  G +GD+GIKG  + G+KG  G  G KG                          G KG +G     G +G TG++  G KGD G       GD G  GD+G KG  G  G++G+ G+ G  GDQG KG +G  G  G
Sbjct:  182 QGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKG--DNGDKGNKGDKGDIGD---------------------------------KGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGI------------KGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKG------------ESGANADKGDKGIKGDKGDKG--------IKGDDGS------------------KGDKGYNGEI-------GQKGDNGEKGDNGEKGDNGEKGDKGE----------KGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKG-------------------NKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKG--------------SKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKG--TNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLSIKGDKGDKGEFGLSIKGDKGVKGDQGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDKGDKG 1167          

HSP 2 Score: 230.335 bits (586), Expect = 2.470e-59
Identity = 405/1233 (32.85%), Postives = 554/1233 (44.93%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGC---------------DGEPGTVGID------------------GKNGTHGTPGKIGDKGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEK---GLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEK---------------GEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGD------------------RGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFK-DR-NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXX-------XXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGT------IGLEGEIGN---------------------------NGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            ++GE+G  G++G  G  G++G +G +G  G+KG  G                +GE G V ID                  G  G+ G  G  GD+G +GD+G  G F S G +GD G+ G  G  G  G KG++G  G +G+ G  G KG KG  G+KG+KG      K  EG KG+ G+ G +G    +  +  N                        G  G  G +G NG  G+K   G  GI GD+G KG  GD G  G+KG  G  G +G++G IGDKGD G  G   ++G+ GDKG     N T  D               G+ G+KG  G+ G+ G  GD G KG +G  G++  KG                  + G +G  G KG  G +G  GT  +G+ G  G +G              G KGY G++ G +G +G+ G ++ +G  G+KG +G KG KG+  +K +     G IG++GD G+KG  G  G NG KG KGE G +G KG +G     GEKG KGSKG  G +G                 G+I   + T             +    G +GD+GE G     G  G  G  GE+G  G  G  GD                  +GDKG  G+ G   +   +G +G +GIKGDKGN+G  G+KG         +  +  FK D+  KG+KG  G  G  G  G NG+KG                                   GS G+ G  G  G+KGD+G KG  G                +            GDKG+KG KG +G +G KG+KG  G  G  G+ G  G  G+ G KG++G+ G KG +G      + G  G KG  G KG  G +GN G  G+    G+ GE G  G  GD G  GD+G  G+ GD G  G  G  G+ G +G+ G KGD G                  I+G  G++GI   KG+ G++G++G +G++G K     G+KG+ G+ G+KG  G KG++G+    G +G  G+     KG  G  GD GT GD+GDKG+ GT       GLEG+ GN                            G+ GD+G++G +G+TGL                        KGD+G  GE G S+   KG  G +G++G++G K I    GDKG KGD+G  G  G  G
Sbjct:   97 LRGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGE-GSKGSKGDVGNKGDKGNKGDKGIKG-----DKGSEGIKGDNGIKGDNGTKGDNGTKGDN------------------------GTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKG-DNSTKGDK--------------GDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKG------------------DNGIKGDKGDKGTKGDKGDKGT--KGDNGDKGTKGDN------------GIKGYKGDI-GDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDK-GYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGD---KGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKG------------------------------NKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKG------------------IKGSEGDKGI---KGESGSKGDKGEKGNKGYK-----GDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGV-----KGTKGDKGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLS----------------------IKGDKGDKGEFGLSIKGDKGVKGDQGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDKG 1164          

HSP 3 Score: 224.557 bits (571), Expect = 1.703e-57
Identity = 387/1079 (35.87%), Postives = 521/1079 (48.29%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTV---GIDGKNGTHGTPGKIGD---KGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPK---GFEGTMGVNGTKGSKGRIGEKGLKGKEANK----PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMER------GERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDI------GLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--------------MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGT---------------------------NGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTI 3442
            KG +G  G  G  G  G +G  G +G  G+KGD G  G+ GT    G  G NGT G  G IGD   KGD+GD G NG     G +GDNG++G  G +G  G KG +G K   G +G +G  G KG KG IG+KG+KG  + K        +GDKG+ G+ G  G+N T      N                  G +G +G+ GI G  G  GT G+KG +G  GD G KG KGD+G+ G KG  G  G +GE G   DKGD+G+ G   ++      G +GDKG    I     + +KG  G KG  G  G+ G KG IG  G NG  GDI      G KG  G +GS  + G                      +GIP      G +G     I+  TG + ++           +G KG+KG  G                +G +G +G  GD   +G  G KG  G KG+KG+  +K +    KGS G++GD GD+G  G  G  G KG KG+ G+ GIKG+ G++   G+KG KG KG+ G  G KG+ G         T+G++G KG+KG  G +G +G++GI G  G  G  G                             G+ G  G+ G  GD+GDKG  G  G   +   +G +G KG KG KGN+G  GEKG+  +  +  + K ++    +KG+KGF G  G+ G +G  G+KG                           + G    NG  G+ G+ G  G KG+EG                            GDKGNKG KGN+G +G KG+KG +G+ G  G+ G  G+ G +G+KGD+G+ G KG +G       +GI G KG  GIKGV+G +G+ GT          G +G  G  GD GT GD+G +G  G NG  GN         +GL G+K      G IG +G  G KG KG +G  G++G+NG KG  G +G+QG +G+ G+   S  G+KG+ G  GL    G KGV+G     G +G+ GI   G KGD G  GD G  G++GDKG  G +
Sbjct:  235 KGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDN------------------GTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFG----------------------QGIPSPD--LGNDGD--IYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGD----KGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKG---------TNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGD---KGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGE-KGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKG---------------------------DSGIKGENGLKGDVGDKGIKGDKGNEG--------------------------DKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGT---------KGVKGTKGDKGDKGTNGDKGDKGIKGTNGDKGN---------KGLEGDK------GNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGL---SIKGDKGDKGEFGLS-IKGDKGVKGDQGYKGDKGDKGIK--GDKGDKGIKGDQGIKGNKGDKGDKGNL 1169          

HSP 4 Score: 169.088 bits (427), Expect = 1.752e-40
Identity = 331/961 (34.44%), Postives = 427/961 (44.43%), Query Frame = 2
Query: 1040 RGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRG---LTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGS-----------KGLPGI-------KGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGD------------------RGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQG----------MPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            RG KG KG  G+ G KG  G  G QG +G  G  G  G   L G+ + R   G+ G   I   T   Y K    +      + ++G KGS G+ G  G  G  G KG  G  GS   KG                      +G  G KG  G +G  G   EG  GS G  G KG+KG+K  +G+KG+KG  G + G  G +GD G   ++G  G KG  G KGDKG+      +   KG IG+ G  GDKG  G  G  G KG KG+ G  G+KG        G+ G KG  G  G+ G+KG+IG       N T G++G            D G +G  G  G  G  G NG  G NG NG  GD+GD G  G+ G    +  +G +G KG  GDKG +G +G KG+  D      +K     + +KG+KG  G           G+KGIK                                +GS G+ G +G+ G KGD                              G+KG+ G KG+ G +G KG KG+ GE G NG  G IG  GN G+KGD+G+IG   + G   P+  +G  G            K L GI       KG +GD+G +G   N    G  G  G  G  GD G+ GD                  +G +G  GD G+ G+ G  G+ G +G  G KGD G  G IG +G  G  G    +G  G +G  G+KG  G +G++G  GD+G KG   S G+KG  G  G+KG  G KG +G                +       + G KGD G  G  G  GD+GDKG+ G  G +G+    G+ GD+GEKG +G  G  GE+G                   KG++G  GEKG   N  KGD G KG +G+ G K  NI  G KGDKGD G  G NG  G V
Sbjct:   98 RGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIMYKKINGIW------IPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKG---------------------DKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEG-IKGDNGIKGDNG---TKGDNGTKGDNGTKGDKGDIGDNG-IKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGD------KGDIGDKGDIGDKGMKGDKGDIGDKGMKGDNSTKGDKG------------DNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDI-GDKGIKGESGANADKGDKGIKG---------DKGDKGIK------------------------------GDDGSKGDKGYNGEIGQKGD-----------------------------NGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGD---KGSKGDKGEKGSKGNKGEKGEKGF------------------KGEKGSKGEKGSKGN--KGDKGDKGFKGDNGIKG-NI--GVKGDKGDSGIKGENGLKGDV 913          

HSP 5 Score: 155.992 bits (393), Expect = 1.838e-36
Identity = 281/800 (35.12%), Postives = 369/800 (46.12%), Query Frame = 2
Query: 1655 SSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLG-DKGTTGFPGKNGT--------KGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGL---------------VGEKGEIGYINR-TAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQ---------NGTNGEMGANGTNGVIGDRGDK--GFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGE---NGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKD-GRRG------NTGITAIGL----------KGDSGPDGDNGT---------------IGDEGDKGMNGTIGL---------------EGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKI------GEKGDSV----NSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            S  G+PG+KG +G  G    +        P+  +G  GDL  +  T     KN +        +G KGE G LGI G  G   + G +G KG KGS+GL                GE G++ YI++ T             + G  G +GDQG +G  G  G  GQ          G  G+MG  G  G  GD+GDK  G  G  G   N+  +G +G KGIKGDKG+ G  G+ G   D N T      +  +  KG+KG  G  G+ G  G  G+ GI    G  G+ G  GD G  G+KG+ G++G     G +G+ G+ G  GMKGD+G                        NS+ GDKG+ G KG++G  G KG KG+ G  G NG  G  G  G+NG KGD+GD G KG +G        G  G+KG  GIKG +GD G+ G  G   +    G++G  G  GD G  GD G +G+ G NG IG  G +GE   NG +G  GEKGD G                   +G IGE+G NG KG IG +G +G +GD           KGE+GS  L   FG    QG+P+ D G  G      NTGI    L          KG+ G  G++G                IG++GDKG  G IG                +G+ G+ G  G +G+KG +G  G+ G++               G  G+KGD+G I      GE G +V      TKGD G KG +GN+G K    T+GDKG+KGD+G  G  GT G
Sbjct:   39 SIPGIPGIKGDKGLTG----SRIFLRNGIPQNELGTNGDLYINLLTDDLYFKNDSFWSLVGNLRGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDV-YIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGD-NGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGI---KGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKG--------------DIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGE------------------KGDIGEKGDNGEKGDIGEKGNKGSKGD-----------KGEIGSSIL---FG----QGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDK---------------GNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKG---TNGDKGNKGDKGSKGDKGTKG 761          

HSP 6 Score: 133.65 bits (335), Expect = 9.458e-30
Identity = 163/415 (39.28%), Postives = 220/415 (53.01%), Query Frame = 2
Query: 2660 NQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGN---------------------------TGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGPDG---DNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKG------DEGPSGVNGTTGYV 3772
            N+G +G KG KG +G+ G  G  G  G  GN G KGD+GDIG +GI+G S      G  G+KG  G KG +G++G+ GT+G+       G +G  G+ GD GT GD+G +G+ GD G+ GN                            G  G+ G++G  G+KGD G+ G  G +G          +G  G++G  GSKG  G +GE+G +G++G KG    G KG  G  G KG+ G  G++G     G +G++GI    GLKGD G  G   D G  GD+GDKG  G  G  G+ G+ G  G++G+KG +G  G  G +G  G KG  GE G  G  G+KGD+G +G KGD        V  TKGD G KG +G +G K    T+GDKGDKG      D+G  G+ G  G +
Sbjct:  663 NKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGD------KGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGD---------KGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKG--EKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNI 1060          

HSP 7 Score: 108.612 bits (270), Expect = 4.180e-22
Identity = 205/548 (37.41%), Postives = 260/548 (47.45%), Query Frame = 2
Query: 2849 LPGIKGVQGDRGNN---------------GTDG--------------NCTSLGLMGE-RGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGT---------RGLTGEKGD---------------------AGLNGTIXXXXXXXXXXXXXIEGVIGE---RGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGD----SVNSTKGDIGQKGHRGN---RGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKGE 4279
            +PGI G++GD+G                 GT+G              N +   L+G  RG  G  G  G +G +G +GE+G  G  G  G DG NG+         R   GE GD                      GL G+ G +G  G +G KG +G  GE    G  G KG +G +GE G +GD+G KG  S G KG+VG+ G KG  G KG++G    +G +G+ GI    G KGD+G  GDNGT GD+GD G NG  G +G+IG+NG  GD+G KG  G  G  G++G IG KG+            KGD+G IG+KGD     +   KGDIG KG +G+   +G K  N T GDKGD G +G  G NGT G                                      G  G  G  GDNG+ GD GDKG    +   G  G  G  G KG  G KG KG  G +G KGE+G         KG +G +GD G  G  GD G  G  G +G IG+ G+NG  G+ G  GD G KG+ GEKG+
Sbjct:   40 IPGIPGIKGDKGLTGSRIFLRNGIPQNELGTNGDLYINLLTDDLYFKNDSFWSLVGNLRGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGM------------KGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKG------------------------------------DNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANA-----DKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGD 534          

HSP 8 Score: 96.6709 bits (239), Expect = 1.943e-18
Identity = 193/506 (38.14%), Postives = 240/506 (47.43%), Query Frame = 2
Query: 2795 IQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPG-TPGDNGTIGDRGRRGEMGD--NGT----IGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINI-THGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXX-XXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKGEN 4282
            ++G       +GI G KG  G  G QG +G  G+DG   S  L G+ G P    G+NG +      G M    NG     +G  G  G+ G +G  G KGD G                   +G  G  G  G KG +G +GE G +GD+G KG  S G KG+VG+ G KG  G KG++G    +G +G+ GI    G KGD+G  GDNGT GD+GD G NG  G +G+IG+NG  GD+G                                 NKGD G  G KGD     KGDIG KG +G++G    +I   GD GDKG +G  G  G  G  G     GDKG  G  G  G  GI G  G+ G KG  G  G  G  GDNG+ GD GDKG    +   G  G  G  G KG  G KG KG  G +G KGE+G                    G  G  GD+G  G+ G  G  GE G+NG  G+ G  GD+G KG++GEKG+N
Sbjct:   97 LRGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQ-GLPRPYEGENGDVYIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQ------------------KGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKG---------------------------------NKGDNGDKGNKGD-----KGDIGDKGMKGDKG----DIGDKGDIGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDN 541          
BLAST of Collagen alpha-1(IV) chain vs. UniProt/SwissProt
Match: sp|A0MSJ1|CRA1B_DANRE (Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 6.037e-60
Identity = 357/1078 (33.12%), Postives = 472/1078 (43.78%), Query Frame = 2
Query:  479 RGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGE------------KGTPGRPGEQGE---QGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV-----MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAK------GENGTLGIKGKDGTSEKPGEK---GRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKG----------IQGPSNPNATMGI---------PGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGE---KGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGI------RGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTI------GDQGEKGRRGKTGL 3520
            R P G+KGD G  G PG  G  G+ G  G PG  G  GD+G RGP+G+         G +G  G QG+ G  G  GPKG  G +G+ G  G  G  GE+GL G    K     G  G  G  G  GE        +          G+ G+ G  G  G  G++G  G +G  G  G KG+ G PG+ GLKG KG+ GLPGE            +G+PG PG QG+   QGKIGD+G  GL G     G  GD G            + G +G  G  G  G  G +G +G  G  G  G  G KG  G  G E +KG                       G+ G  GM G+ G  G +  G  G +G  G KG++G+    G  GEKG  G+       G  GP G PG   S G+ G +G +G +G +G          P G +GE+G +G KG  G PGK G  G        GE G  G  G  G +  PG K   G  G +GS G++G  GEIG I                           G+QG+PG PG  G  G+ G +G     G+IG RGD G  GE G    +  +G QG  G++G+ G +G  G KG                    +G  G PG +GV GP                                           G  G+ GE GKPG KG +G                     L    + G++G+ G  G +G +G  G  G  G++GQ G  G +G +G+ G +G  G  G KG          ++GP  P+  +G          PG  G PG++GVQG+RG  G  G     G  G RGFPG  G  G  G +G+    G++G  G+ GP G  G RG+ G    +G+ GL+G  G  G  G  G  G +G +G  G  G +G  GA G  G+      +G++GI G S  PG++G  G  G  G  G +G +G P   G +G  G+  +G+ G  GP GD G +G +G KG  G +G++G IG  G I      G QG+KG +G+ G+
Sbjct:  483 RAPSGIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGS--------PGAKGYPGRQGLPGPIGNMGPKGVRGFIGIPGIFGLPGADGERGLPGVPGKK-----GKMGRPGFPGDFGERGPPGPDGNP---------GEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKG---------------------EPGMTGNPGMLGERGPVGFV--GPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARG----------PDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPG---------------------KAGDQGLPGEPGEKGAVGSPGNIGE---QGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIGFKG-------------------TEGRTGDPGLIGVKGP------------------------------------------EGKPGKIGERGKPGEKGSKG-----------------HQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPG---VPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGV--LGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKGEMGV 1398          

HSP 2 Score: 209.149 bits (531), Expect = 9.150e-53
Identity = 338/987 (34.25%), Postives = 436/987 (44.17%), Query Frame = 2
Query:  962 GEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDR---------GLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-----VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSN---GLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGW-----AEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXX----------------XXXXXXIEGVIGER------GINGSKGKIGARGEQGIRGDQGIKGGSSP-------GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            G +G+PG+ G+ G  G+KG  G  G  G +GI+G DG PG KG PGR G  G  G +G KG R         GL G + ERG  G  G    +       D G +G  G  G  GEIG+ G +G PG  G  G +G+ GP G +G                            +G+PG  G  G +G  G L + GE G                 G +G+KG  G+     V GK GP+G  GD   +G+PG  G  GF GD G       ++ PKG+ G RG  G  G  G  G  G  G  G  G  G  G+ G S  PGE+G KG  G     G++GE+G +G++                  G  G +GD+GE G PG P         GE GA G  G  G+RG  G +G PG H +  + G +G KG +G +G  GP GEKG       E       +     K    GE G  G  GV GP GP G KGI G  G  GS G  G  G+ G  G  G+ G     G  GE G  G PG  G++G+                           G +G+ G+ G  G  G  G KGE+G++G  G +G  G+ G  GT+G  GD G  G++GP      +G  G  G  G KG QG  G  G  G     G +G +G  GT G  G  G  G++GE G  G  G+ GP G  G+ G  GEKG+ G +G +                         G  G+EGV GER      G+ G+ G  G  G +G +G++G KG +SP       G  G VG PG +G  G +G +G P  DG  G  G  A G+ GD G DGD G  G  G +G  G  GL G     G+ G +GE+G  G +G PG+RG                    G  G  G++GD     +G  GQ G  G +GF  +    G +G  GD GP G+ G  G
Sbjct:  493 GLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDGSPGAKGYPGRQGLPGPIGNMGPKGVRGFIGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGP---------------------------KGVPGNPGEPGLKGDKGELGLPGEPGE---------------PGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNG-VEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGE------------MGLAGEKGDRGETGQPGPP---------GEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGL--------------------------IGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDG--AKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGV---QGSFGPKGERGITGHSGPPGKRGL------------------NGGMGFPGKQGD-----QGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKG 1361          

HSP 3 Score: 199.134 bits (505), Expect = 9.626e-50
Identity = 319/967 (32.99%), Postives = 410/967 (42.40%), Query Frame = 2
Query:  413 EQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGK-----------------EANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIG---NTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIK 3232
            E G PG +G  G  G  G +G  GP GL G  G  G PG  G+ G  G  G PG+ G+ G +GD+G  G+  + G +G  G +G  G +G +G  G  GP+GF G +G  G  G +G  G  G++G                   A  P + EG  G KG+SG  GE                                 +G  G PG  G  G  GE+G  G  G  G  G+ G+ G  GE G PG PGE+G  G  G  G+RGL+G     G  G +G +                     G  G  G++G+ G  G  G  G +G+KGP+GP G + + G +G  GE G  G  G  G +G  G PGAKG+ G+ G  G+       GE G+IG  G+ G++G     G KG  G  GN+   G  GPRGDPG D   G  G  G +G +GD                +G  G+ G+KG  GF    GT+G  G+ G +G+KG +G   K GE+G+ G KGS G  G+ GE+G +                           GEQG  G  G  G  GT G MGA G  G           GEPGL   E  QG QG  G  G KG +G  G+ G  E     S    +     N+G++G PG  G  G  G  GE+G                              K    G  G SG  G PG KG +G                        NS  G+ GN+G  G  G  G +G+ G  G  G+ G  G  G DG  G  GD G  G  G+ G   P    G PG  G+ G  G +G+RG  G  G     GL G  GFPG  GD G  G  G  GE G  G +G     GP G+ G  G+ G KG  GL G               ++G IG  GI G  G  G +G++G +G+ G++
Sbjct:  608 EIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGL-EGRPGRKGISGNPGE---------------------------------EGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLS---------------------GTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGD----------------VGLEGESGEKGVIGF---KGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGAL---------------------------GEQGDTGFIGPKGSRGTTGFMGAPGKMGQ---------QGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPS---GDIGPVGNRGDRGEPGDPGYPGLEGVQGERG------------------------------KEGAPGVPGNSGPRGFPGPKGSKG-----------------NKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGIQGPKGPQGLMG---------------MQGAIGPVGIIGPSGNPGPQGDKGNKGEMGVQ 1399          

HSP 4 Score: 188.734 bits (478), Expect = 1.499e-46
Identity = 282/880 (32.05%), Postives = 381/880 (43.30%), Query Frame = 2
Query: 1277 GEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRG------FKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKG------------DKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGF---PGKMGVAGPVG---PNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGN------------------TGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIG-LEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G+ G KG  G+PG +G  GD G++GPDG                                  PGAKG  G++G  G +  G  G                   KG +G+    +G  G  G PG D   G+PGV GK+G      F GD GE           G  G  G++G  G  G PG  G  G  G  G  G+ G  G    PGE G KG KG  GL GE GE G+                        +GD+G QG PG+PG  G+ G  G++G  G +G+ G  G +GF G+ G      ++G +G  G++G            D+G  GP+G  G  E       +  N  ++  KGE G    PG +G  GPVG   P GE G+                                  G  GE+G+ G PG KG  G                          + G  G++GL G +G +G +G +G  G +G+ G  G  G +G  G +G  G +G+ G  G + P    G+ G  G PG KG+ G+ G  G+ G    LG +G  G PG  GD G  G+ G +G +G  G IG                   +GPDG  G +G  G +G++G  G IG +G  GR G     G+IG +G  G  GKIG RG+ G +G +G +G      + GE+G+ G  G KG  G  G  G P K G++G  G+  +G +G  GP G  G+ G +G+KG  G  G +EG  G +G IG  G +G RG+ G PG  G  G                +G+RGK G  G   NS  +G  G KG +GN+G K  N   G+ G++G  GP GV G  G +
Sbjct:  502 GQPGRKGQKGHPGPSGHPGDQGIRGPDG---------------------------------SPGAKGYPGRQGLPGPI--GNMGP------------------KGVRGF----IGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPP-------GPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGF------------------------QGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGL-EGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLA------------------------------GEKGDRGETGQPGPPGEKGAMG-----------HPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIGFKGTEGRTGD---PGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGL--VGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGV---------------QGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVI 1231          

HSP 5 Score: 187.193 bits (474), Expect = 4.360e-46
Identity = 319/957 (33.33%), Postives = 421/957 (43.99%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGID------------GKNGTHGTPGKIGDKGDEGDRGPNGTF----------SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLK---GIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGD---IGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTN----------------------GVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGE---KGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGT 3094
            ++G  G PG  G  G DG++G  G     G KG +G  G PG  G              G  G  G PG IGD G  G  GP G              G +GD GE G+ G  G  G +G++G +G  G  GV G  G +G+IG++G  G      P+   GD G  G +G +G       R      G  GL G             QG +G  G  G  G  G KG+ G PG+ G+K   G+ G+ G+ GE+G  G  G  GE G  G+KGDRG TG+    GE+G  G              GA G  GS+G  G  G KG+ G  G +G  G+   +G+KGP+GP G + + G +G  GE G  G  G  G +G  G PGAKG+ G+ G  G+       GE G+IG  G+ G++G     G KG  G  GN+   G  GPRGDPG D   G  G  G +G +GD                +G  G+ G+KG  GF    GT+G  G+ G +G+KG +G   K GE+G+ G KGS G  G+ GE+G +         G +G +G  G  G  G  G+QG PG+ G +G  G  G +G+ G                        G +G+RGD+G  G+PG    E +QG +G +G  G  GN GP G  G       +   K  + K+  +GE   +G PG +GV GP                                           G +G  G +G+PG+ G                             + G  G KG+ G+ GR G  GL G+ G  G  G  G  G+ G+ G KG+RG  G  G  G    N  MG PG +G  G KG  GD G  G  G    LG+ G +G PG  G  G  G +G +G MG  G IG  G  G +G  G  G+KG+ G  G 
Sbjct:  554 VRGFIGIPGIFGLPGADGERGLPGVP---GKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGD------------QGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGEPGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGD----------------VGLEGESGEKGVIGF---KGTEGRTGDPGLIGVKGPEGKPGKIGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPG----PKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGP------------------------------------------RGVIGREGFEGEPGLDG-----------------------------AAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGITGHSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPG---VLGIFGPQGPPGDFGPVGIQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKGNKGEMGV 1398          

HSP 6 Score: 150.984 bits (380), Expect = 6.324e-35
Identity = 266/811 (32.80%), Postives = 347/811 (42.79%), Query Frame = 2
Query:  407 KGEQGFPGE---MGHNGTDGQQGFMGYRGPVGLKG---DIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQE-GDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL----IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQ 2800
            KG  G PGE    G  G  G  G +G RGPVG  G   ++G  GE G  G  G+ G  G  G +G  G  G+RG +G    G  G +G RG++GT+G  GT+G RGP G  G  G+ G KG +G  G++GL G+     KI E G+ G  G +G  G       +                        GI GE G  G  G  G  GE G  G+PG  G +G+ G+   PGEKG  G PG  GEQG IG +GD G+ G+    G  G KG    +                     GE G KG IG  G  G TGD GL G  GP G     G                      RG PG KG  G +G+ G +     +G+TG IG +G +G  G   A G  G++G  G V   G +GP+G      S G PG KG++G +GD G+           G +G RGD G+ G  G+PG  G +G +G+ G  G+ G  G    PG KG KG+KG  G    +GE G  NR +        G  G +G  G  G +GE G+ G  G DG  G  G++G +G  G+ G  G +G +G PGL     +QG  G KG +G  G+ GP G++G                     G  GFPGK G  G                                            G  G++GE G PG+ G  G                            GD G  G++G +G QG  G++G  G +G       IG  GN G +GD+G+ G+ G+Q
Sbjct:  765 KGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSG--PAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGLSGQMG---KIGETGEAGPTGFTGVQGPTGPPGAK------------------------GILGEPGPQGSPGVLGPLGEIGAIGLPGKAGDQGLPGE---PGEKGAVGSPGNIGEQGLIGPRGDPGVDGEAGPSGPDGAKGEQGDVGLE------------------GESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKPGKIG---------------------ERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGAPGKMGQQGEPGLVGYEGHQGPQG------SLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESG--NRGSPGPV----GVPGPRGVIGREGFEGEPGLDGAAGKDGAKGMPGDLGRDGDVGLPGKPGPQGNAGAPGLPG---VQGSFGPKGERGITGHSGPPGKRGL-------------------NGGMGFPGKQGDQG------------------------------------------FKGQPGDAGEQGFPGVLGIFG-----------------------PQGPPGDFGPVGIQGPKGPQGLMGMQGAIGPVG------IIGPSGNPGPQGDKGNKGEMGVQ 1399          

HSP 7 Score: 106.301 bits (264), Expect = 2.200e-21
Identity = 227/741 (30.63%), Postives = 288/741 (38.87%), Query Frame = 2
Query: 2114 NGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLG---LMGERGFPGT---PGDNGTIGDRG---RRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXX---------XXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSP-GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKG 4276
            +G+ GD G  G  G+PG    +  +G  G  G  GD+G RGP G                      + G KG+PG+ G+ GP+G  G KG+                                  G +G  G  G PG  G+ G+                              G  G KG  GR GF G  GERG  G +G  G IG  G  G  G  GD+G  G+ GP       G+PG+ G PG+KG +G+ G  G  G     G   + G  G PG    PG  G IGDRG     G +G  G  G+ GP G+NG  G    KG+AG+ G  G  G  G           G  G+EG  G +GI+G+ G+ G +GE G+ G+ G+ G   P G  G  G  GL G  G +G  G P   G +G  G   A G +G SGP G  G  G  G  G  G  G  G  G +G +G++G  G +G  G PG++G                    G  GKIGE G++     G  G +G  G  G K I    G +G  G  GP G  G  G                                            G  GD GL G+PG+KGA                         G  G  G QG  G  G+P              G DG+ GP G  G  G+ G  G+ GE GE G IG +G+ G  G  G +G KG
Sbjct:  486 SGIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRGPDG----------------------SPGAKGYPGRQGLPGPIGNMGPKGV---------------------------------RGFIGIPGIFGLPGADGERGL-----------------------------PGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEG---PKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGHPGAPGERGLSGPAGAPGPHGSRGLSGTRGPKGTRGARGPDGPVGEKGMMGMKGPEGPPGKQGL------------------SGQMGKIGETGEA--GPTGFTGVQGPTGPPGAKGILGEPGPQGSPGVLGPLGEIGAIGL------------------------------------------PGKAGDQGLPGEPGEKGAV------------------------GSPGNIGEQGLIGPRGDP--------------GVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKG 1039          

HSP 8 Score: 69.707 bits (169), Expect = 3.272e-10
Identity = 125/354 (35.31%), Postives = 155/354 (43.79%), Query Frame = 2
Query: 2813 PNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGP------------------DGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS----------TKGDIGQKGHRGNRGF------KSINITHGDKGDKGDEGPSGVNGTTGY 3769
            P+   G PG  GLPG  G  G +G  G  G     G  G RG       +G+ G +G  G  G  G IGN GP                  DGE G  G+ G+KG  G  G  G  G  G  G  G  G IG  G  G  G IG  G  G+ G  G+ G    G  G  G PGLKG  G  G+ G P + G +G+ GI  + GL G  G  G  G IGD G  G+ G +G EG  G+ G  G  G +G +G  G+ G  G  G  G+ G+ G +G +G  G  G+ G KG S N             G+ G  G RG  GF        +    GD+G+ G  GP G  G  G+
Sbjct:  485 PSGIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIRG------PDGSPGAKGYPGRQGLPGPIGNMGPKGVRGFIGIPGIFGLPGADGERGLPGVPGKKGKMGRPGFPGDFGERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPK--GVPGNPGEPGLKGDKGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEGPKGNAGVRGIPGPGGLPGLEGDQGPVGPAGAPGLEGRPGRKGISGNPGEEGMKGEPGMTGNPGMLGERGPVGFVGPFGEMGLAGEKGDRGETGQPGPPGEKGAMGH 830          

HSP 9 Score: 65.855 bits (159), Expect = 4.027e-9
Identity = 103/307 (33.55%), Postives = 131/307 (42.67%), Query Frame = 2
Query: 2864 GVQGDRGNNGTDGNCTSLGLMGERGFPG------TPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            G+   R  +G  G+   +GL G+ G PG       PG +G  GD+G R            GPDG  G +G  G +G  G  G +G             +GV G  GI G  G  GA GE+G+ G         PG+KG++G PG  G FG            R         G  G  GP G  G IGD G  GM G  GL G  G  G  G+ G KG +G+ GLPGE                G+ G +GD+G  G  G  +   +G  G +G  G+RG   +    G +G  GD GP G NG  G
Sbjct:  478 GISPGRAPSGIKGDPGLVGLPGQPGQPGRKGQKGHPGPSGHPGDQGIR------------GPDGSPGAKGYPGRQGLPGPIGNMGP------------KGVRGFIGIPGIFGLPGADGERGLPG--------VPGKKGKMGRPGFPGDFG-----------ERGPPGPDGNPGEIGAPGPVGIPGFIGDMGPVGMVGPPGLIGPKGVPGNPGEPGLKGDKGELGLPGE---------------PGEPGFQGDKGIQGSPG--LPGVQGKPGPQGKIGDRGPDGLPGPLGPEGFPGDIGPPGQNGVEG 724          
BLAST of Collagen alpha-1(IV) chain vs. UniProt/SwissProt
Match: sp|Q17RW2|COOA1_HUMAN (Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 6.258e-51
Identity = 350/1096 (31.93%), Postives = 439/1096 (40.05%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDC-----------------------PKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGAN---GTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPG--SKGLPGIKGV--------QGDRGNNGTDGNCTSLGLMGERGF------PGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-------SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGER 3532
            KG+ GF       G  G QG  G  GP G++GD G  G PG  G+ G+ G  G  G IG  G  G +        G  G  G  G  G QG  G+ GE G  G EG  G+ G +G KG  G +G  G          GD+G  G+ G  G                                G++G +G  G +G  G  G  GL    G++GL GIKGD G  G  G  G PG  G++G +G  G  G+ GK+   G+ GD G          +   G  G  G     G  G KG +GN G  G  G  G +G +GP+G+    G                      RG PG KG  G+ G  G                          +KGE G  GN+  +G+ GP G PG+    G  G KG+RG  G  G    K  +                         P GS G +G  G +G  G  G+ G +GAKGE G  G +G  G   K   PGE+G +G  G  GL G  G+ G                    G  G  G  GE G+ G PGT+G++G  GE GA    GT G +G  G+ G  GEPG    E   GLQG  G+KG  G RG  GE G                    KGE G P   G+ GP+G +G+ G+                                  G VG  G+ G+PG KGD+G                           TG+ G++G  G  G+ G KG +G RG +G     G +G DG  G  G RG  GQ G  G   P    G PG  S  L              QG+RG  G +G    +G+ G RG       PG PGD G  G +G RG  G+ G  G  GP G+ G  GL G  G  G                  I+G  G  GI+G+ GKIG  G+QG+ G +G  G +        PG KG  G PG  G  G KG QG+P + G +G  G    G +GD GP GD G  G  G+ G+ G  G +G  G  G  GD G  G  G  G  G R
Sbjct:  536 KGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQ--------GLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPG--------DFGDRGPAGLDGSPGLVGGTGPPGFP---------------------GLRGSVGPVGPIGPAGIPGPMGLS---GNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQN---GPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELG---------------------PRGKPGQKGYAGEPGPEG--------------------------LKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLR------------GLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEE---GLQGKDGLKGVPGGRGLPGEDG-------------------EKGEMGLP---GIIGPLGRSGQTGL------------------------------PGPEGIVGIPGQRGRPGKKGDKG-----------------------QIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGH---LGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKG------------------IQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHR--GAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHR 1428          

HSP 2 Score: 183.726 bits (465), Expect = 5.969e-45
Identity = 366/1143 (32.02%), Postives = 467/1143 (40.86%), Query Frame = 2
Query:  479 RGPVGLKGDIGCDGEPGTVGIDGKNGTHG-TPGKI--GDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK---------------PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVG---ESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPD-------------------GENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            RGP G+ G  G  G PG  G  G  G  G +PG+   G+KGD+G  G      +G  G  G++G+ G  G+ G  GE+G  GF G +G      S G  G +GL G E N  PK  +G  G  G +G+ G                                  +GE GIPG  GK G  G +G  G  GDRG  G+ G  GL G  G PG PG +G  G +G  G  G+ G     G  G+KG   I                  KG  GE G+ G +G PG  G  G +GL GP G  G     G  G PG  G  G  G EG  G  GIPG  G  G +G  G         +                 +GE+G  G   G+ GPRG PG     G PG +G +G  GD+G            G IGE G +G  G  G  G  G KG +G  G LG +G+ G                   PG  G +G  GS G  G++G  G                             G  G  GI G  G+ G  G+ G +G  G  G+ G++GF G+PGL         QG  G  GD+G  G  G +G                    +G+ G PG+MG+ GP G  GE G++G  G  G +                      T GSVG   E G  G+PG  G+EG++G+                    +   G  G +GL G  G +G  GL G  G +G++G TG  G +G  G  G RG  G+KG +G   P   +G   S+G PG  G  G +G  GT G    LGLMG  G PG PG  G  G  G  G  G  G  G  G D                   GE G  G  G KG  G                  + G+ G  G  G  G+ G +GEQG++G++G +G      +PG  G+ G PGL+G  G KG+QG    DG  GN G   IG  G  G  G  G  G  G  G  G  G++G  G  G+ G QG KG +G  G PG +G                   +G RG  G++G   +   KG  G+ G +G  GF+      G +GD G  G SG  G  G+
Sbjct:  512 RGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSG-----LMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIG------SPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGP---------------------------------EGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGP---MGLSGNKGLPGI------------------KGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKG--------------TQGEEGPIG-AFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNI----------GKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRG---------------------------PDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGL---------QGLPGSTGDRGLPGEPGLRGL-------------------QGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDV---------------------GTAGSVGGTGEPGLRGEPGAPGEEGLQGK--------------------DGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVG---SRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVG------------------VPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPG--KIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQG------------------KRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGH 1427          

HSP 3 Score: 150.599 bits (379), Expect = 7.724e-35
Identity = 297/966 (30.75%), Postives = 395/966 (40.89%), Query Frame = 2
Query:  404 IKGEQGF------PGEMGHN---GTDGQQGF------------------MGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDR---------------GPNGTF-------------------SIGTRGDNGERGINGTQG---------INGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKG---------------DDGLPGEKGTPGRPGEQGEQGKIGDK------GDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDI------GLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-------IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQ------------GIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDK---------GFSGEP------GLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDG 2902
            I+G++GF      PG+ G     G DG  G                   +G  GP G+ G +G  G  G  GI G  G  GT G++G+ G  GD+               GP+G                      IG  G NG  G  G  G         + GT+GE GP G  G +G  G  G KG  GE G +G         +G+ G++G  GK GE                                  G +G+PG++G  G+ GEKG  G PG  G +G KG                 GLPG  G  G PG QG +G+ G +      G++G+ G   E+G++G +G   +I  T    ++G +G  G +G  G  G +G  G PGL G  GD+      G++GP G  G   ++G  G  G++G  G  G  GE G RG PGA G  G +GK+G         + GE G                   KGE G  G +  +G+ G  G PG +   G+PG +G+ G KGDKG+         P G +G RG  G  G +G  G  GT+GA G    LG+ G DG    PG +G +G  G +GL G KGE GY    +  +        G +G PGP GDQGE+            G+PG+ G  GQ G  GE G  G  G+ G+RG +         G SG+P      GL   + IQG  G  GI G+ G  GP G++G                     G +G PG+ G+AG  GP G KG                               +   GS G  G  G+ G+ G  GI                           G +G++G +G+QG  G  GLKG+ GE G  G TG  G  G  G +GD G +G  G +GP       G  G +G+ G  G  G RG  G  G
Sbjct:  640 IRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEG--------LKGEVGDQGNIGKIGET---------------------------------GPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGE------------------KGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIG-------PTGEVGSRGPPGKIGKSGPKGARGTRGAVGH---LGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLG-----PPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLP-------------------GIRGGPGRTGLAGAPGPPGVKG------------------------------SSGLPGSPGIQGPKGEQGLPGQPGI--------------------------QGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRG 1456          

HSP 4 Score: 142.895 bits (359), Expect = 1.751e-32
Identity = 286/940 (30.43%), Postives = 378/940 (40.21%), Query Frame = 2
Query: 1058 KGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGK---------NGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGV------------IGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNG---TIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKG-------DKGDEGPSGVNGTTGYV 3772
            +G  G+PG  G PG PG  G +G    KGD G +      GE+GD+G + ++                     G  G KG  G+PGL G  G+ G+ G  G +GS                            G PG +G+ G EG  G                           KG +G+    +G  G  G  G +   G+PG++GK+GFKG +G            G  G+RG  G  G+ G  G           G+ G  G  G  GI G  G S   G  G KG KG  G  GE GE GY                         GD+G  G+PG PG  G++G +G+ G  G  G             IG  G  G  G  GL  N    G  G KG +G++G  G  GE G                       +G PG+ G AG  GP G KG                              +    G++G+ GE G  G+ G+ G+                         S G+KG +G  G  G QG KG+ G  G  G  G  G +G+ G+ G +G  G  G KG +G   P+   G+ G +G+ G KG +GD+G  G  G     G  GERGF G PG  G   + GDRG  GE G  G  G+ GP GE G  G  G +G++GL G                    G +G  G+ G +G  GE G+RG+ G     +PGE+G  G  GLKG  GG+G   +P +DG +G  G+  I    G  G +G  G  G +G  G +G  G  G +G+IG  G +G +G  G+ GK+G  G RG  G  G  G  G  G+ G  G RG  G+ G S     G  G KG +G  G  S  +             D+G+ G  G  G  G+V
Sbjct:  512 RGPRGIPGPHGNPGLPGLPGPKG---PKGDPGFSPGQPVPGEKGDQGLSGLMGPP------------------GMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSP---------------------------GYPGRQGLAGPEGNPGP--------------------------KGAQGF----IGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFP----------GDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGY------------------------PGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELG----------------------PRGKPGQKGYAGEPGPEGLKG------------------------------EVGDQGNIGKIGETGPVGLPGEVGM-----------------------TGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPD---GLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEP------------------GAKGDVGTAGSVGGTGEPGLRGEPG-----APGEEGLQGKDGLKGVPGGRG---LPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPS-----GLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHV 1230          

HSP 5 Score: 88.1965 bits (217), Expect = 7.646e-16
Identity = 182/512 (35.55%), Postives = 223/512 (43.55%), Query Frame = 2
Query: 2351 AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRG---------------------------DQGIKGGSSP-GEKGEVGS------PGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGM---NGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGF---KSINITHGDKGDKGDEGPSGVNGTTG 3766
             GP G  G +GI G  G  G  G  G  G  G+ G    Q      G  G SG  G PGM+GD+G+                             KG+ GL G  G QG  G  G  G  G  G  G  G +GN G KG +G IG  G  G   P    GIPG +G  G KG QG  G+ G  G     GL G  G  G  G  G  G RG  G +G  G  G  GP G +G +GL G KGD G  GT                G +GE G  G KG +G  G  G+RG                           D GI G + P G KG +G+      PGLKG  G +G  G   + G RG  G    G  G+ GP+G  G +GD+G+ G     G +GL GE+G  G+IG++GE+G  G  G  GE+G +G  G  G  G IG  G  G  G  G  G     ++G  GQ+G RG  G    + I    G+KGD+G  GP G+ G TG
Sbjct:  506 PGPSGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGL-----------------------------KGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPA---GLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGT---------------AGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPG--QKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPG-----SQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTG 963          
BLAST of Collagen alpha-1(IV) chain vs. UniProt/SwissProt
Match: sp|Q14031|CO4A6_HUMAN (Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3)

HSP 1 Score: 196.823 bits (499), Expect = 5.192e-49
Identity = 378/1251 (30.22%), Postives = 485/1251 (38.77%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK-----NGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGR--IGEKGLKG-------------------------KEANKPKI--QEGDKGEKGMSGKDGEN--CTDTGRSSNFYXXXXXXXXXXXXXXXXX----------XXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGD--------------------DGLPGEKGTPGRPGEQGE-----------------QGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKG---FSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD-IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGK-------IGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG----------------ITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +G QG PG+ G  GT G  G  G++G  G KGDIG  G    + IDG       G  G PG  G KGDEG            +G  G  G+ G   ++G  G  GP+GF G   + G +G+ GR  IG  GL G                         KE+  P +  ++G KG  G+ G  G++  C   G   N                               G QG  G PG +G  G  G KG         ++G+PGDRG       +G+ G+                     G PGEKG PG PGE+G                  +G  GDKG  GL G   ++G  G KG    + C                   G  G  G  G PG  G  G  GL G  G  GS   KG  G PG +      G  G +G +G+PG  G+ GK+G  G +  G  G                  + G KG  G++ G E   G PG+   +G+ G+ G +GF GD G    K       G  G  G  G++G+ G PG+ G  G  G +G  GIKGK G    PG  G  G  G  G  G+KG  G I +                         G +G+PG PG  G  G+ G  G  G   + G +G+KG   F G PG+     I G +G KGI G  G  GPSG  G   +                KG++G PG +G+  P  P     +K                                 GS G +G +G PG +GD+G               + G  +            G +G  GLKG+ G  GF G+ GE G  G  G+ G  G  G  G KGD G  +   G  GP       G  G+KG  G+ G  G  GN G DG     G +G  G PG PG  G  G+ G  G  G  G IG  G  G  G +G  G  G  GLNG +             I GV G  G+ G KG+       IGA G+ G+RG +G +G   PG +G  G PG  G      + G P   GR G  G                 +  G  GD G  G  G  G +GD+G+ G  GL GE+G  G  G+ G  G  GK             G  G+ G  G  G  G RG  G +GD   +   +  Q    G  G   I+   G  GD G +GP G+ G+ G 
Sbjct:  308 EGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEG-----------IQGLRGPSGVPGLPALSGVPGALGPQGFPG---LKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPG---QQGLPGSKGIT--LPCIIP----------------GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMI--GSPG------------------LPGSKGATGDIFGAE--NGAPGE---QGLQGLTGHKGFLGDSGLPGLKGV----HGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGL---------------------PGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGE----------------KGDRGNPGPVGIPSPRRPMSNLWLK------------------------------GDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNG-LPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRG--FPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKV------------GPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQV-PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGL 1411          

HSP 2 Score: 182.57 bits (462), Expect = 1.483e-44
Identity = 96/259 (37.07%), Postives = 131/259 (50.58%), Query Frame = 2
Query: 4649 IKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXX-XXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTK-PLGETFGTQMELEKTISRCRVCVKNM 5416
            ++G  G +G PG  G  G+ G      R      +H Q         CP G + +  GYS +   G E     DLG   SCL +FS  P I+C+    CH+  RN +SYWLS+  PI   PV   ++   ISRC VC AP+   A H Q       CP  W  LW GYS +MHT+  ++GG Q L SPGSCLE  R  P IEC+     CH + +   ++L  V +   F + P+ ET     +L   +SRC+VC+K++
Sbjct: 1438 LQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQ---SEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQ-CPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETL-KAGQLHTRVSRCQVCMKSL 1691          

HSP 3 Score: 160.614 bits (405), Expect = 6.313e-38
Identity = 382/1289 (29.64%), Postives = 505/1289 (39.18%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDI---------------GCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEK------GTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEG---------------------VPGVKGKRGFKGDKGEAATKCELDCP--KGSIGERGDLGDKG------TTGFPGKNGTKGAKGENGTLGIKGKD-----------------------GTSEKPGEK--------------------GRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANG------TNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAED-CNATSKVKANEFKDRNKGEKGFPGKMGV---AGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGV---------------QGDRGNNGTDG------NCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGD----------------NGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQG--IKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINI----------THGDKGDKGDEGPSGVNGTTGY 3769
            +KGE+GFPG +G  G  G +G MG  G +G+ G                 GC+G  G VG  G +G  G  G  G  G +G +G +   + G+    G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +      G  G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   +  GV              +     R   GA G+ G++G  G        S   E       +    G++GE+G  GN +G +G +GD G  + +G                     +PG+KG R   GD+G    +     P   G +G  G  G KG        G PG  G  G++G  G +G  GKD                       G    PGEK                    G  G KG +GL G++G  G    T   I  G  G  G  G PG  G +G +G+PG PG  G +G+ GE G+ G        G  G RG+KG  G PGL   + + G+ G  G+ G KG    +G+   AE+       ++         G+ G PG  GV    G +GP GE+G                    G  G+ G+ G   ++G  G  G+ G PG  G  GI                           G    KGL G +G  G  GL G +G  G  G  G   + G  G KG  G +G  GI G        GIPG++GL GI G                +GDRGN G  G        ++L L G++G  G+ G NG  G RG +GE G                  G  G  GP G  G RGL G KG +G+ G              G+ G  G +GI GS G  GA G  G++GD G  ++   SPG KG+ G  G KG  G         +DG  GN G    G KG+ G  G +G +G  G  G  G  G+ GE G  G+ G QG  G  G  GL G +G  G  G+ G  G        G +G  G  G S+    G  G  G +G +G+  I I            GD+G  G +GP+G+ G  G 
Sbjct:   75 LKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKG-DPVLAPGSF--KGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALS-GVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGN-LGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGAR---GDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGA---TGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERG------------------SPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGI-----------SGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPG------LPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGF------------PGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKG---------RDGLIGNIGFP--GNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGL------PGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGI 1248          

HSP 4 Score: 158.688 bits (400), Expect = 2.244e-37
Identity = 369/1281 (28.81%), Postives = 482/1281 (37.63%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGK---------------NGTHGTPGKIGDKGDEG------------DRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEI---GIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGD-----------DGLPGEKG------TPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGT----LIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKG--------------EAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPG-----TDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNE------TIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVA---GPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKG---NKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG---------------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERG------FPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQ----------------------------------GIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-----------IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPS--GVNGTTGY 3769
            G QGF G  G +G  G++GF G  GP G KGD G  G PG +GI+G                +G +GT G +G  G +G             +G  G   +      G +G  G  G++G  G +G  GF G +G  G  G +G  G  G  G + N   +  G +GEKG+ G  G         S                         GE+   G P GK G  G  G KG  GI G  G  G+               GLPG +G        G PG+QG++G +G  G  G  G   ++G+ G  G    I+   A                G  G  G  G PGL G  G  GL+GP G  G   + G                 G  G +G PG KG  G  G+       L   +              +     +  ++  +  + G++GP+G+       G+ G+KG  GF    G                     L   KG+ G+RG  G +G  G PG  G  G  G  G  G          PG++G  GS+G  G++GE G+ G           G+ G+             GE+G+PG+PG            NG  G  G  G+ GD+G  G  G+ GL  ++       I G  G  G  G  G  GP G +G                   +KGE G PG + +    G  GP GEKG+                                  G  G  G+DG PGM G  G+ G  G  G I G              TG KG   + GL G +G  G  GL G +GE G  GT G++G  G  G+ G  G  G+ G+ G                     P       G+PG KGLPG  G+ G +G+ G+ G      L G +G      F G PG  G  G  G RG  G  G+ G  GP G  GT    GEKGD G  G +G+  P        ++G  G +G  GS G  G RG++                                  GIRG  G+KG S     PG  GE GS G++G  G  G  G+P   G  G T   +            G KG  G DG  G IG  G+KG +G +G+ G++G  G  G  G  G RG+ GLPG                     + G +G IG  G     + G IG KG  G  G   +N   G KG  G  GPS  GV G  G 
Sbjct:   62 GPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGN---MGLGFQGEKGVKGDVGLPGPAGPPPST------------------------GELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVIS-------------GNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSG---------------VPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGN------LGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGF----------PGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLP-------GTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGL---------------------------------PGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGT---PGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPG---------------------SSGHQGAIGPLG-----SPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGL 1202          

HSP 5 Score: 157.147 bits (396), Expect = 7.454e-37
Identity = 290/970 (29.90%), Postives = 366/970 (37.73%), Query Frame = 2
Query:  416 QGFPGEMGHNGTDGQQGFMGYRG---PVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI---QEGDKGEKGMSGKDGEN--CTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNG------TDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE-GETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSS----------------------EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENG-TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGE------KGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGD------KGFSGEPGLHSNETIQGLQG--------YKGIKGDKGNRGPSGEKGWA-EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGE------RGEIGQNGTTGRI------------GMDGNNGTKGDRGDIGQ----------------------------KGIQGPSNPNATMGIPGSKGLPGIKG---VQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE 2995
            +G PG+ G +G  GQQG  G +G   P  + G  G  G PGT G  G  G+ G PG  G  G           S G++G+ G  G+     + G  G RG KG  G  G+ G  G  G IG  GL G +     I   + G  GE+G+ G  G      D+G                          ++G  G PG LG  G      T G+ G  G PG  G  GIKG  GLPG  G PG  G  G++G  G KG  G   K    G +G  G   ++    +    G  G     G  GE GS G +G PG+ G  G  G +G                                  +GIPG+ G  G  G+ GT  E G+ G+ G  G    +   +   +KG+KG  G+    G  GPRGD G+                          G PG  G RG  G KG +        P    GE G  G +G+ G PG +G  G KG+NG T+ I G  G   +PGE G KG+KG +GL+G       KGE G +  +                      D G  G PG PG  G  G  G  G++G  G IG  G       KGF G PGLH    + G +G          G+ G  G  GP GEKG+      A  K          KG++GFPG   + GP G  G  GI                                 +   G+ G+ G+PG+ G+                              G  G KG KG+QG  GF GL GE      RGE G  GT G++            G  G  G+ G +GD GQ                             G QGP      +G+ GSKGLPGI G     G  G  G  G+    GL G  GF G PG  G  G  G  G+
Sbjct:  630 RGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPG-----------SSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPG-----------------------LKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRG---------------------------------LKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMP----GESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSG---------------------DVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRG----QKGDRGFPG---LQGPAGLPGAPGIS------------------------------LPSLIAGQPGDPGRPGLDGER--GRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGP------VGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQ 1462          

HSP 6 Score: 150.599 bits (379), Expect = 7.785e-35
Identity = 345/1093 (31.56%), Postives = 445/1093 (40.71%), Query Frame = 2
Query:  413 EQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------------EPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG--------------TKGSKGRIGEKGLKGKEANKPKIQ------------------EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRG------LKGIKGDDGLPGEKGTPGRPGEQGEQGKI-----GDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKG----IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGL-KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDG---NNGTKGDRGDIGQKGIQG------------PSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNG----TIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSS-------------PGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI 3361
            E GFPG  G  G  G  G  G +G  G      CDG                      PG  G  G  G+ G  G  G  G  G  GP+G      +G  GE  ++  QG+ G +G+ G +GF G +G  G                G +G  GEKGL G    K                       GDKG+ G+ G+ G   +          GS G SG  G+ G  G +G +G  G PG+ G +G+ GE G         L G PG RG        G+ G DGLPG  G+PG PG +G  G I     G  G++GL G    +G  GD G   +          G KG +      G  G+ G +G PG  G++G  G+KG  G  G+    G  G PG+ G +GK+G  G    +G+PG KG+ G  G  G  ++G  GS       G  G  A  G KGEKG  G V       G PG     G+PG +G +G  G  G+           G  G  G  G+KG  G PG  G    +     L +KG         +KG +GS GSNG  G +G+ G   R       G  G  G           G+ G PG  G  G  G  G  G  G  G+ G+ G +G  G PGL     + GL+G  G    I G  G +G  GE G+          K  + +D   G  GFPG  G  G VG +G+ G+ G  G  G  G +G+ G  G  G QG  G   + G +G  G  G PG+ G  G+ G  GT G  G                G+KG  G+  G  G+ G +G KG+RG  G  G  G  G  G    +   G  GD G+ G+ G            P  P++  G  G  G PGI G +G +G+ G              GF G PG+ G  G RG  G MG  G +G  G  G  G +G  G +G +GL G    T          G  G+ G+ G  G+ G  G  G  G QG +G  GI G                PG  G  G PG +G  G +G  GMP   G+    G T +
Sbjct:  454 ESGFPGLRGEQGPKGNLGLKGIKGDSGF---CACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP-----KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGER------GSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVG--LKGSPGS------PGVAGLPALSGPKGEKGSVGFV-------GFPGIPGLPGIPGTRGLKGIPGSTGKM----------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKG---------DKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGV-----SGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGF----------KGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIP------------GFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLV 1471          

HSP 7 Score: 113.235 bits (282), Expect = 1.842e-23
Identity = 217/693 (31.31%), Postives = 279/693 (40.26%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDG---------------EPGTV---GIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEAN----------KPKIQEGDKGEKGMSGKDGENCTDTGRSSN-FYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG------LEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDG------PLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCP-----------------------------------------KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGK---DGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXD---------QGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQG 2200
            +G  G PG++G  GT G  G  G +G  GL G  G  G                PG++   G+ G  G  G PG +G KG  G  G  G  ++ G +G+ G  G  G  GI G  G  G +G +G  G  G  G  GR G  G KG   N          +P      KG+KG  G  G N     R                        +G+ G+ G PG +G  G  G KG        G+PG+ G +GI+G  GLPG  G PG  G+ G+  +I   G  G  G+  E G +G KG   +I       +KG  G  G     G++G  G+ G PG+ G  G+ GL G  G      PLGS  + G          KG  G  G  G  G+PG KG  G  G + T + G  G                 G KGEKGY G  +G  G  G  G     G PG++G  G  G  G +        P                                          G  G +GD G  G +G PG+ G KG +GE G +G  GK    G    PG KG+ G +GS+GL G+ G+       A  +  G  G  G  G PG  GD         QG +G+PGIPG DG +G  G  GA G  G+ G +G  GF G PG      + G+ G
Sbjct:  800 RGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEI--SGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVS---GDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIG---------PKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAG---------------LPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQT--PTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPG 1461          

HSP 8 Score: 92.0485 bits (227), Expect = 5.355e-17
Identity = 201/675 (29.78%), Postives = 265/675 (39.26%), Query Frame = 2
Query: 2048 IPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEG-----------IXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRI------------------GMDGNNGTKGDRGD------IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDG-----------------------NCTSLGLMGERGFPGTPGD--------------------NGTIGDRGRRGEMGDNG------------TIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKG-----VQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            IPG+PG        G MG+ G  G  G +G KG  G PGL+         G++GI+G KG+ G  G   + +   A   +  N       G  G  G  G+ G  GP+G  G+                               A +G  G  G  G PG+KGD+G           + G +G  G  G  G    E         + G  GL+G QG +G  GLKG +G+ G     G +                  G+ G  G +GDRG        G  G+ GP  P+   G  G   L  I+G+ GDRG++G+ G                            G  GE+G PG PG+                     G  GD+G+ G  G  G              G+ GP G  GT G  G KG  GL GT G  G  G KG  G  G++    + G  G    RGE+G+ G  G+ G    G  G +GSPGL G  G  G       G P + G +G TG        GL G  G  G  G +G +G++G  GT    G++G  GT G  G  G +GK+GLPG  G  G  G  G+ G  GK G  G   K G  G   +    G +G KG  G+ G   +    G KG+K         G+ G+V
Sbjct:  295 IPGLPGP------RGPMGSEGVQGPPGQQGKKGTLGFPGLN---------GFQGIEGQKGDIGLPGPDVFIDIDGAV--ISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP------------------------------ALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPG---PRGEKGLPGFPGLPGKD--GLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGT---PGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEK---------GSVGFV 905          

HSP 9 Score: 59.6918 bits (143), Expect = 3.391e-7
Identity = 98/302 (32.45%), Postives = 124/302 (41.06%), Query Frame = 2
Query:  407 KGEQGFPG-------EMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIG-------TRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKP-------KIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGD------RGLKGIKGDDGLPGEKGTPG---RPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT 1222
            KGE+G+PG       + G  G  G +GF G +GP GL         PG  GI   +   G PG  G  G +G+RG  G             +GD G+ G  G  G  G KG++G  GF G  G  G KG +G  G  G  GK            K + G +G  G+ G  G+  T T  +              G  G  G  GI G  G PG  G  G  G KGL GIPG        G  G  GD GLPG +G PG    PG+QG  G  G  G     G  + +  + ++     I  +
Sbjct: 1206 KGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGL---------PGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQ--TPTAEAVQV---------PPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMS 1487          

HSP 10 Score: 56.225 bits (134), Expect = 3.553e-6
Identity = 131/393 (33.33%), Postives = 176/393 (44.78%), Query Frame = 2
Query: 2654 KGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGL------PGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGE--MGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG--------------GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            KG +GR G  G++G  G  G  G+TG  G+ G  G  G  G  G KG +GP      MG+PG  G+      PG  G +G  G +G +G   ++G  G  G+PG  G  G  G +G +G+  +      G  G  G  G  G+TG +G  G  G +G  GP G +G  G  G +G  G  G    +G +GE+G++GD G+ G              G   G+KG  G PG KG+ G  G  G P              G+ G  GP    G +G EG +G  G  G +G +G  G  G QG +G++G  GLPG         +  +      SGN GD G  G  G      KGD G +G RG  G   +    G  G  G +G  G+ G  G
Sbjct:   46 KGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGP------MGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMG----LGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP---RGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPD-------VFIDIDGAVISGNPGDPGVPGLPG-----LKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQG 413          
BLAST of Collagen alpha-1(IV) chain vs. TrEMBL
Match: A0A4D6FZM5 (Collagen 4-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=col4-3 PE=2 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 5.572e-145
Identity = 269/273 (98.53%), Postives = 271/273 (99.27%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT 1222
            IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNG KGSKGRIG KGLKGKEANKP+IQEGDKGEKGMSGKDGENCTDTGRSSNFYKGSNGLSGKEGSKGE+GERGIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT
Sbjct:   29 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGAKGSKGRIGGKGLKGKEANKPRIQEGDKGEKGMSGKDGENCTDTGRSSNFYKGSNGLSGKEGSKGEEGERGIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT 301          

HSP 2 Score: 105.531 bits (262), Expect = 1.328e-20
Identity = 126/321 (39.25%), Postives = 174/321 (54.21%), Query Frame = 2
Query: 2828 GIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXX-----XXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKG--------YFGGKGVQGMPAKDGRR-GNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGT---------IGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKS-INITHGD 3715
            G+ G++G+PG+ G +G RG +G  G     G+ GE+GFPG  G NGT G +G  G  G  G  G+ G DGE GT G+ G+ G  G  G IG +G             G  G  GERGING++G  G +GE+G +G +G  G + + G KG +G  GLKG          G KG +GM  KDG    +TG ++   KG +G  G  G+ G+EG++G+ G IG+ G++G NGT          GD+G KG +G  GLPGE+            G  G+ G +G++GKIG+KGD      G   ++G RG++G  S IN T  D
Sbjct:    1 GLKGNRGIPGVSGPKGGRGLSGKSG---KPGIKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGAKGSKGRIGGKGLKGKEANKPRIQEGDKGEKGMSGKDGENCTDTGRSSNFYKGSNGLSGKEGSKGEEGERGIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEK------------GTPGRPGEQGEQGKIGDKGD--RGLTGKNMERGERGDKGTASIINCTDAD 304          

HSP 3 Score: 94.3597 bits (233), Expect = 9.545e-17
Identity = 125/352 (35.51%), Postives = 161/352 (45.74%), Query Frame = 2
Query:  956 IQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPR-GDPGDDSS--EGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLV---------GEKGEIGYINRTAANI 1975
            I+GE G PG++G NGTDG++G  G  G  GLKG  G DG PG  G  G+ G  G  GKIGDKGD G         +RG  GT SI                   G  G+ G +G  G  G+NGT G+ G KG +G +G    KG                      +G  G KG+ GKE     + EG+                     KGEKG    + GK+G    D G  S+  +G  G+ GK G KG++GE   + E+  P G +G+ G  G+KG  G PG  G KG KG++G  G KG  G   + GE+G+ G KG  GL          G+KG    IN T A+ 
Sbjct:   29 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEG---------DRGPNGTFSI-------------------GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGAKG---------------------SKGRIGGKGLKGKEANKPRIQEGD---------------------KGEKG----MSGKDGENCTDTGRSSNFYKGSNGLSGKEGSKGEEGERGIQGEIGIP-GKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTDADY 305          

HSP 4 Score: 88.1965 bits (217), Expect = 1.093e-14
Identity = 119/340 (35.00%), Postives = 154/340 (45.29%), Query Frame = 2
Query: 2489 GSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKG----GSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEK 3496
            G  G SG+ GKPG+KG++G                            G+ G+ G  G QG  G++G  G +G+IG +G  G +G+DG NGT G  G IG KG +G   PN T  I       G +G  G+RG NGT G   + G  G +GF GT G NG  G +GR G  G  G   N  P  + G +G  G  G  G N T   R               G  G++G +G  G  GE+GI+G+ GI G      + GEKG  G PG +G  G KG  G+P + G  G  G    G +G  G  GD G  G   ++G  G  G    I       D+G K
Sbjct:   16 GGRGLSGKSGKPGIKGEQGF--------------------------PGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI-------GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGAKGSKGRIGGKGLKGKEANK-PRIQEGDKGEKGMSGKDGENCTDTGRSSNF---------YKGSNGLSGKEGSKGEEGERGIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPG--EQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTDADYDKGAK 310          

HSP 5 Score: 76.2554 bits (186), Expect = 9.271e-11
Identity = 117/305 (38.36%), Postives = 148/305 (48.52%), Query Frame = 2
Query: 1451 HRGIPGA------KGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKG---AKGENGTLGIKGKDGTSEKPGEKGRKGS-----------KGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGT---NGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKG------NRGPSGEKGWAEDCNAT 2278
            +RGIPG       +G+ GK GK G  I+GE G  G  G  G  G +   G +G  G  G++ G +G  G  G D   G  G  GK G KGD+G+            SIG RGD G++G  G  G NGTKG    KG  GT+G+ G  G+  + G KG KG            KG  G+ G+ GE       ++N   G  G  G++G  G  G++G QG  GIPG  G+NGT+GE G  G     G+ G +GD G  GE G       QG QG  G KGD+G       RG  G+KG A   N T
Sbjct:    5 NRGIPGVSGPKGGRGLSGKSGKPG--IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDI-GCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF-----SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGAKGSKGRIGGKGLKGKEANKPRIQEGDKGEKGMSGKDGENCTDTGRSSNFYKGSNGLSGKEGSKGEEGERGIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCT 301          

HSP 6 Score: 72.7886 bits (177), Expect = 1.583e-9
Identity = 115/372 (30.91%), Postives = 153/372 (41.13%), Query Frame = 2
Query: 2033 QGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGL---------KGNQGRQGFKGLKGE-----RGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDR---GRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTI 3097
            +G +GIPG+ G  G  G +G+ G  G       +G++GF GE G +  +  QG  GY+G  G KG+ G  GE G                 D   G  G PGK+G  G  G  G  G                                    S+G  G++G+ G+ G +GI                       N + G++G KG          KG++GR G KGLKG+     R + G  G  G  G DG N T   R     KG  G S    + G  G +G+ G  G+ G  G NGTDG     G+ G+RG  G  GD+G  G++   GR GE G+ G IG+ G  G  G     GE+GD G    I
Sbjct:    3 KGNRGIPGVSGPKGGRGLSGKSGKPGI------KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTV-------------GIDGKNGTHGTPGKIGDKGDEGDRGPNGTF----------------------------------SIGTRGDNGERGINGTQGI-----------------------NGTKGERGPKGFEGTMGVNGAKGSKGRIGGKGLKGKEANKPRIQEGDKGEKGMSGKDGENCTDTGRSSNFYKGSNGLSGKEGSKGEEGERGIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASII 298          

HSP 7 Score: 65.855 bits (159), Expect = 2.948e-7
Identity = 120/365 (32.88%), Postives = 159/365 (43.56%), Query Frame = 2
Query: 1745 KGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNR-----GPSGEKGWA----EDCNATSKVKANEFKDRN-----KGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGI 2797
            KG+ G  G  G KG  G  GK+G  G KGE G  G  G +GT  + G  G +G  G  G +G  GE G +     N TH   G  G+ G  G  GD+G  G   I GT G NG  G  G  G NG  G+RG KGF G  G++  +  +G  G KG+KG + N+     G  GEKG +    E+C  T +  +N +K  N     +G KG  G+ G+ G +G  G+ G                                  NG+ GE G +G PG +G +GI                             KG+ GL G +G  G  G +GE+G+IG  G     G+ G N  +G+RGD G   I
Sbjct:    3 KGNRGIPGVSGPKGGRGLSGKSGKPGIKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTH---GTPGKIGDKGDEGDRGPNGTFSI-GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGAKGSKGRIGGKGLKGKEANKPRIQEGDKGEKGMSGKDGENCTDTGR-SSNFYKGSNGLSGKEGSKGEEGERGIQGEIGIPGKLG---------------------------------KNGTDGEKGLEGIPGDRGLKGI-----------------------------KGDDGLPGEKGTPGRPGEQGEQGKIGDKGDR---GLTGKNMERGERGDKGTASI 297          
BLAST of Collagen alpha-1(IV) chain vs. TrEMBL
Match: A0A4E0RED0 (Collagen type IV alpha 2 OS=Fasciola hepatica OX=6192 GN=D915_003442 PE=4 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 2.481e-82
Identity = 456/1207 (37.78%), Postives = 595/1207 (49.30%), Query Frame = 2
Query:  179 VELKTEDKNSTNKSEKCLNICTSDRCKCVGIKXXXXXXXXXXXXXXXXLKGNRXXXXXXXXXXXXXXXXXXXXXXIKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTAS-IINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGD-----------PGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSN--ETIQGLQGYKGIKGDKGNRGPSGEKGWA-EDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDG---KPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQ------GDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDK 3718
              L    + + +   +C  ICT D+C+CVGIKG+ GPPG  G  G  G  G+ G  G++G KG +G SG+ G+ G KGEQG  G  G++G +G  G  G+ GP G KG+ GC G+PG  G+ G  G  G  G  G  G +G +G  G  + G +G  GE G+ G  G  G  G  GP+G  G  G+ G KG KG  G  G+KG  A    IQ  +G++GE+G  G DG  C       +   G  GL G +G KG KG+ G  G+IG+PG  G  G  GEKGL G  GDRG  G  G  GLPGE G+ G  GE G  G IG KGD G  G +  RG  G KG    ++ C      +G  G  G +G  G+ G +G  G PG  G+ G +G  G    LG  C +G           G  G +GE G  G+PG  G+ G+ G++G   + G+T      G  G  G   + G KG+ G  G++ G +G RG            PGDD   G+PG  G  G +G KG +   C + CP G  G  GD GD G  GFPG+ G  G  G+ G  G  G+DG    PG+KG+ G  GS G  G++GE G I      +  G+ G+ G  G  G  G++G  G  GIPG+ GQ G  G  G NG  G+ G++GD G  G PG      + + G  G  G  G KG  G  GEKG+     +  +K +  E+  R  G+ G PG+ G  G  G  G  G+ G  G  G  G  G  G  G++G  G  G     GS+G  G DG   +PG+ G  G+ G  G  G  G  G             G  G  G+ G  G +G KGL G  G+ G NG  G  G  G  G+KG RG            P+ T+ +PG    PG+KG++      G +G  G  G C   GL G+ G  G PG +G  G+ G  G+ GD G  G T   G  G RG  G  G  G+ G  G  G  G +G KG  G  G  G  G +GK G  G +G+ G++G+ G SS G  G+ G  G  G  G KGV+G+  K+G++G+ G    G KG  G  G  G   D G  G  G+ G +G  G  G +G +GE G RG  G+ G  GA G KG  G+ G+ G  G KGDRG  G+ G+  N   G  G+KG  G +G+       GDK
Sbjct:   22 TPLYISAQWNFDDPYRCQRICTPDKCRCVGIKGSMGPPGPVGSPGEWGTAGDPGPMGLAGTKGEKGYSGQLGRQGFKGEQGIQGPPGYHGQNGLSGNPGFMGPKGDKGEPGCYGDPGDNGMPGMPGISGIKGPPGFSGRKGAKGHPGWSTEGAQGPRGEPGLPGLVGDYGIPGTPGPQGDPGLRGLPGPKGFKGVRGLPGIKGVPAPAITIQGQKGEQGEQGSRGPDGYPCP---MDVDSLVGPTGLPGPKGYKGLKGDTGPHGDIGLPGVDGPPGNRGEKGLPGRHGDRGRPGDAGLPGLPGEPGSRGLDGEPGRFGDIGPKGDTGPPGVDGARGFHGPKGKPGGLVFCPGPKGIRGEPGLPGPRGGPGDPGRQGMFGLPGDKGSMGPVGRPGL---LGRRCSEG---------QPGLPGEKGEIGISGLPGDPGIIGEPGRDGARGMPGDTPDQILPGVPGRPGTPGSFGRKGQPGDAGDI-GPKGYRGTGDRGPAGPRGPPGDDGDSGMPGSPGLSGVRGAKGRSIVPCGI-CPDGMPGLPGDSGDMGEPGFPGQPGKNGINGDIGWDGDPGRDGQPGMPGKKGQPGHPGSFGAKGDRGEPGRITYIQEKVIPGDAGEPGYPGAKGEPGERGFPGSFGIPGSAGQPGRRGTPGPNGIPGMPGEKGDDGIPGAPGEDGRGIDGMPGDTGEHGYPGRKGFPGRPGEKGFCGYIPHQIAKGQPGEYGFR--GDPGPPGEQGNPGSTGLKGANGLPGGRGSPGENGTFGYPGMKGDRGRPGSFGVVGYPGSIGIPGRDGIPGEPGVPGRSGLPGMRGPQGEPGDPGRAFFATPGEKGFPGSAGVPGMPGEAGYRGIKGLPGRAGKPGINGAFGPRGFAGMKGSKGRRG-----------LPSDTL-MPGE---PGVKGIRGFPGTWGRKGEMGLPGVCLYKGLTGDTGEKGLPGYHGLPGNAGLPGDRGDPGFDGRTAFAGPKGDRGADGFPGRMGVPGAKGAAGWPGSQGPKGSPGSFGAPGDIGVRGKPGIPGSRGLPGERGLDGRSSVGLAGDPGPMGRPGVPGTKGVRGLAGKEGKQGDPGRDGYGAKGLQGRPGFPGPQADPGTPGRQGSFGPKGFPGMPGRMGQKGEHGPRGLDGIEGPDGAPGIKGQPGKPGEYGAVGMKGDRGSRGDPGEPSNVIFGRAGRKGFPGMQGYPGSLGMPGDK 1194          

HSP 2 Score: 212.616 bits (540), Expect = 2.902e-51
Identity = 398/1298 (30.66%), Postives = 506/1298 (38.98%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHG---TPGKIGDKGDEGDRG----------------PNGTFSIGTRGDNGERGINGTQGINGTKGERG-------PKGF------------------EGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIG-----------------DKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG----------TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV-----MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKG---------AKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGL------KGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKG---IQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGL---MGERGFPGTPGDNGTIGDRGRRGE-----MGDNGTIGNTGPDGENGTRGLTGEKGDAG-----------LNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-------SPGEKGEVGSPGLKGYFGGKGVQGMPA-----KDGRRGNTGIT----AIGLKGD------------------------SGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGK-----------------------TGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
            +G  G+P  M  +   G  G  G +G  GLKGD G  G+ G  G+DG  G  G    PG+ GD+G  GD G                P     IG +GD G  G++G +G +G KG+ G       PKG                   +G  G+ G KGS G +G  GL G+  ++        G+ G+ G+ GE                               GI G  G PG +G+ G DG +G+ G   D+ L G+ G  G PG  G  G+PG+ G+ G  G                 D GD G+ G     G RG KG  SI+ C          G  G  G  G++G  G  G PG NG  GDIG  G  G  G   + G                      +G PG  G FG +G  G           +I G+ G  G  G KGE          GE+G+ G+       G+ G RG PG +   G+PG KG  G  G  GE     +     G  G+ G+ G  G  GFPG+ G KG         AKG+ G  G +G  G   + G  G  G KG+NGL G +G                                GE G  G PG  G  G  G  G  G  G IG  G  G  GEPG+     + G++G +G  GD G               AT             GEKGFPG  GV G  G  G +GIKG  G+ G                         NG+ G  G  G  G KG  G+  +                        G KG +G  G  GR+G  GL      KG  G+ G+ G  G  G+ GN G  GDRGD G  G     GP       G PG  G+PG KG  G  G+ G  G+  S G    +G RG PG PG  G  G+RG  G       GD G +G  G  G  G RGL G++G  G           L G  G  GP    G  G +G  G +G  G  G++G +GE G RG  GI+G          PG+ GE G+ G+KG  G +G  G P+     + GR+G  G+     ++G+ GD                         G  G  G +G  G  GM G  G  G+ G  G+ G  G+KGRRG+                        G+PG  G  G  G +G  G  G  G  G+ G  GEKG        G  G  G RG +G  S     G  G+ G +GPSG+ G  GY
Sbjct:  245 RGPDGYPCPMDVDSLVGPTGLPGPKGYKGLKGDTGPHGDIGLPGVDGPPGNRGEKGLPGRHGDRGRPGDAGLPGLPGEPGSRGLDGEPGRFGDIGPKGDTGPPGVDGARGFHGPKGKPGGLVFCPGPKGIRGEPGLPGPRGGPGDPGRQGMFGLPGDKGSMGPVGRPGLLGRRCSE--------GQPGLPGEKGE------------------------------IGISGLPGDPGIIGEPGRDGARGMPGDTPDQILPGVPGRPGTPGSFGRKGQPGDAGDIGPKGYRGTGDRGPAGPRGPPGDDGDSGMPGSPGLSGVRGAKGR-SIVPC-----GICPDGMPGLPGDSGDMGEPGFPGQPGKNGINGDIGWDGDPGRDGQPGMPG---------------------KKGQPGHPGSFGAKGDRGEPGRITYIQEKVIPGDAGEPGYPGAKGE---------PGERGFPGSFGIPGSAGQPGRRGTPGPNGIPGMPGEKGDDGIPGAPGEDGRGID-----GMPGDTGEHGYPGRKGFPGRPGEKGFCGYIPHQIAKGQPGEYGFRGDPGPPGEQGNPGSTGLKGANGLPGGRGS------------------------------PGENGTFGYPGMKGDRGRPGSFGVVGYPGSIGIPGRDGIPGEPGVPGRSGLPGMRGPQGEPGDPGRA-----------FFATP------------GEKGFPGSAGVPGMPGEAGYRGIKGLPGRAGKP---------------------GINGAFGPRGFAGMKGSKGRRGLPSDTLM-----------------PGEPGVKGIRGFPGTWGRKGEMGLPGVCLYKGLTGDTGEKGLPGYHGLPGNAGLPGDRGDPGFDGRTAFAGPKGDRGADGFPGRMGVPGAKGAAGWPGSQGPKGSPGSFGAPGDIGVRGKPGIPGSRGLPGERGLDGRSSVGLAGDPGPMGRPGVPGTKGVRGLAGKEGKQGDPGRDGYGAKGLQGRPGFPGPQADPGTPGRQGSFGPKGFPGMPGRMGQKGEHGPRGLDGIEGPDGAPGIKGQPGKPGEYGAVGMKGDRGSRGDPGEPSNVIFGRAGRKGFPGMQGYPGSLGMPGDKGYPGLGGPPGETGYPGLRGPTGPPGVPGQQGNVGYPGSHGMPGQPGSRGDPGIPGSRGFPGQKGRRGEKGDRGFTPPCPPGIPGPKGPMGMPGIPGPEGMKGDTGASGLPGPKGPRGYPGE-GVPGEKGFPGRPGIDGLPGMPGDRGRQGHTSPPGAPGLPGEPGYQGPSGLPGDRGY 1371          

HSP 3 Score: 211.846 bits (538), Expect = 4.144e-51
Identity = 394/1260 (31.27%), Postives = 498/1260 (39.52%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVG---LKGDIGCDGEPG---------------TVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIG---------TRGDNGERGINGTQGINGTKGERG------------------------PKGFEGTMGVNGTKGS------KGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKV---KANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQG----PSNPNATM-------GIPGSKGLPGIKGVQGDR------------------------------GNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTI-----------------GNTGPDG---ENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTK-GDIGQKGHRGNRGFKSINI----------------THGDKGDKGDEGPSGVNGTTGY 3769
            G  G PG +G   ++GQ G  G +G +G   L GD G  GEPG                 G+ G+ GT G+ G+ G  GD GD GP G    G           GD+G+ G+ G+ G++G +G +G                          GF G  G NG  G        GR G+ G+ GK     K Q G  G  G  G  GE    T        G  G  G  G+KGE GERG  G  GIPG  G+ G  G  G  GIPG   + G KGDDG+PG  G  GR    G  G  GD G+ G  G+    G  G+KG    I             ++ +KG  GE G +G  G PG  G  G  GLKG +G      + GG                     RG PG  G FG  G  G    G  GS                   G  GY G++   G++G  G+PG     G+PG++G +G  GD G A                      G  GFPG  G  G  GE G  GIKG  G + KPG  G  G +G  G+ G KG  G  + T                     G+ G +GI G PGT G+ G  G  G     G+ GD G+KG  G  GL  N  + G +G  G  G     GP G++G A+       V   K       ++G KG PG  G  G +G  G+ GI G  G  G  G  G +                  G+ G  G  GK G +GD G  G                         G  G KG  G  GR G KG  G RG  G  G  G  G+ G  G  G+ G +G KG +G    P  P+  +       G PG +G PG  G+ GD+                              GN G  G+    G  G RG PG PG  G  G +GRRGE GD G                   G  GP+G   + G  GL G KG  G  G                EGV GE+G     G+ G  G  G+ GD+G +G +SP      G+PGL G  G +G  G+P   G  G+ G    G+ G  GP G  G  G +G  G +G  G +G+ G  G +G  G  G RG+ GL G R            G  G+ G++G+RG+ G  G    + K GD GQKG +G    +  ++                  G  G+KG  GP+G NGT G 
Sbjct:  406 GPVGRPGLLGRRCSEGQPGLPGEKGEIGISGLPGDPGIIGEPGRDGARGMPGDTPDQILPGVPGRPGTPGSFGRKGQPGDAGDIGPKGYRGTGDRGPAGPRGPPGDDGDSGMPGSPGLSGVRGAKGRSIVPCGICPDGMPGLPGDSGDMGEPGFPGQPGKNGINGDIGWDGDPGRDGQPGMPGK-----KGQPGHPGSFGAKGDRGEPGRITYIQEKVIPGDAGEPGYPGAKGEPGERGFPGSFGIPGSAGQPGRRGTPGPNGIPG---MPGEKGDDGIPGAPGEDGR----GIDGMPGDTGEHGYPGRKGFPGRPGEKGFCGYIP------------HQIAKGQPGEYGFRGDPGPPGEQGNPGSTGLKGANG------LPGG---------------------RGSPGENGTFGYPGMKGD--RGRPGSF------------------GVVGYPGSIGIPGRDGIPGEPGVPGRSGLPGMRGPQGEPGDPGRAF-----------------FATPGEKGFPGSAGVPGMPGEAGYRGIKGLPGRAGKPGINGAFGPRGFAGMKGSKGRRGLPSDTLMP------------------GEPGVKGIRGFPGTWGRKGEMGLPGVCLYKGLTGDTGEKGLPGYHGLPGNAGLPGDRGDPGFDGRTAFAGPKGDRG-ADGFPGRMGVPGAKGAAGWPGSQGPKGSPGSFGAPGDIGVRGKPGIPGSRGLPGERGLDGRSSVGLAGDPGPMGRP-GVPGTKGVRGLAGKEGKQGDPGRDGYGAKGLQGRPGFPGPQADPGTPGRQGSFGPKGFPGMPGRMGQKGEHGPRGLDGIEGPDGAPGIKGQPGKPGEYGAVGMKGDRGSRGDPGEPSNVIFGRAGRKGFPGMQGYPGSLGMPGDKGYPGLGGPPGETGYPGLRGPTGPPGVPGQQGNVGYPGSHGMPGQPGSRGDPGIPGSRGFPGQKGRRGEKGDRGFTPPCPPGIPGPKGPMGMPGIPGPEGMKGDTGASGLPGPKGPRGYPG----------------EGVPGEKGF---PGRPGIDGLPGMPGDRGRQGHTSP-----PGAPGLPGEPGYQGPSGLPGDRGYPGSVGPK--GISGRPGPRGMPGRPGPDGRPGADGVRGRDGDRGTAGPMGAPGAPGPRGQPGLTG-RKGAPGFARFAVKGMRGEPGDRGERGETGLSGIPGQAGKPGDFGQKGAKGLPNPRPGSLGQPGDPGPPGETGYRGPKGYMGEKGYRGPAGPNGTIGL 1530          

HSP 4 Score: 211.46 bits (537), Expect = 5.968e-51
Identity = 337/1061 (31.76%), Postives = 427/1061 (40.25%), Query Frame = 2
Query:  413 EQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-QEGDKGEKGMSGKDGENCT--------DTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDG-----LPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEK--------PGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETI--QGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR--------NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTR---GLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMP----------------AKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTI 3442
            E+  PG+ G  G  G +G  G RG  G  G  G  G+PG  G  G NG  G PG+ GD G  G  G +G    G  GD GE G  G +G  G  GE+G  G+       G  G  G  G+ G  G++ N      +G  G  G  G  GEN T        D GR  +F                 G  G  G IGIPG+ G  G  G  G  G+PG RG +G  GD G      PGEKG PG  G  G  G+ G +G +GL G+    G+ G  G             KG +G        GE G KG  G PG  G  G++GL G        C+  G+                   + G+PG  G+ G  G  G   +G T   G +G +G  G     GV G KG  G   G +GP+G PG   + G  GV+GK G  G +G    +  LD  + S+G  GD G  G  G PG  G +G  G+ G  G  G+DG   K        PG +   G+ G  G  G KG  G   R      H                  G +G+ GI G DG  G  G+ G  G  G +G +GD+G  G+PG  SN      G +G+ G++G  G+ G  G+KG+        +      +           +G  G+PG  G+ G  G  G+ GI                                  GS G  G+ G+ G KGD G                            GD G  GL G +G +G+ G     G  G+ G  GR G+DG  G  GDRG       QG ++P    G+PG  G  G  G+ GDRG  G+ G     G  G RG PG PG +G  G  G RG  GD GT G  G  G  G R   GLTG KG  G                           + G +G+ G RGE+G  G  GI     PG+ G+ G       FG KG +G+P                 + G RG  G   +G KG  GP G NGTIG  GD G   T+
Sbjct:  616 EKVIPGDAGEPGYPGAKGEPGERGFPGSFGIPGSAGQPGRRGTPGPNGIPGMPGEKGDDGIPGAPGEDGRGIDGMPGDTGEHGYPGRKGFPGRPGEKGFCGYIPHQIAKGQPGEYGFRGDPGPPGEQGNPGSTGLKGANGLPGGRGSPGENGTFGYPGMKGDRGRPGSF-----------------GVVGYPGSIGIPGRDGIPGEPGVPGRSGLPGMRGPQGEPGDPGRAFFATPGEKGFPGSAGVPGMPGEAGYRGIKGLPGRA---GKPGINGAFGPRGFAGMKGSKGRRGLPSDTLMPGEPGVKGIRGFPGTWGRKGEMGLPG-------VCLYKGLTGDTGEKGLPG--------YHGLPGNAGLPGDRGDPG--FDGRTAFAGPKGDRGADGFPGRMGVPGAKGAAG-WPGSQGPKGSPGSFGAPGDIGVRGKPGIPGSRGLPGER-GLDG-RSSVGLAGDPGPMGRPGVPGTKGVRGLAGKEGKQGDPGRDGYGAKGLQGRPGFPGPQADPGTPGRQGSFGPKGFPGMPGRMGQKGEH------------------GPRGLDGIEGPDGAPGIKGQPGKPGEYGAVGMKGDRGSRGDPGEPSNVIFGRAGRKGFPGMQGYPGSLGMPGDKGYPGLGGPPGETGYPGLRGPTGPPGVPGQQGNVGYPGSHGMPGQPGSRGDPGI---------------------------------PGSRGFPGQKGRRGEKGDRGFTPPCPPGIPGPKGPMGMPGIPGPEGMKGDTGASGLPGPKGPRGYPG----EGVPGEKGFPGRPGIDGLPGMPGDRGR------QGHTSPPGAPGLPGEPGYQGPSGLPGDRGYPGSVGPKGISGRPGPRGMPGRPGPDGRPGADGVRGRDGDRGTAGPMGAPGAPGPRGQPGLTGRKGAPGFA----------------------RFAVKGMRGEPGDRGERGETGLSGI-----PGQAGKPGD------FGQKGAKGLPNPRPGSLGQPGDPGPPGETGYRGPKGY--MGEKGYRGPAGPNGTIG-LGDAGYLFTV 1539          

HSP 5 Score: 195.667 bits (496), Expect = 3.700e-46
Identity = 104/265 (39.25%), Postives = 139/265 (52.45%), Query Frame = 2
Query: 4637 TGLR-IKGKMGIKGTPGIPGDTGIKGERAAINRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQP--GCHFNIRNARSYWLSSL-LPIQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXX-XXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKTISRCRVCVKNM 5416
            TG R  KG MG KG  G  G  G  G    +  +  LF  H Q   D+   +CP  T  + TG+S V   G++    MDLGSP SCL+KFS  P   C  +    CH N+RN RSYWLS+L   + +P KV+ ++  ISRCVVC +   + +FH Q       CP  W   W G+S  M    S  G  Q   SPGSCL++ R  P IECNN    C  W D + Y+L  +   + F KP+G  F ++  + + +SRC VC ++M
Sbjct: 1504 TGYRGPKGYMGEKGYRGPAGPNGTIG----LGDAGYLFTVHSQ---DSRPPQCPIFTTQLYTGFSLVTLQGDDDSMTMDLGSPGSCLQKFSIMPFASCFAKTTGNCHVNMRNGRSYWLSTLEQYMLSPTKVDHMEPYISRCVVCQSRTTLISFHSQKQDAIQGCPSGWENAWNGFSFPMMVGPSSSGGVQPLESPGSCLQHFRALPFIECNNHDGNCFHWQDGRSYWLTSIPQRDQFIKPVGMAFKSETAVLQHVSRCSVCRRSM 1761          

HSP 6 Score: 140.198 bits (352), Expect = 2.981e-29
Identity = 245/802 (30.55%), Postives = 315/802 (39.28%), Query Frame = 2
Query: 1583 VKGEKGYYGN--------VMGKEGPRG------DPGDDSSEGVPGV---KGKRGF---KGDKGEAATKCE-LDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGR-------KGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNG------------VIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDR---------NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKG---DRGDIGQKGIQGPSNP-----------NATMGIPGSKGLPGIKGVQGDR------GNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGS---PGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            ++G  GY+G          MG +G +G      DPGD+   G+PG+   KG  GF   KG KG      E    P+G  G  G +GD G  G PG  G  G +G  G  G KG  G    PG KG        +G KG  G  G +G  GY      +   G  G  G KG  G +GD G  G  G+PG DG  G  GE G  G +G            + G+ G +G  GEPG   +   +G  G  G+ G +G  GP G+ G    C     ++                 +G  G PG  G  GPVG                                         G +G    +G+PG+ G++G                           +G  G+ G+ G  GR G +G+ G+  +    G  GR G  G+ G KG   D GDIG KG +G  +            +   G+PGS GL G++G +G          +G  G     G MGE GFPG PG NG  GD G  G+ G +G  G  G  G+ G  G  G KGD G  G I             I G  GE G  G+KG+ G RG  G  G  G  G   PG +G  G    PG+ G  G  G+ G P +DGR         G+ G  G  G++G  G +G  G  G  G  G I +    G  GE G RG  G PGE                     +G+ G  G KG   N   G  G  G  G  G+  +      KGD+G  G  GV G  G +
Sbjct:  103 IQGPPGYHGQNGLSGNPGFMGPKGDKGEPGCYGDPGDNGMPGMPGISGIKGPPGFSGRKGAKGHPGWSTEGAQGPRGEPGLPGLVGDYGIPGTPGPQGDPGLRGLPGPKGFKGVRGL---PGIKGVPAPAITIQGQKGEQGEQGSRGPDGYPCPMDVDSLVGPTGLPGPKGYKGLKGDTGPHGDIGLPGVDGPPGNRGEKGLPGRHGDRGRPGDAGLPGLPGEPGSRGLDGEPGRFGDIGPKGDTGPPGVDGARGFHGPKGKPGGLVFCPGPKGIRGEPGLPGPRGGPGDPGRQGMFGLPGDKGSMGPVG---------------------------------------RPGLLGRRCSEGQPGLPGEKG-----------------------EIGISGLPGDPGIIGEPGRDGARGMPGDTPDQILPGVPGRPGTPGSFGRKGQPGDAGDIGPKGYRGTGDRGPAGPRGPPGDDGDSGMPGSPGLSGVRGAKGRSIVPCGICPDGMPGLPGDSGDMGEPGFPGQPGKNGINGDIGWDGDPGRDGQPGMPGKKGQPGHPGSFGAKGDRGEPGRITYIQEKV------IPGDAGEPGYPGAKGEPGERGFPGSFGIPGSAG--QPGRRGTPGPNGIPGMPGEKGDDGIPGAPGEDGR---------GIDGMPGDTGEHGYPGRKGFPGRPGEKGFCGYIPHQIAKGQPGEYGFRGDPGPPGE---------------------QGNPGSTGLKG--ANGLPGGRGSPGENGTFGYPGM------KGDRGRPGSFGVVGYPGSI 793          

HSP 7 Score: 87.4261 bits (215), Expect = 3.694e-13
Identity = 161/568 (28.35%), Postives = 209/568 (36.80%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRG---------------PVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGER------------------------------GPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPG-----VKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPG-KNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYI 1954
            ++G  GFPG     GT G+QG  G +G               P GL G  G DG PG  G  GK G +G  G  GD+G  GD G       G  G  G  G+ G  G  G  G++                              G  G+ G+ G+ G  GS+G  G  G +G      K + G+KG++G +                                           +PG  G  G  G+ G  G+PG +G +G  G +G+PGEKG PGRPG  G  G  GD+G +G T      G  G+ G                          G+ G  GS+G  G++G  G  G+ G  GP G                               PGA G+ G++G  GT   G  G+                             G  GPRG PG    +G PG     VKG RG  GD+GE         P G  G+ GD G KG  G P  + G+ G  G+ G  G  G  G     GEKG +G  G NG +G  G+ GY+
Sbjct: 1080 LQGRPGFPGPQADPGTPGRQGSFGPKGFPGMPGRMGQKGEHGPRGLDGIEGPDGAPGIKGQPGKPGEYGAVGMKGDRGSRGDPGEPSNVIFGRAGRKGFPGMQGYPGSLGMPGDKGYPGLGGPPGETGYPGLRGPTGPPGVPGQQGNVGYPGSHGMPGQPGSRGDPGIPGSRGFPGQ--KGRRGEKGDRGFTPPCPPGIPGPKGPMG----------------------------MPGIPGPEGMKGDTGASGLPGPKGPRGYPG-EGVPGEKGFPGRPGIDGLPGMPGDRGRQGHTSPPGAPGLPGEPGYQGPSGLP------------------GDRGYPGSVGPKGISGRPGPRGMPGRPGPDGR------------------------------PGADGVRGRDGDRGT--AGPMGAP----------------------------GAPGPRGQPGLTGRKGAPGFARFAVKGMRGEPGDRGERGETGLSGIP-GQAGKPGDFGQKGAKGLPNPRPGSLGQPGDPGPPGETGYRGPKGYMGEKGYRGPAGPNGTIG-LGDAGYL 1536          
BLAST of Collagen alpha-1(IV) chain vs. TrEMBL
Match: A0A3S4HRM0 (Collagen triple helix repeat (20 copies) OS=Avibacterium volantium OX=762 GN=NCTC3438_00152 PE=4 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 2.115e-81
Identity = 512/1329 (38.53%), Postives = 645/1329 (48.53%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGN---PGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG----TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFKG---DKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKAN-EFKDR----NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMG---------ERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG-ITAIGLKGDSGPDGDNGTIGDEG---DKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS----TKGDIGQKGHRGNRGF---KSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKGE 4279
            G+QG  GE G  G  G +G  G +G  G  GD G  G+ G  G  G  G  G  G+ GDKG  GD+G  G    G +G+ G++G  G +G+ G KGE G KG  G  G  G +G+KG  G+KG  G         +G+ G+KG++G  GE   D G + +                       +G  G  G  G+ G  GE G +G  GD+G KG  GD G  G+KG  G  G +GE G  G+ GD+G TG    +GE GDKG A     T    + G KG  G KG  G+ G+KG  G+    G  G TGD+G  G  G  G    KG  G  G  G  G +G  G+KG  G  GA G  G +G+ G    T  +GE G  G  G +G KG+   +G  G+KG  G+    G+ G +G+ GD  + G  G KG+ G KG   DKGEA  K        KG  G++G+ GDKG TG  G  G  G KGE G  G  G  G   + G+KG  G KG+ G VG  G  G    T      G++G  G+ G  G  GD+GE G  G  G     G  G+ GA G  G  G+ GDKG +G+ G   ++  +G  G KG  GDKG  G  G KG   D  AT    A  E  D+    +KGE G  G  G  G  G  G+KG  G  G  G  G KG+ G  GE G++G  G     G  G+ GE G  G  GD+G                           TGDKG  G KG  G QG KG  G++GE G  G TG +G  G  G KG+ GD G+ G +G +      G  G KG  G KG  GD+G  G  G+  + G  G         E G  G  GD G  GD+G +GE GD G  G+ G  GE G +G TG+KG+AG  G  G             +G  GE G  G  G  GA G+QG +G+ G KG    G+KGE G  G  G  G KG  G   + G +G TG + A G  GD G  GD G  GD+G   D G  G  G +GE G+ G  GD+GE G +G TG  G +G  G KG TG+ G+ G  G  GD+G  GE GD   +      GD G KG  G++G    K      G KG+ GD+G +G  G TG VG  G  GDKG  GD G  G +G  G  G  G+ G  G  G  G  GD G  G+ GDKGA   +   G +   G  G+ G KGE G KG  G QG KGE G+         G  G +G  G+TG  G+ G+ G+ G  G  G+ G  G  G++G+ GD+G KGE G+KGE
Sbjct:  690 GDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG--ETGDKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGETG--------DKGEAGDKGLTGDKGETG-DKGEAGD-----------------------KGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETG---DKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGA-----------------------KGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGD------------QGAKGETGDKGEAGDKGATGDQGAKGETGDKG--ETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGET---GDKGETGDKGEAGDKGATGDQGAKGETGDK--------GATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGE 1933          

HSP 2 Score: 310.457 bits (794), Expect = 4.219e-81
Identity = 488/1313 (37.17%), Postives = 619/1313 (47.14%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE-GETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKAN-EFKDR-NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEK---GDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGPDGDNGTIGDE------------GDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKG 4276
            G+QG  GE G  G  G +G  G +G  G  GD G  G+ G  G  G  G  G  G+ GDKG  GD+G  G T   G  GD G  G  G +G  G KGE G KG  G  G  G +G+KG  G+KG  G +     K   GD+G KG +G  GE   D G + +                       +G  G  G  G+ G  GE G +G  GD+G KG  GD G  G+KG  G  G +GE G  G+ GD+G TG    +GE GDKG A     T     KG  G K      GE G KG+ G+ G  G TGD G  G  G  G +  KG            + G++GE G +G  G KG+ G +G+ G   E G+ G+ G +G KGE GDK   G KGE G  G + G +G  GD G+   +G  G +G +G  GDKGEA  K        KG  G++G+ GDKG TG  G  G  G KGE G  G  G  G     GE G KG  G  GL G+KGE G           G++G KGE G  G  GD+G  G  G  G  G  G  G+ GA G  G  G  GDKG +G+ G   +   +G  G +G KG+ G++G +G+KG A D  AT    A  E  D+   G+KG  G  G  G  G  GE G KG  G  G+ G  GD G+ G+KGE G++G     G+ GE+G+ G+ G KG  G                     +    +TGDKG  G KG  G QG KG  G++GE G  G TG +G  G  G KG+ GD G+ G +G +      G  G KG  G KG  GD+G  G  G     G  GE G  G  GD G  GD+G +GE GD G  G+ G  G+ G +G TG+K   GD G  G  G +G  G KG  G +G  G++G  G  G  GA G+QG +G+ G KG    G+KGE G  G  G  G KG  G   + G +G TG   A G  GD G  GD G  GD+            GDKG  G +G  G  G+ G  GD+GE G +G TG  G +                  G  GD+G+ G+KG + +   KG+ G KG  G++G K      GDKG+ GD+G +G  G TG                                                D G  G+ GDKGA   +   G +G +G+ GDKG  G+KG  G  G +G+ G+ GE               GD G TG  G +GE G  G  G  GE G+ G  G++G+ G+ G KGE G+KG
Sbjct:  462 GDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGETG-DKGEAGD-----------------------KGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDK------GEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------------ETGDKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKG-LTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGA---KGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDVGATGATGDKGETGDKGETGD---KGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATG--------------------DVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKG--ETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAK------------------GETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGET---GDKGETGDKGEAGDKGATG------------------------------------------------DQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEA--------------GDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKG 1620          

HSP 3 Score: 303.908 bits (777), Expect = 4.101e-79
Identity = 438/1144 (38.29%), Postives = 555/1144 (48.51%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDK---GDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG-TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL--------DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDK---GNRGPSGEKGWAEDCNATSKVKAN-EFKDR-NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G+QG  GE G  G  G +G  G +G  G  GD G  G+ G  G  G  G  G  G+ GDKG  GD+G  G T   G  GD G  G  G +G  G KGE G KG  G  G  G  G KG  G+KG  G +  K +   GDKGE G  G  G+                               G +GE G  G+ G  G  G++G +G  GD+G  G KG  G  G KG  G  GE G++G+ GDK   GD+G  G+  ++GE GDKG A     T     KG  G KG  G  GE G KG+ G+ G  G TGD G  G  G  G +  KG                  E G +G  G KG  G +G  G T  +GE G  G  G +G KG+   +G  G+KG  G+  G +G  GD G+   +G  G +G +G  GDKGEA  K              KG  G++G+ GDKG TG  G+ G KG  G+ G  G +G  G +   GE G KG  G  GL G+KGE G           G++G KGE G  G  GD+G  G  G  G  G  G  G+ GA G  G  G+ GDKG +G+ G   ++  +G  G KG  GDK   G++G +G+KG A D  AT    A  E  D+   G+KG  G +G  G  G  GE G KG  G  G+ G  GD G+ G+KGE G++G     G+ GE+G+ G+ G KG+ G               +           TGDKG  G KG  G QG KG  G++GE G  G TG  G  G  G KG+ GD G+ G +G +      G  G+KG  G KG  GD+G  G  G   + G  GE G  G  GD G  G+ G +GE GD G  G+ G  G  G +G TG+KG+AG  G  G  G  G  G KG  G  GE G  G  G  GA G+QG +G+ G KG +    + G++G  G  G KG  G KG  G     G  G+ G T   G KG++G  G+ G  G+ GDKG  G  G +GE G+ G  GDQG KG  G  G  G++G  G KG TG+ G  G++G+KG+ G  G  GD     KG+ G KG  G++G        G+ GDKG+ G  G  G  G  
Sbjct:  357 GDQGAKGETGDKGEAGDKGLTGDKGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGET--GDKGEAGDKGATGDQ------------------------------GAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------------------ETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGD-QGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGATGDQGAKGETGDKGETGDKGEAG--------------DKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGAT------GDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGD--QGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGAT 1427          

HSP 4 Score: 303.138 bits (775), Expect = 8.039e-79
Identity = 448/1154 (38.82%), Postives = 553/1154 (47.92%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTF-SIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL-DC-PKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGN------RGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD---IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIG---ARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTG---LPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-------TKGDIGQKGHRGNRGFK-SINIT--HGDKGDKGDEGPSGVNGTTGYV 3772
             KGE G  GE G  G  G +G  G +G  G  GD G  G+ G  G  G  G  G  G+ GDKG+ GD+G  G   + G  GD GE G  G  G  G KGE G KG  G  G  G +G+KG  G+KG  G      K   GD+G KG +G  GE            KG  G  G+ G KG  G++G +GE G  G+ G  G  G+KGL G  G+ G KG  GD G  G++G  G  G++GE G  G+ GD+GLTG   ++GE GDKG A     T     KG  G K      GE G KG+ G+ G  G TGD G  G  G  G +  KG                  E G +G  G KG  G +G      +GETG  G  G KG  GDK   G KGE G  G     G +G  GD G+   +G  G  G  G  GDKGE   K    D    G+ G++G+ GDKG TG  G  G +GAKGE    G KG+ G   + G+KG  G +G+ G  G+KGE G    T      GE G KGE G  G  GDQG +G  G  G  G  G  G+ GA G  G  G+ GDKG +G+ G   +    G  G KG  GDKG       +G +G+KG A D  AT  V A        G+KG  G  G AG  G  G+ G  G  G  G  G KG+ G  GE G++G  G     G  G+ GE G  G  GD+G                           TGDKG  G KG  G QG KG  G++G  G  G  G  G  G  G KG+ GD    G +G +G +      G  G+KG  G KG  GD+G  G  G     G  GE G  G  GD G  GD+G +GE GD G  G+ G  G+ G +G TG+KG+AG  G  G  G           G  G++G  G KG+ G   A G+QG +G+ G KG    G+KG  G  G KG  G KG  G     G  G+ G T   G  GD G  GD G  G+ GDKG  G  G +GE G+ G  GD+GE G +G TG     GE G  G+ G  G TG  G  G  GD+G+ G+KG++ +         KG+ G KG  G++G    +  T   GDKG+ GD+G +G  G TG V
Sbjct:  577 AKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAG-----DKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGLTG---DKGETGDKGEAGDKGATGDQGAKGETGDK------GEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------------------ETGDKGEAGDKGATGDQG-----AKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGATGDQGAKGE---TGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGAT----GDKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGA-----------------------KGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVG---------ATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKG--EAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGATGDV 1652          

HSP 5 Score: 303.138 bits (775), Expect = 8.107e-79
Identity = 496/1333 (37.21%), Postives = 627/1333 (47.04%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGT---------VGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPG---RPGEQGEQGKIGDKG---DRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGD---IGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG-TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNS----STGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGD---------RGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGR---RGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG-ITAIGLKGDSGPDGDNGTIGDEG---DKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGEKGE 4279
            KGE G  GE G  G  G QG  G  G  G  GD G  G+ G           G  G  G  G  G+ GDKG+ GD+G  G    G +G+ G++G  G +G+ G KGE G KG  G  G  G +G+KG  G+KG  G      K   GD G  G +G  GE   D G + +                        G  G  G  G+ G  GE G +G  GD+G KG  GD G  G+KG  G     G+QG +G+ GDKG   D+G TG    +GE GDKG A     T     KG  G KG  G  GE G KG+ G+ G  G TGD    G KG  G +G+    G  G  G+ G  G +G +GE G +G  G KG  G  G  G T  +GETG  G  G KG  GD  A G  G+KG  G+  G+ G +G+ GD   +G  G +G +G  GDKGEA  K        KG  G++G+ GDKG TG  G  G  G KG  G  G KG+ G   + G+KG  G KG+ G  G KGE G    T               G  G +G+ G++G  G  G  G  G  G+ GA G  G  G+ GDKG +G+ G       +G  G KG  GD+G +G +G+KG A D  AT  V A      +KGE G  G+ G  G  G  G KG  G  G+ G  G  GD G  GE G++G  G     G  G+ GE G  G  GD+G  G+ G  G  G KG  GD+G KG +     TGDKG  G KG  G QG KG  G++GE G  G TG  G  G  G KG+ GD G+ G +G +      G  G KG  G KG  GD         +G  G  G     G  G+ G  G  GD G  GD+G    +GE GD G  G+ G  GE G +G TG+KG+AG                   +G  G++G  G  G  G  G++G  GDQG KG    G+KGE G  G  G  G KG  G   + G +G TG + A G  GD G  GD G  GD+G   D+G  G  G +GE G+ G  GDQG KG  G  G  G++GA G                 GD+G+ G+KG++ +    GD G KG  G++G        G+ GDKG+ G  G  G  G  G                                             D G  G+ GDKGA   +   G +G +G+ GDKG  G++G KG  G +G+ G+ GE      G KG  G +G  G+TG  G+ G+ G  G  G  GE G+ G  G++G+ GD+G KGE G+KGE
Sbjct:  827 KGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATG--DQGAKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAG-----DKGATGDVGATGATGDKGETG-DKGATGDV-----------------------GATGATGDKGETGDKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDVGATGATGDKGETGD-KGETGDKGEAGD---KGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGAT---------------GDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGAT-GDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAG------------------DKGATGDQGAKGETGDKGEAGDKGATGDQGAKG--ETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKG---------------ETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATG---------------------------------------------DQGAKGETGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEA-----GDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGE 2023          

HSP 6 Score: 302.753 bits (774), Expect = 9.370e-79
Identity = 434/1149 (37.77%), Postives = 534/1149 (46.48%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNME---RGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFKG---DKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKG------------NRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKI---GARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
             KGE G  GE G  G  G  G  G  G  G  GD G  G+ G  G  G  G  G  G+ GDKG  GD+G  G T   G  GD GE G  G  G  G KGE G KG  G  G  G +G+KG  G+KG  G      K   GD+G KG +G  GE   D G + +              KG  G++G +GE G  G+ G  G  G+ G  G  GD+G  G KG  G  G KG  G  GE G++G  GD G  G TG   E   +GE GDKG    +  T A  DKG  G KG  G  GE G KG+ G+ G  G TGD G  G  G  G +  KG                  E G +G  G KG  G +G      +GETG  G  G +G KG+   +G  G+KG  G+    G +G +G+ GD  + G  G KG+ G KG   DKGEA  K        KG  G++G+ GDKG TG  G  G  G KGE G  G  G  G   + G+KG  G KG+ G VG  G  G    T      G++G  G++G  G  GD+GE G  G  G  G  G  G+ GA G  G  G+ GDKG +G+ G   ++   G QG KG  GDKG            ++G +G+KG A D  AT    A       KGE G  G+ G  G  G  G KG  G                                G  G+ GE G  G  GD+G KGE G                      GDKG  G  G  G  G KG  G++GE G  G TG +G  G  G KG+ GD G+ G +G +      G  G+KG  G KG  GD+G  G  G     G  GE G  G  GD G  GD+G +GE GD G  G+ G  G+ G +G TG+KG+AG  G           G  G  G  G++G  G KG+    GA G+QG +G+ G KG    G+KG  G  G KG  G KG  G     G  G+ G T   G  GD G  GD G  G+ GDKG  G  G +GE G+ G  GD+GE G +G TG  G +G  G KG TG+ G  G++G+KG+ G  G  GD       GD G+ G +G  G K      G KG+ GD+G +G  G TG
Sbjct:  949 AKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAG-----DKGATGDQGAKGETGDKGETG-DKGEAGD--------------KGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------------------ETGDKGEAGDKGATGDQG-----AKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGA-------KGETGDKGEAGDKGATGDQGAKGETGD------------------------------KGETGDKGEAGDKGATGDQGAKGETGD-----------------KGEAGDKGATGDVGATGATGDKGETGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGAT---------GDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKG--EAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATG 1989          

HSP 7 Score: 298.901 bits (764), Expect = 1.709e-77
Identity = 436/1144 (38.11%), Postives = 552/1144 (48.25%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLN---GTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFK---GDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLV------GEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLP---GIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG-ITAIGLKGDSGPDGDNGTIGDE---GDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
             KGE G  GE G  G  G QG  G  G  G  GD G  G+ G  G  G  G  G  G+ GDKG  GD+G  G    G +G+ G++G  G +G  G +G +G  G +G  G  G  G KG  G++G KG+  +K +   GDKG  G  G  GE   D G + +                       +G  G  G  G+ G  GE G +G  GD+G KG  GD G  G+KG  G  G +GE G  G+ GD+G TG    +GE GDKG A     T     KG  G K      GE G KG  G+ GL    G TGD G  G  G  G +  KG  G  GE G+KG+ G++G  G +G  G KG  G +G  G    +GETG  G  G KG  GD+ A+G  G+KG  G+    G +G +G+ GD    G  G  G +G K   GDKGEA  K  L   KG  G++G+ GDKG TG  G  G  G KGE G  G  G  G +   G+KG  G KG+ G V      G+KGE G    T      G++G KGE G  G  GD+GE G  G  G  G  G  G+ G  G  G  GD+G KG +G+ G   +   +G  G +G KG+ G++G +G+KG A D  AT    A + +  +KGE G  G  G  G  G  G+KG  G  G  G  G KG+ G  GE G++G  G     G+ G+ GE G  G  GD+G                          +TGD G  G  G++G  G KG  G++GE G  G TG  G  G  G KG+ GD G  G QG        G  G KG     G KG  GD+G  G  G     G  GE G  G  GD G  GD+G +GE GD G  G+ G  GE G +G TG+KG+AG                   +G  G++G  G  G  G  G++G  GDQG KG    G+KGE G  G  G  G KG  G   + G +G TG + A G  GD G  GD G  GD+   GD+G  G  G +GE G+ G  GDQG KG  G  G  G++         G  G+ G  G  GD+G+ G+KG + +   KG+ G KG  G++G K      GDKG+ GD+G +G  G TG
Sbjct:  508 AKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKG--ETGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEA--GDKGATGDQGAKGETG-DKGEAGD-----------------------KGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDK------GETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKG-LTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGD---KGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGA-KGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKG--------------------------ATGDVGATGATGDKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAG------------------DKGATGDQGAKGETGDKGEAGDKGATGDQGAKG--ETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQ---------GAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGET---GDKGETGDKGEAGDKGATG 1554          

HSP 8 Score: 294.664 bits (753), Expect = 3.330e-76
Identity = 434/1138 (38.14%), Postives = 543/1138 (47.72%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK----PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGE---QGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD---IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITH---GDKGDKGDEGPSGVNGTTGYV 3772
            G+QG  GE G  G  G +G  G  G  G  GD G  G+ G  G  G  G  G  G  GDKG+ GD+G  G    G  GD G  G  G +G  G KGE G KG  G  G  G  G KG  G+KG  G +  K     K   GD+G KG +G  GE   D G + +  KG+ G  G +G  G+KG  G QG  G  G  G+ G  GE G +G  GD+G KG  GD G  G+KG  G  G +GE G  G+ GD+G TG    +GE GDKG A     T      GA G KG  G  GE G KG+ G+ G  G TGD G  G  G  G +  KG                 G+KG  G  GAKG  G +G+ G   +GE G  G  G +G KG+   +G  G++G  G   G +G  GD G+   +G  G +G +G  GDKGEA  K        KG  G++G+ GDKG  G  G  G +GAKGE G  G         + G+KG  G  G+ G  G+KGE G    T      G+ G  G  G  G  GD+GE   +G  G  G  G  G  GE G  G  G  G+ GDKG +G+ G       +G  G KG  GD+G +G +G+KG A D  AT    A + +  +KGE G  G  G  G  G  G+KG  G  G+ G  G  GD G  GE G++GE G     G  G  GE G  G  GD+G KGE G                     TGDKG  G KG  G QG KG  G++G  G  G  G  G  G  G KG+ GD    G +G +G +      G  G+KG  G KG  GD+G  G  G     G  GE G  G  GD G  GD+G +GE GD G  G+ G  G+ G +G TG+KG+AG                   +G  G++G  G  G  G  G++G+ GDQG KG +   GE G+ G  G KG  G +G +G     G  G+ G T   G KG++G  G+ G  G  GD+G  G  G +GE G+ G  GDQG KG  G  G  G++GA                   GD+G  GE GD     KG+ G KG  G++G K         GDKG+ GD+G +G  G TG +
Sbjct: 1152 GDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETG--DKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETG-DKGEAGD--KGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG---------------ETGDKGATGDQGAKGETGDKGETGD--KGEAGDKGATGDQGAKGETGDKGATGDQGAKGET-GDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKG---------EAGDKGATGDVGATGATGDKGETGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGA-KGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGD-----------------KGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAG------------------DKGATGDQGAKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGAT------------------GDQGAKGETGD-----KGEAGDKGATGDQGAKGETGDKGETGDKGETGDKGEAGDKGATGDI 2198          

HSP 9 Score: 293.893 bits (751), Expect = 5.739e-76
Identity = 417/1139 (36.61%), Postives = 524/1139 (46.01%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKI-QEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDK---GDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL-DC-------PKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG-ITAIGLKGDSGPDGDNGTIGDE---GDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            + G++G  G+ G  G  G  G  G +G  G KG+ G  GE G  G+ G  G  G  G+ GDKG  GD+G  G T   G  GD G  G  G +G  G KGE G KG  G  G  G  G KG  G+KG  G +  K +   +G+ G+KG++G  GE   D G + +              KG  G++G +GE G  G+ G  G  G+ G  G  GD+G  G KG  G  G  G  G  GE G++G+ GDK   GD+G  G+  ++GE GDKG A     T     KG  G K      GE G KG+ G+ G  G TGD G  G  G  G +  KG                  E G +G  G KG  G +G  G    +GETG  G                 G+KG  G+V G  G  GD G+   +G  G +G +G  GDKGEA  K    D         KG  G++G+ GDKG TG  G  G  G KGE    G KG+ G   + G+KG  G +G+ G  G+KGE G    T      GE G KGE G  G  GDQG +G  G  G  G  G  GE G  G  G  G+ GDKG +G+ G       +G  G +G KG+ G++G +G+KG A D  AT           ++G KG  G  G AG  G  G++G                                   G  G+ GE G  G  GD+G                           TGDKG  G KG  G  G  G  G++GE G  G  G  G  G+ G KG+ GD G+ G +G +      G  G+KG  G KG  GD+G  G        G  GE G  G  GD G  GD+G +GE GD G  G+ G  GE G +G TG+KG+AG  G  G             +G  GE G  G  G  GA G+QG +G+ G KG    G+KGE G  G  G  G KG  G   + G +G TG + A G  GD G  GD G  GD+   GD G  G  G +GE G+ G  GD+GE G +G TG  G +G  G KG TG+ G+ G  G  GD+G  GE GD     KG+ G KG  G++G K      G+ GDKG  G  G  G TG
Sbjct:  778 LTGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGLTGDKGETG-DKGEAGD--------------KGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDK------GEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------------------ETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEA---------------GDKGATGDV-GATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDVGATGATGDKGE---TGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATG----------DQGAKGETGDKGEAGDKGATGDQGA---------------------------------KGETGDKGEAGDKGATGDQGA-----------------------KGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGAT------GDQGAKGETGDKGATGDQGAKG------ETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGD------------QGAKGETGDKGEAGDKGATGDQGAKGETGDKG--ETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGD-----KGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETG 1761          

HSP 10 Score: 283.108 bits (723), Expect = 9.340e-73
Identity = 413/1117 (36.97%), Postives = 509/1117 (45.57%), Query Frame = 2
Query:  524 PGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK----PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE---------MGANGTNGVIGDRGDKGFSGEPGLHSN--ET-IQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKAN-EFKDR-NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-------SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTG-ITAIGLKGDSGPDGDNGTIGDE---GDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS----TKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTG 3766
            PG  G  G  G  G  G  GDKG  GD+G  G T   G  GD G  G  G +G  G KGE G KG  G  G  G  G KG  G+KG  G +  K     K + GDKG  G  G  GE   D G + +                       +G  G  G  G+ G  GE G +G  GD+G KG  GD G  G+KG  G  G +GE G  G+ GD+G TG    +GE GDKG A     T     KG  G KG  G  GE G KG+ G+ G  G TGD G  G  G  G +                           G  GAKG  G +G+ G   +GE G  G  G +G KG+   +G  G+KG  G+  G +G  GD G+   +G  G +G +G  GDKGEA  K        KG  G++G+ GDKG TG  G  G  G KGE G  G  G  G   + G+KG  G KG+ G  G KGE G    T                     GD+GE G  G+ G  G+ G  GE          GA G  G  G+ GDKG +G+ GL  +  ET  +G  G KG  GD+G +G +G+KG A D  AT    A  E  D+   G+KG  G  G  G  G  GE G                        ++G  G     G  G+ GE G  G+ GD+G                           TGDKG  G KG  G QG KG  G++GE G  G TG +G  G  G KG+ GD G  G  G +      G  G KG  G KG  GD+G  G        G  GE G  G  GD G  GD+G +GE GD G  G+ G  G+ G +G TG+KG+AG  G  G +G  G  G KG  G  GE G  G+ G  GA+GE G +G+ G KG +       + G+KGE G  G  G  G KG  G   + G +G TG + A G  GD G  GD G  GD+   GD G  G  G +GE G+ G  GD+GE G +G TG  G +G  G KG  G+ G  G  G KG+ G  GE GD   +     KG+ G KG  G++G K      GDKG+ GD+G +G  G TG
Sbjct:  332 PGLKGPTGDKGETGDKGLTGDKGATGDQGAKGETGDKGEAGDKGLTGDKGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETG-DKGEAGD-----------------------KGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGA------------------------TGDQGAKGETGDKGETGD--KGEAGDKGATGDQGAKGETGDKGEAGDKGATGD-QGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGET---------------------GDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAG------------------------DKGATGDQGAKGETGDKGEAGDKGLTGDKG--------------------------ETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGATGDQGAKG------ETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGET---GDKGETGDKGEAGDKGATG 1317          

HSP 11 Score: 270.011 bits (689), Expect = 9.571e-69
Identity = 403/1055 (38.20%), Postives = 490/1055 (46.45%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPG---------TVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKG---DKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-IGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTG 3517
             KGE G  GE G  G  G QG  G  G  G  GD G  GE G           G  G  G  G  G+ GDKG  GD+G  G T   G  GD GE G  G  G  G KGE G KG  G  G  G +G+KG  G+KG  G      K   GD+G KG +G  GE   D G + +   G+ G +G +G  G+KGE G +G  G  G  G+ G  GE G +G  GD+G KG  GD G  G++G  G  G++GE G  G+ GD+G TG    +GE GDKG       T     KG  G KG  G  GE G KG+ G+ G  G TGD G  G  G  G +  KG                  E G +G  G KG  G +G  G    +GETG  G  G KG  GD  A G  G+KG  G+  G+ G +G  GD  + G  G KG+ G KG   DKGEA  K        KG  G++G+ GDKG  G  G  G +GAKGE G  G         + G+KG  G +G+ G  G+KGE G    T                     GDQG +G  G  G  G  G  G++GA G  G  G+ GDKG +G+ G   ++  +G  G KG  GDKG  G  G KG   D  AT    A + +  +KGE G  G+ G  G  G  G KG  G  G  G  G KG+ G  GE G++GE G     G  G  GE G  G  GD+G                           TGDKG  G KG  G QG KG  G++GE G  G  G  G  G+ G KG+ GD G+ G +G +      G  G KG  G KG  GD+G  G        G  GE G  G  GD G  G+ G +GE GD G  G+ G  G+ G +G TG+KG+AG  G  G             +G  GE G  G  G  GA G+QG +G+ G KG    G+KG  G  G KG  G KG  G     G +G  G T   G  GD G  GD G  G+ GDK         GE G+ G  GD+GE G +G TG
Sbjct: 1258 AKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAG-----DKGATGDQGAKGETGDKGE-AGDKGATGDV--GATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKG------ATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------------------ETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGD-KGETGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKG---------EAGDKGATGDQGAKGETGDKGEAGDKGAT---------------------GDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGA-KGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGA-----------------------KGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------ETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGD------------QGAKGETGDKGEAGDKGATGDQGAKGETGDKG--EAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDK---------GETGDKGETGDKGEAGDKGATG 2196          

HSP 12 Score: 256.529 bits (654), Expect = 1.337e-64
Identity = 362/957 (37.83%), Postives = 459/957 (47.96%), Query Frame = 2
Query:  971 GIPGKLGKNGTDGEKGL---EGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG-TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFK---GDKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKAN-EFKDRNK-GEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGE---QGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKT---GLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNS-TKGDIGQKGHRGNRGFK-SINIT--HGDKGDKGDEGPSGVNGTTGYV 3772
            G+ G  G  G  G+KGL   +G  GD+G KG  GD G  G+KG  G  G +GE G  G+ GD+G TG    +GE GDKG A     T     KG  G K      GE G KG+ G+ G  G TGD G  G  G  G +  KG                  E G +G  G KG  G +G  G T  +GE G  G  G +G KG+   +G  G+KG  G+    G+ G +G+ GD  + G  G KG+ G K   GDKGEA  K        KG  G++G+ GDKG  G  G  G +GAKGE    G KG+ G   + G+KG  G +G+ G  G+KGE G    T      GE G KGE G  G  GDQG +G  G  G  G  G  G+ GA G  G  G+ GDKG +G+ G       +G  G KG  GD+G +G +G+KG A D  AT    A  E  D+ + G+KG  G  G+ G  G  G+KG                     E G++G  G     G  G+ GE G  G  GD+G+                          TGDKG  G KG  G QG KG  G++GE G  G TG  G  G  G KG+ GD G  G QG        G  G KG  G +G +G+ G+ G  G+    G  GE G  G  GD G  GD+G +GE GD G  G+ G  G+ G  G TG+KG+ G  G                 G +G  G  G KG+ G +GE   +G  GDQG KG    G+KGE G  G  G  G  G QG   + G +G  G    G  GD G  G+ G  G+ GDKG  G  G +GE G+ G  GD+GE G +G T   G  GE G  G+ G  G TG +G +G  GD+G+ G+KG + +   KG+ G KG  G++G    +  T   GDKG+ GD+G +G  G TG V
Sbjct:  333 GLKGPTGDKGETGDKGLTGDKGATGDQGAKGETGDKGEAGDKGLTGDKGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDK------GEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------------------ETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGE---TGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGLTGDKGETGDKG---------------------EAGDKGATGDQGAKGETGDKGETGDKGEAGDKGL--------------------TGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGLTGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGAT---------------GDVGATGATGDKGETGDKGETGDKGATGDQGAKG--ETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGD--KGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDV 1202          

HSP 13 Score: 239.965 bits (611), Expect = 1.695e-59
Identity = 357/910 (39.23%), Postives = 435/910 (47.80%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNG-TLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFKG---DKGEAATKCEL-DC-PKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKAN-EFKDR----NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPG---IKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGN---TGPDGENGTRGLTGEKGDA 3079
            G+QG  GE G  G  G +G  G +G  G  GD G  G+ G  G  G  G  G  G+ GDKG  GD G  G T   G  GD GE G  G  G  G KGE G KG  G  G  G +G+KG  G+KG  G +  K +   GDKGE G  G+ G    D G + +                     G +GE G  G  G  G  GE G +G  GD+G  G KG  G  G KG  G  GE G++G  GD+G +G TG   ++GE GDKG A     T     KG  G K      GE G KG+ G+ G  G TGD G  G  G  G +   G VG  G  G+KG+ G++GE G +G  G KG+ G +G  G T  +GETG  G  G KG  GD+ A+G  G+KG  G+    G +G +G+ GD    G  G  G +G KG   DKGEA  K    D    G+ G++G+ GDKG  G  G  G +GAKGE G  G  G  G +   G KG  G KG+ G  G KGE G    T               G  G  GD+G  G  G  G  G  G  G+ GA G  G  G+ GDKG +G+ G   ++  +G  G KG  GD+G +G +G+KG A D  AT    A  E  D+    +KGE G  G  G  G  G  G+KG  G  G  G  G KG+ G  GE G++G  G     G  G+ GE G  G+ GD+G KGE G                     TGDKG  G KG  G QG KG  G++GE G  G TG  G  G  G KG+ GD G  G QG        G  G KG  G    KG  GD+G  G  G     G  GE G  G  GD G  GD+G +GE GD G  G+   TG  GE G +G TG+ G A
Sbjct: 1359 GDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGET--GDKGETGDKGEAG----DKGATGDQ--------------------GAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETG---DKGETGDKGEAGDKGATGDQGAKGETGDK------GEAGDKGATGDVGATGATGDKGETGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGET---------------GDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGVTGDQGAKGETGD-----------------KGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGETGDKGEAGDKGATGDIGSA 2201          

HSP 14 Score: 174.481 bits (441), Expect = 1.476e-39
Identity = 306/787 (38.88%), Postives = 378/787 (48.03%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPG---------TVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCEL--DCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKG---NRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIG 2713
             KGE G  GE G  G  G QG  G  G  G  GD G  GE G           G  G  G  G  G+ GDKG  GD+G  G T   G  GD GE G  G  G  G KGE G KG  G  G  G +G+KG  G+KG  G +     K   GD+G KG +G  GE   D G + +      G +G  G KGE G++G  G+ G  G +G  G  G+KG  G  G+ G KG  GD G+ G++G  G  G++GE G  G+ GD+G TG    +GE GDKG A     T     KG  G K      GE G KG+ G+ G  G TGD G  G  G  G     G  G                   +G  G KG  G +G  G    +GETG  G  G KG  GD+ A+G  G+KG  G+  G +G  GD G+   +G  G KG  G +G KGE   K        KG  G++G+ GDKG  G  G  G +GAKGE G  G  G  G   + G+KG  G KG+ G  G KGE G    T      G++G  G++G  G  GD+GE G  G  G  G  G  G+ G  G  G  GD+G KG +G+ G   ++ + G QG KG  GDKG   ++G +G+KG   D  A  +         +KGE G  G  G  G  G  G+KG  G  G  G  G KG+ G  GE G++G  G     G  G+ GE G  G  GD+G KGE G  G  G KG  GD+G      TGDKG  G KG  G +G  G KG  G+IG
Sbjct: 1453 AKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGE-AGDKGATGDV-----GATGATGDKGETGDKGETGDKGATGDVGATGATGDKGETGDKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDK------GEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATG------------------DKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGD-QGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGVTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGET-------GDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGA--KGETGDKGETGDKGETGDKGEAGDKGATGDIG 2199          

HSP 15 Score: 160.999 bits (406), Expect = 1.708e-35
Identity = 224/649 (34.51%), Postives = 280/649 (43.14%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-------TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK----PKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAE---DCNATSKVKANEFKD 2308
            + G+QG  GE G  G  G +G  G +G  G +G  G  G+ G  G  G  G  G  G+ GDKG+ GD+G  G       T   G  GD G  G  G  G  G KGE G KG  G  G  G +G+KG  G+KG  G +        K + GDKG  G  G  GE   D G + +                       +GE G  G  G  G  GE G +G  GD+G KG  GD G  G+KG  G  G  G+QG  G+ GD+G TG    +GE GDKG A     T     KG  G KG  G  GE G KG+ G+ G  G TGD G  G  G  G +  KG                  E G +G  G KG  G +G      +GETG                   KGE G  G V G +G +G+ GD    G  G  G +G  GD+G           KG  G++G+ GDKG TG  G  G  G KGE G  G  G  G   + G+KG  G KG+ G  G KGE G                           D+GE G  G  G  G  G  G+ G  G  G  GD+G KG +G+ G    ET  G +G  G KG+ G++G +G+ G A      N +   + N++ D
Sbjct: 1681 VTGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDVGATGATGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETG-DKGETGD-----------------------KGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKG------------------ETGDKGEAGDKGATGDQG-----AKGETGD------------------KGEAGDKG-VTGDQGAKGETGDKGETGDKGEAGDKGATGDQG----------AKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETG---------------------------DKGEAGDKGATGDQGAKGETGDKGEAGDKGATGDQGAKGETGDKG----ET--GDKGETGDKGEAGDKGATGDIGSARGIVTYNVSGNTEKNDYPD 2220          
BLAST of Collagen alpha-1(IV) chain vs. TrEMBL
Match: A0A3S0CJT6 (Uncharacterized protein (Fragment) OS=Arenibacter sp. GUO666 OX=2489054 GN=EHW67_13420 PE=4 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 5.640e-80
Identity = 445/1218 (36.54%), Postives = 574/1218 (47.13%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNG-TFSIGTRGDNGERG------------------INGTQGINGTKGERGPKGFEGTMGVNGTKGSKG------RIGEKGLKGKE-ANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN-----VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKG------KDGTSEKPGEKGRKGSKGSNGLVGEKGEIGY------INRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSN--ET----IQGLQGYKG------IKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGP---VGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNAT------------MGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGA---RGEQGIRGDQGIKGGSSPGEKGEVGSPGLK---------GYFGGKGVQGMPAKDGRRGNTGITAI----GLKGDSGPDGDNGTIGD---EGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGD-------SVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
             +G QG  GE G  G  G+QG  G +G  G  G  G  G  G  G  G  G  G  G+ GDKG++G +G  G T + G +GD G +G                    G QGI G KG++G  G +G  G+ G KG KG        GEKG KG+  A   K   GD+GE+G+ G+ G+        +    G  G  G            IQGE G  G+ G+ G   E+G++G  G  G  G +G+ G+ GE G  G  GEQG QG+ GDKGD G TG      E+G+ G    I  T A                GE G +G  G+ G  G  G+ GLKG  G  G++ ++G            + G  G KG +GI G KG  G +G     I+GETG+ G +G +G KGD  A+G++GEKG  G+       G++G  GD G   ++G  G  G  G KGDKG+           G+ GE+GD GD G TG  G  G +G +GE G  G KG        G +   G++G +G +G  G+ GEKGE G          T A    G+ G  GEKG  G +G+QG QG  G  G  G  G  G+ GA G  G  GD+GD G  GE G+     ET     QG QG KG       KGDKG+ G  GE+G   +  AT   K ++     +GEKG  G  G  G     G  GEKG                                   G+ GE GE G  G +G +GI+GE G  G  G +G +G+ G  G +    +G +GLKG+ G  G +G++GE+GE G  G TG  G  G  G KGD+GD G  G QG                    GI G  G  G KG +GD G  G  G     G  GE+G  G  G  G  G++G  G  GD G  G TG  GE G  G TGEKG  G  G                 G  GE+G+ G KG+ GA   +GEQG++GD G     + GEKG+ G+ G +         G  G KG QG     G  G TG T      GLKGD+G  G+ G  GD   +GDKG  G  G++GE G++G  GD+G+ G +G+ G+ GE+G  G KG  G+TG  G+ G+KGD+G  GEKGD            KGD G +G +G +G K      G KGD+GD+G  G  G TG 
Sbjct:  472 AQGAQGIQGEKGDTGAQGEQGIQGEKGETGATGATGDQGIQGEKGETGAQGEQGVQGEKGDKGEQGIQGETGATGAQGEKGDTGAKGDKGDTGATGATGATGATGAKGDQGIQGEKGDKGDTGAQGEQGIQGEKGDKGDTGATGATGEKGDKGETGATGAKGDTGDQGEQGIQGEKGDTGATGATGATGATGEKGDQG------------IQGETGATGEKGEKG---EQGIQGETGATGATGAQGEQGIQGETGATGAQGEQGIQGEKGDKGDTGATG------EKGETGATGAIGATGA---------------QGEQGIQGEKGDKGDTGAQGEQGLKGEKGDTGAQGIQG------------ETGATGAKGEQGIQGEKGDTGAQG-----IQGETGATGAKGEQGLKGDTGAQGIQGEKGDKGDTGATGATGEKGETGDTGATGAKGDTGATGATGEKGDKGDT-------GATGAAGEKGDKGDTGATGATGAQGEQGIQGETGATGAKGDTGATGATGATGAKGDQGEQGIQGEQGIQGEKGETGAKGDQGIQGETGAKGDKGDTGATGEKGETGAQGEQGIQGETGATGATGAKGDKGDTGAQGIQGEKGDKGDTGSQGEQGIQGEKGETGATGAQGEQGLKGETGATGAKGDKGDTGAQGEQGIQGETGATG-AKGDKGDTGAQGEKGDTGATGATGEKGDTGATGEKG------------------------------DTGATGATGEKGETGATGAQGAQGIQGEKGDTGAQGEQGIQGETGATGGTGA--QGEQGLKGDTGATGAQGIQGEKGETGATGATGEKGETGATGEKGDKGDTGATGAQGIQGETGATGATGATGAKGDQGIQGETGATGAKGDKGDTGAQGEQGVQGEKGDKGEQGIQGETGATGAQGEKGDTGAKGDKGDTGATGATGEKGDTGATGEKGATGEKGDT---------------GAQGEQGVQGEKGETGATGAQGEQGLKGDTG-----ATGEKGDTGATGAQGIQGETGATGATGAKGDQGEQGVQGETGATGATGAQGEQGLKGDTGATGEKGDKGDQGIQGDKGDTGAQGIQGEKGDSGEKGDKGDTGAQGEQGIQGEKGETGAKGDKGDTGATGEKGDKGDQGIQGEKGDTGATGATGATGAKGDTGAQGDQGIQGEKGETGATGAKGDQGDQGIQGETGATGA 1576          

HSP 2 Score: 285.804 bits (730), Expect = 7.910e-74
Identity = 500/1433 (34.89%), Postives = 632/1433 (44.10%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGL---------------------KGDIGCDGEPGTVGIDGKNGTHGTPGK---IGDKGDEGDRGPNG----------TFSIGTRGDNGERGINGTQGINGTKGERGPKGF---------------------EGTMGVNGTKGSKGRIGEKGLKGKEANKPKI----QEGDKGEKGMSGKDGENCT-----------DTGRS-SNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGL------TGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDC--PKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNAT-------SKVKANEFKDR-------NKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGS------------------------KGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLK------GYFGGKGVQGMPAK------------DGRRGNTGIT-AIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNGLSGDPGDKGAACGRSMDGFSXXXXXXXXXXXXXXXXXXXRFGLQGQKGENGEPVLXXXXXXXXXXXXXXXXXTGPIGDQGEIGKNGTDGIIGEMGENGTIGERGSPGDRGLKGEMGE 4270
            +KG  G  G  G  G  G QG  G +G  G                      KGD G  GE G  G  G  G  GT G+    G+KGD+GD G  G          T + G +GD GE+GI G QGI G  G  G KG                      +G  G+ G KG+ G  G +G +G +  K         G+KGE G +G  GE              +TG + +   KG  G +G  G KGE G  G QG  GI G+ G  G  GE+G++G  G+ G  G  GD G+ GEKG  G  GEQG QG+ GDKG++G+      TG   E+G+ G KG       T A    GA G KG +G  GE G KG  G  G  G  G+ G KG  G  G+   KG                  +KG  G  GAKG  G +G+ G  I+GE G  G  G  G  G         EKG  G + G+ G  G+ G+   +G+ G  G  G  G +GE   + E      +G  G +G+ GDKG TG  G+ G  GA G  G  G +G+ G   + G+KG  G++G  GL GEKG+ G                            QG QG  G  G  G+ G  GE G  G  G+ G+ G  G  GE GL  +   QG+QG KG KGD G  G +GEKG   D  AT       +     E  D+         GEKG  G  G  G  G  GE+GI+G  G  G+ G  G  G  G  G +G+QG+    G  G  GE G+ G KGD+GI                         +TG+KG  G +G QG QG  G  G  G  G  G TG  G+ G  G KGD G  G++GIQG        G  G +GL G  G  G +G+ G        G  GE+G  G  G  G  GD+G  G  G+ G  G TG  GE G  G TGEKGD G  G  G +G  G  G +G +G+ GE+G  G+                        KG  GA G QGI+G++G  G + + GEKGE G+ G K      G  G +G+QG                 G +G TG T A G KGD+G  G+ G  G++GDKG  G  G  G  G  G  GD G KG +G TG  G             TG+ G +G  G++G  GEKGD+       V   KG+ G  G +G +G K      G+KGD G  G  G+ G TG  G  G  GD+G QG  G  G  G  G  G  G KG  G  G+ G  GD G+ GD GD GA                               G+QG+KG++GE               GD G TG  G+QG  G+ G  G  G+ G+ G  GE+G  GD+G++GE G+
Sbjct:  217 LKGATGATGAKGDTGAQGDQGIQGEKGETGATGEKGETGATGATGATGAKGDKGDQGIQGEKGNTGATGATGAQGTQGETGATGEKGDKGDTGAQGEQGIQGEKGDTGATGAKGDQGEQGIQGEQGIQGETGATGAKGATGEKGDKGATGATGATGEKGDKGDQGIQGEKGNTGATGAQGAQGIQGEKGDTGATGATGEKGETGATGATGEKGETGAQGEQGIQGETGATGATGEKGDTGATGATGEKGETGATGAQGAQGIQGEKGDTGAQGEQGIQGEKGETGATGATGDQGIQGEKGETGAQGEQGVQGEKGDKGEQGIQGETGATGAQGEKGDTGAKGDKGDTGATGATGATGATGAKGDQGIQGEKGDKGDTGAQGEQGIQGEKGDKGDTGATGATGEKG------------------DKGETGATGAKGDTGDQGEQG--IQGEKGDTGATGATGATGATG------EKGDQG-IQGETGATGEKGEKGEQGIQGETGATGATGAQGEQGIQGETGATGAQGEQGIQGEKGDKGDTGATGEKGETGATGAIGATGAQGEQGIQGEKGDKGDTGAQGEQGLKGEKGDTGA---------------------------QGIQGETGATGAKGEQGIQGEKGDTGAQGIQGETGATGAKGEQGLKGDTGAQGIQGEKGDKGDTGATGATGEKGETGDTGATGAKGDTGATGATGEKGDKGDTGATGAAGEKGDKGDTGATGATGAQGEQGIQGETGATGAKGDTGATGATGATGAKGDQGEQGIQGEQGIQGEKGETGAKGDQGI-----------QGETGAKGDKGDTGATGEKGETGAQGEQGIQGETGATGATGAKGDKGDTGAQGIQGEKGDKGDTGSQGEQGIQGEKGETGATGAQGEQGLKGETGATGAKGDKG------DTGAQGEQGIQGETGATGAKGDKGDTGAQGEKGDTGATGATGEKGDTGATGEKGDTGATGATGEKGETGATGAQGAQGIQGEKGDTGAQGEQGIQGETGATGGTGAQGEQGLKGDTGATGAQGIQGEKGETGATGATGEKGETGATGEKGDKGDTGATGAQGIQGETGATGATGATGAKGDQGIQGETGATGAKGDKGDTGAQGEQGVQGEKGDKGEQGIQGETGATGAQGEKGDTGAKGDKGDTGATG------------ATGEKGDTGATGEKGATGEKGDTGAQGEQGVQGEKGETGATGAQGEQGLKGDTGATGEKGDTGATGAQGIQGETGATGATGAKGDQGEQGVQGETGATGATGAQGEQGLKGDTGATGEKGDKGDQGIQGDKGDTGA------------------------------QGIQGEKGDSGEK--------------GDKGDTGAQGEQGIQGEKGETGAKGDKGDTGATGEKGDKGDQGIQGEKGD 1522          

HSP 3 Score: 285.034 bits (728), Expect = 1.313e-73
Identity = 419/1231 (34.04%), Postives = 554/1231 (45.00%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFS-------------------IGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGK---NGTDGEKGLEGIPGDRGLKGI---------KGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGL---TGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANG------TNGVIGDRGDKGFSGEPGL--------HSNET-IQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGR---------QGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGING---SKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-------GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGN---------------NGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----------VNSTKGDIGQKGH---------------------RGNRGFKSINITHGDKGDKGDEGPSGVNG 3757
            KG+QG  GE G  G  G QG  G +G  G KGD G  G  G  G  G+ G  G  G  GD+G++G +G  G                       G  G  GE+G  G QGI G  G  G  G +G  G+ G  G+ G  GE+G++G        ++GDKG+ G +G+ GE    TG +                    G  G QGE GI G+ G     G  GE+GL+G  GD G +GI         KG+ G+ GEKG  G  G QGE G  G KG++GL   TG    +GE+GDKG       T    +             G+ G+ G+ G+ G  G TG+ G KG  G  G+   KG                      +G  GA G  G +G+ G  I+GETG+ G +G  G  G   A G KG++G  G + G++G +G+ G+  ++G  G++G+ G KGDKG+     E    KG  G +G+ G +G TG  G  G KG KG+ G  GI+G+       G+KG  GS+G  G+ GEKGE G           GE G  G KG  G  G QGEQGI G  G  G  G  G+ GA G        G  G++GD G +GE G            ET   G QG +GI+G+KG+ G  GE+G                    +GE+G  G  G  G  G  GEKG                              +    G+ GE GE G  G KGD+G                           TG  G +G++G  G          +G +G++GE G  G  G  G  G  G  G +G++GD G++GIQG +      G  G KG  G KG +GD G  G  G     G  GE+G  G  GD G  G++G +GE G+ G  G  G  G  G  G TGEKGD G  G  G++G  G  G  G +G  GE+G+ G   + G  GA+GEQG++GD G  G    G+KG+ G  G KG  G +G+QG     G +G+ G T         G KG++G  GD G  G  G+KG  G  G++GE G+                G  GDQG +G +G+TG  G +G  G +GI GETG  G +G KG+ G  GEKGD           +   KGD G +G                      +G++G +      G+KGDKGD G +G  G
Sbjct:  578 KGDQGIQGEKGDKGDTGAQGEQGIQGEKGDKGDTGATGATGEKGDKGETGATGAKGDTGDQGEQGIQGEKGDTGATGATGATGATGEKGDQGIQGETGATGEKGEKGEQGIQGETGATGATGAQGEQGIQGETGATGAQGEQGIQG--------EKGDKGDTGATGEKGE----TGATGAI-----------------GATGAQGEQGIQGEKGDKGDTGAQGEQGLKGEKGDTGAQGIQGETGATGAKGEQGIQGEKGDTGAQGIQGETGATGAKGEQGLKGDTGAQGIQGEKGDKGDTGATGATGEKGE------------TGDTGATGAKGDTGATGATGEKGDKGDTGATGAAGEKG---------------------DKGDTGATGATGAQGEQG--IQGETGATGAKGDTGATGATGATGAKGDQGEQG-IQGEQGIQGEKGETGAKGDQGIQGETGAKGDKGDTGATGE----KGETGAQGEQGIQGETGATGATGAKGDKGDTGAQGIQGE------KGDKGDTGSQGEQGIQGEKGETGATGAQGEQGLKGETGATGAKGDKGDTGAQGEQGIQGETGATGAKGDKGDTGAQGEKGDTGATGATGEKGDTGATGEKGDTGATGATGEKGETGATGAQGAQGIQGEKGDTGAQGEQGI-------QGETGATGGTGAQGEQGLKGDTGATGAQGIQGEKG------------------------------ETGATGATGEKGETGATGEKGDKG--------------------------DTGATGAQGIQGETGATGATGATGAKGDQGIQGETGATGAKGDKGDTGAQGEQGVQGEKGDKGEQGIQGETGA---TGAQGEKGDTGAKGDKGDTGATGATGEKGDTGATGEKGATGEKGDTGAQGEQGVQGEKGETGATGAQGEQGLKGDTGATGEKGDTGATGAQGIQGETGATGATGAKGDQGEQGVQGETGATGATGAQGEQGLKGDTGATG--EKGDKGDQGIQGDKGDTGAQGIQGEKGDSGEKGDKGDTGAQGEQGIQGEKGETGAKGDKGDTGATGEKGDKGDQGIQGEKGDTGATGATGATGAKGDTGAQGDQGIQGEKGETGATGAKGDQGDQGIQGETGATGANGEKGETGATGEKGDKGDTGAQGEQGIQGEKGDTGAQGEQGIQGDTGATGATGATGATGEKGDQGIQGETGATGEKGDKGDTGATGAKG 1665          

HSP 4 Score: 273.863 bits (699), Expect = 3.934e-70
Identity = 416/1207 (34.47%), Postives = 549/1207 (45.48%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGING---------------TQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKG---------LEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPG------------LNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKR------------GFKGDKGEAATKCE--LDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENG------------TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPG---------------TDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKG-------DSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGY 3769
             +GEQG  GE G  G  G QG  G +G  G  G  G  GE G  G  G  G  G  G+ G  G++GD+G  G    G +GD G +GI G                +G  G  GE+G KG +GT G  G  G+ G  GE+GLKG                G +G  G    DTG                           QG+ GI G+ G+ G  GEKG           G  GD+G +GI+G+ G  G  G  G  G QGE G  G+KGD+G TG   E+G +G+KG            ++G +G +G +G  G  G+KG+ G  G              G  GD G++G  G  G+   +G  GI GE G+ G  G  GEKG  G  GA G  G+ G  G   I+GETG+ G  G KG+ G   A G KGE G  G   G +G +G+ GD  ++G  G++G++            G +G+KGE   + E  +   KG  GE+G  G+ G TG  G+ G  GAKG+ G              G KG  G   + G+KG  G++G  G+ GEKG+ G    T A    G++G+ G  G  G  GDQGEQGI G  G                 G  G  GE GA G  G  G++G +G +G  G    +  QG+QG  G  G +G +G  GEKG   D  AT             GEKG  G  G  G  G  GE+GI+G                                G  G++G  G+ G+KG++G                           TG +G +G  G  G +G +G++GE+G+ G  G  G  G  G  G +G +GD G +GIQG        G  G+ G  G KG  GD G  G  G+  + G  GE+G     GD G  G  G +G+ GD G  G TG  GE G +G TG  G  G  G  G  G  G KG +G +G+ GE+GI G KG+ GA+G+QGI+G+ G K     G+KG+ G+ G KG  G +G QG+  + G  G TG  A G KGD+G  G  G  GD+GD G  G  G++GE G  G  G QGE+G +G+TG  G +                  G+KGD G  GE+G             KGD G +G +G+ G        GD G  G++G +G  G TG 
Sbjct:   79 AQGEQGIQGETGATGATGAQGEQGLKGDTGATGAQGIQGEKGDTGATGAKGDQGIQGETGATGEKGDKGATG--EKGDKGDTGAQGIQGEKGETGATGATGATGEKGETGATGEKGDKGDQGTQGETGATGATGAQGEQGLKGA--------------TGATGAKG----DTG--------------------------AQGDQGIQGEKGETGATGEKGETGATGATGATGAKGDKGDQGIQGEKGNTGATGATGAQGTQGETGATGEKGDKGDTGAQGEQGIQGEKGDTGATGAKGDQGEQGIQGEQGIQGETGATGAKGATGEKGDKGATGATGATGEKGDKGDQGIQGEKGNTGATGAQGAQGIQGEKGDTGATGATGEKGETGATGATGEKGETGAQGEQGIQGETGATGATGEKGDTGATGATGEKGETGATG-AQGAQGIQGEKGDTGAQGEQGIQGEKGETGATGATGDQGIQGEKGETGAQGEQGVQGEKGDKGEQGIQGETGATGAQGEKGDTGAKGDKGDTGATGATGATGATGAKGDQGIQGEKGDKGDTGAQGEQGIQGEKGDKGDTGATGATGEKGDKGETGATGAKGDTGDQGEQGIQGEKGDTGATGATGATGATGEKGDQGIQGETGATGEKGEKGEQGIQGETGATGATGAQGEQGIQGETGATGAQGEQGIQGEKGDKGDTGAT-------------GEKGETGATGAIGATGAQGEQGIQGE------------------------------KGDKGDTGAQGEQGLKGEKG--------------------------DTGAQGIQGETGATGAKGEQGIQGEKGDTGAQGIQGETGATGAKGEQGLKGDTGAQGIQGEKGDK---GDTGATGATGEKGETGDTGATGAKGDTGATGATGEKGD---KGDTGATGAAGEKGDKGDTGATGATGAQGEQGIQGETGATGAKGDTGATGATGATGAKGDQGEQGIQGEQGIQGEKGETGAKGDQGIQGETGAK-----GDKGDTGATGEKGETGAQGEQGIQGETGATGATG--AKGDKGDTGAQGIQGEKGDKGDTGSQGEQGIQGEKGETGATGAQGEQGLKGETGATGAK------------------GDKGDTGAQGEQGIQGETGATGAKGDKGDTGAQGEKGDTGATGATGEKGDTGATGEKGDTGATGATGE 1138          

HSP 5 Score: 257.684 bits (657), Expect = 3.187e-65
Identity = 379/1131 (33.51%), Postives = 498/1131 (44.03%), Query Frame = 2
Query:  407 KGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGN--VMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNET---------------------IQGLQGYKG------IKGDKGNRGPSGEKGWAEDCNATS---------------------------KVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGD---------RGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERG------------------------INGSKGKIGARGEQGIRGDQGIKGGS----SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITA-IGLKGDS---GPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRG 3508
            KG+QG  GE G  G  G++G  G +G  G  G  G  GE G  G  G  G  G  G  G+KGD+GD G  G    G  G  G  G  G QG  G +GE+G KG  G  G  G KG KG  G +G++G+         G KGE+G+ G+ G    DTG                               GI G+ G  G  GE+GL+G  G +G++G KGD G  G  G  G  GE G+ G  G KGD G TG   E+G++GD G                          GE G KG  G  G  G  G+ G++G  G  G++   G  G  G  G KG +G +G +G +GI G KG  G +G  G  I+GETG+ G +G  G  G+K   G +GE+G  G     G  G +GD GD  ++G+ G KG +G  G +GE   + E        GE G  G +G  G  G+ G  GAKG+ G  G +G+ G   + G  G KG KG  G  GEKG+ G    T      G                 GE+G  G  G  G+ G  G  GA G  G+ G++GD G  GE G+                           QG+QG KG        G+KG  G +GEKG   D  AT                            +  A   K  +KG+ G  G+ GV G  G  GE+GI+G                                G+ G  GE G  G KGD+G                          +TG+KG  G KG+ G QG +G++GE+GE G  G  G  G+ G+ G  G++GD G  G QG        G  G+KG  G +GVQG+         +G  G  G+  + G  G++G  G  GD G  G +G +GE GD+G  G+ G  G  G +G+ GEKG+ G  G  G  G  G KG KG +G+ GE+G                        I G KG+ GA G +G +GDQGI+G +    + GEKGE G+ G KG  G  G QG     G +G+TG     G++GD+   G  G  G  G++GD+G+ G  G  GE G+ G  G  G KG +G
Sbjct:  665 KGDQGIQGETGATGEKGEKGEQGIQGETGATGATGAQGEQGIQGETGATGAQGEQGIQGEKGDKGDTGATG--EKGETGATGAIGATGAQGEQGIQGEKGDKGDTGAQGEQGLKGEKGDTGAQGIQGETGAT-----GAKGEQGIQGEKG----DTGAQ-----------------------------GIQGETGATGAKGEQGLKGDTGAQGIQGEKGDKGDTGATGATGEKGETGDTGATGAKGDTGATGATGEKGDKGDTGATGA---------------------AGEKGDKGDTGATGATGAQGEQGIQGETGATGAKGDTGATGATGATGAKGDQGEQGIQGEQGIQGEKGETGAKGDQG--IQGETGAKGDKGDTGATGEKGETGAQGEQGIQGETGATGATGAKGDKGDTGAQGIQGEKGDKGDTGSQGEQGIQGEK-------GETGATGAQGEQGLKGETGATGAKGDKGDTGAQGEQGIQGETGATGAKGDKGDTGAQGEKGDTGATGATGEKGDTGAT---------------GEKGDTGATGATGEKGETGATGAQGAQGIQGEKGDTGAQGEQGIQGETGATGGTGAQGEQGLKGDTGATGAQGIQGEKGETGATGATGEKGETGATGEKGDKGDTGATGAQGIQGETGATGATGATGAKGDQGIQGETGATGAK-GDKGDTGAQGEQGVQGEKGDKGEQGIQGE------------------------------TGATGAQGEKGDTGAKGDKG-----------DTGATGATGEKGDTGATGEKGATGEKGDTGAQGEQGVQGEKGETGATGAQGEQGLKGDTGATGEKGDTGATGAQGIQGETGATGATGAKGDQGEQGVQGETGATGATGAQGEQGLKGDTGATGEKGDKGDQGIQGDKGDTGAQGIQGEKGDSGEKGDKGDTGAQGEQGIQGEKGETGAKGDKGDTGATGEKGDKGDQGIQGEKGDTGATGATGATGAKGDTGAQGDQGIQGEKGETGATGAKGDQGDQGIQGETGATGANGEKGETGATGEKGDKGDTGAQGEQGIQGEKGDTGAQGEQGIQGDTGATGATGATGATGEKGDQGIQGETGATGEKGDKGDTGATGAKGDKG 1668          

HSP 6 Score: 252.677 bits (644), Expect = 1.181e-63
Identity = 398/1184 (33.61%), Postives = 501/1184 (42.31%), Query Frame = 2
Query:  620 TFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIE-GETGSIXXXXXXXXXXXXXXXXVKGEK------GYYGNV--------------MGKEGPRGDPGDDSSEGVPGVKGKR------GFKGDKGEAATKCE--------LDCPKGSIGERGD------------LGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGR---IGMDGNNGTKGDRGDIGQKGIQGPSNP---------------------NATMGIPGSKGLPGIKGVQGD---------RGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGE---------------NGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGV---IGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGIT-AIGLKGDSGPDGDNGTIGDEGDKGMNGTI---------GLEGEIGNNGT---------------IGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS----------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            T + G +GD G +G  G QG  G KGE G  G +G  G  G  G++   GE+GLKG         +G +GEKG +G  GE                               GIQGE G  G  G     GE+GL+G  G  G +GI+G+ G  G  G  G  G QGE G  G+KGD+G T      GE+GDKG            + GA G  G+ G  GE G+ G  G+ G  GT G+ G  G  G  G + +KG                       G  GAKG  G +G  G   E GETG+ G +G  G  G   A G KG+K      G  GN                G  G +GD GD  ++G  G++G++      G KGD+GE   + E            KG+ GE+GD             GDKG  G  G+ G  GA G  G  GI+G+ G +   G  G KG  G+ G  GEKGE G                            QGEQGI G  G     G  GE G  G  G  G++G+ G +G  G       QG+QG KG  G +G +G  GEKG      AT     ++     KGE G  G+ GV G  G  GE+GI+G                                G+ G  GE G  G KGD+G      T                     G+KG+KG  G QG QG +G KG++G+ G  G TG     G  G  G KGD GD G++GIQG                             G  G KG  G +G+QG+         +G  G  G   + G  GE+G  G  GD G  G  G +GE G  G IG TG  GE                G +GL GEKGD G  G  G  G  G KG +GI+G     G +GI G  G  GA+GEQG++GD G +G    GEKG+ G  G  G  G KG  G     G +G+TG T A G KGD G  G  G  G++GDKG  G           G++GE G  G                 GDQGE+G +G+ G+ GE+G  G KG  G  G+ G  G+KGD G  GEKG++               G  G KG +G+ G + I    GDKGD G +G  G+ G  G  
Sbjct:    8 TGATGAKGDTGAQGEQGIQGETGEKGETGATGEKGDTGATGATGAQ---GEQGLKGD--TGATGAQGIQGEKGDTGAQGEQ------------------------------GIQGETGATGATGAQ---GEQGLKGDTGATGAQGIQGEKGDTGATGAKGDQGIQGETGATGEKGDKGAT------GEKGDKGDTGAQGIQGEKGETGATGATGATGEKGETGATGEKGDKGDQGTQGETGATGATGAQGEQGLKG---------------------ATGATGAKGDTGAQGDQGIQGEKGETGATGEKGETGATGATGATGAKGDKGDQGIQGEKGNTGATGATGAQGTQGETGATGEKGDKGDTGAQGEQGIQGEKGDTGATGAKGDQGEQGIQGEQGIQGETGATGAKGATGEKGDKGATGATGATGEKGDKGDQGIQGEKGNTGATGAQGAQGIQGEKGDTGATGATGEKGETGATGATGEKGETGA---------------------------QGEQGIQGETGA---TGATGEKGDTGATGATGEKGETGATGAQGA------QGIQGEKGDTGAQGEQGIQGEKGETGATGATG----DQGIQGEKGETGAQGEQGVQGEKGDKGEQGIQGE------------------------------TGATGAQGEKGDTGAKGDKG-----DTGATGATGATGATGAKGDQGIQGEKGDKGDTGAQGEQGIQGEKGDKGDTGATGATGEKGDKGETGATGAKGDTGDQGEQGIQGEKGDTGATGATGATGATGEKGDQGIQGETGATGEKGEKGEQGIQGETGATGATGAQGEQGIQGETGATGAQGEQGIQGEKGDKGDTGATGEKGETGATGAIGATGAQGEQGIQGEKGDKGDTGAQGEQGLKGEKGDTGAQGIQGETGATGAKGEQGIQGEKGDTGAQGIQGETGATGAKGEQGLKGDTGAQG--IQGEKGDKGDTGATGATGEKGETGDTGATGAKGDTGATGATGEKGDKGDTGATGAAGEKGDKGDTGATGATGAQGEQGIQGETGATGAKGDTGATGATGATGAKGDQGEQGIQGEQGIQGEKGETGAKGDQGIQGETGAKGDKGDTGATGEKGETGAQGEQGIQGETGATGATGAKGDKGDTGAQGIQGEKGDKGDTGSQGEQGIQGEKGET 1049          

HSP 7 Score: 221.861 bits (564), Expect = 3.850e-54
Identity = 328/929 (35.31%), Postives = 439/929 (47.26%), Query Frame = 2
Query: 1022 EGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDG----RRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            +GI G+ G  G KGD G  GE+G  G  GE+GE G  G+KGD G TG    +GE+G KG             +G +G KG  G  GE G +G  G  G  G  G+ GLKG  G  G++ ++G                      +G  GA G  G +G     I+GETG+                   GEKG  G      G +GD GD  ++G+ G KG+ G  G  G    K E     G+ GE+GD GD+GT G  G  G  GA+GE G  G  G        G KG  G++G  G+ GEKGE G           GE G  G  G  G +GD+G+QGI G  G  G  G  G  G  G  G  G++GDKG +G             QG +GI+G+KG+ G +G KG                   ++GE+G  G+ G+ G  G  G KG  G  G  G+ G  G  G+ G+KG+QG QG+    G+ G  G  G  G KGD G                          +TG+KG  G  G  G +G  G +GE+G  G+ G TG  G  G+ G  G  G+ G+ G  G        G  G  G  G +G+QG++G  G  G     G+ GE+G  G  G+ G  G++G +GE G  G  G TG  GE G  G  G+KGD G  G  G  G  G KG +GI+G  G++G  G++G+ G +GE+G +GD G  G +   G+KGE G+ G KG  G +G QG+  + G            A G KGD G  G+ G  G++G+KG     G++GE G  G  G QGE+G +G+TG  G +         GE G  G+ G+KGD G  GEKG++           +G+ G +G +G++G        G KG+KGD G  G+ G TG  
Sbjct:    2 QGIQGETGATGAKGDTGAQGEQGIQGETGEKGETGATGEKGDTGATGATGAQGEQGLKGDTGATGA------QGIQGEKGDTGAQGEQGIQGETGATGATGAQGEQGLKGDTGATGAQGIQG---------------------EKGDTGATGAKGDQG-----IQGETGAT------------------GEKGDKGAT----GEKGDKGDTGAQGIQGEKGETGATGATGATGEKGET----GATGEKGDKGDQGTQGETGATGATGAQGEQGLKGATGA------TGAKGDTGAQGDQGIQGEKGETGATGE------KGETGATGATGATGAKGDKGDQGIQGEKGNTGATGATGAQGTQGETGATGEKGDKGDTG------------AQGEQGIQGEKGDTGATGAKG-------------------DQGEQGIQGEQGIQGETGATGAKGATGEKGDKGATGATGATGEKGDKGDQGIQGEKGNTGATGAQGAQGIQGEKGDTGA-----------------------TGATGEKGETGATGATGEKGETGAQGEQGIQGETGATGATGEKGDTGATGATGEKGETGATGAQGAQGIQGEKGDTGAQGEQGIQGEKGETGATGATGDQGIQGEKGETGAQGEQGVQGEKGDKGEQGIQGETGATGAQGEKGDTGAKGDKGDTGATGATGATGATGAKGDQGIQGEKGDKGDTGAQGEQGIQGEKGDKGDTGATGATGEKGDKGETGATGAKGDTGDQGEQGIQGEKGDTGATGATGATGATGEKGDQGIQGETGATGEKGEKGEQ---GIQGETGATGATGAQGEQGIQGETGATGAQ---------GEQGIQGEKGDKGDTGATGEKGETGATGAIGATGAQGEQGIQGEKGDKGDTGAQGEQGLKGEKGDTGAQGIQGETGAT 794          

HSP 8 Score: 211.46 bits (537), Expect = 6.241e-51
Identity = 357/1043 (34.23%), Postives = 462/1043 (44.30%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI----------------------------GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKE----------------ANKPKIQEGDKGEKGMSGKDGE--NCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV--MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENG---------------TLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINR------TAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRN--------KGEKG------FPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXX-------XXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD------IGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRG------------LTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQG 3208
             +GEQG  GE G  G  G+QG  G +G  G  G  G  GE G  G  G  G  G  G  G+KGD+GD G  G   +                            G +GD G +GI G  G  G KGE+G KG  G  G+ G KG KG  G  G  G++                A     ++GDKG+ G +G  GE  +  DTG +                 G +GE+GIQGE G  G  G  G  G  G  G  GD+G +GI+G+ G+ GEKG  G  G+QG QG+ G KGD+G TG   E+GE G +G   I   T A                G  G+KG  G+ G  G  G+ G KG  G  G + ++G                      +G  GA G  G++G     ++GETG+ G +G KG+ G +  +G++GE G  G     G  G +G+ GD  + G  G KG  G  G+KG+           G  GE G  G +G  G  G+ G  GA+GE G                 G+KG  G +   G +G KG  G+ G  GEKGE G          T A    G +G+ G  G  G  G +G+QGI G  G  G  G  G+ GA G  GV G++GDKG  G  G       QG +G  G KGDKG+ G +G  G   D  AT +  A   K           +GEKG        G+ G+ G  G  GEKG  G  G  G  G  G  G  G KG+QGEQG     G+ G +G  G+ G+KGD G  GE G  G  G          +        +   GDKG+ G +G QG QG KG  G +G+ G  G TG  G  G+ G +G++GD       G  G +G +      GI G KG  G  G +GD+G+ G  G   + G  GE+G  G  G+ G  GD G +GE G  G  G+TG  GE G +G             TGEKGD G+ G                 G  GE+G  G  G  GA+G++G
Sbjct:  700 AQGEQGIQGETGATGAQGEQGIQGEKGDKGDTGATGEKGETGATGAIGATGAQGEQGIQGEKGDKGDTGAQGEQGLKGEKGDTGAQGIQGETGATGAKGEQGIQGEKGDTGAQGIQGETGATGAKGEQGLKGDTGAQGIQGEKGDKGDTGATGATGEKGETGDTGATGAKGDTGATGATGEKGDKGDTGATGAAGEKGDKGDTGATGAT--------------GAQGEQGIQGETGATGAKGDTGATGATGATGAKGDQGEQGIQGEQGIQGEKGETGAKGDQGIQGETGAKGDKGDTGATGEKGETGAQGEQGIQGETGA---------------TGATGAKGDKGDTGAQGIQGEKGDKGDTGSQGEQGIQG---------------------EKGETGATGAQGEQG-----LKGETGATGAKGDKGDTGAQGEQGIQGETGATGAKGDKGDTGAQGEKGDTGATGATGEKGDTGATGEKGDTG----ATGATGEKGETGATGAQGAQGIQGEKGDTGAQGEQGIQGETGATGGTGAQGEQGLKGDTGATGAQGIQGEKGETGATGATGEKGETGATGEKGDKGDTGATGAQGIQGETGATGATGATGAKGDQGIQGETGATGAKGDKGDTGAQGEQGVQGEKGDKGEQGIQGETGATGAQGEKGDTGAKGDKGDTGATGATGEKGDTGATGEKGATGEKGDTGAQGEQGVQGEKGETGATGAQGEQGLKGDTGATGEKGDTGATGAQGIQGETGATGATGAKGDQGEQGVQGETGATGATGAQGEQGLKGDTGATGEKGDKGDQGIQGDKGDTGAQGIQGEKGDSGEKGDKGDTGAQGEQGIQGEKGETGAKGDKGDTGATGEKGDKGDQGIQGEKGDTGATGATGATGAKGDTGAQGDQGIQGEKGETGATGAKGDQGDQGIQGETGATGANGEKGETGATGEKGDKGDTGAQGEQGIQGEKGDTGAQGEQGIQGDTGATGATGATGATGEKGDQGIQGET---------------GATGEKGDKGDTGATGAKGDKG 1668          

HSP 9 Score: 110.538 bits (275), Expect = 3.842e-20
Identity = 128/351 (36.47%), Postives = 176/351 (50.14%), Query Frame = 2
Query: 2786 QKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDG---NCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAK------------DGRRGNTGITA-IGLKGDSGPDGD---NGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDS-------VNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNG 3757
            ++GIQG +      G  G++G  GI+G  G++G  G  G   +  + G  G +G  G  GD G  G +G +GE GD G  G  G  GE G  G TG +G+ GL G                 G  G +GI G KG  GA G    +GDQGI+G + + GEKG+ G+ G KG  G  G QG+  +             G +G TG T   G KGD G  G+    G  G +G++G+ G  G  G  G+ G  GDQG +G +G+TG  GE+   G+ G TG TG  G  G+KGD+G  GEKG++          T+G+ G  G +G++G        G +G+KGD G +G  G
Sbjct:    1 EQGIQGETGATGAKGDTGAQGEQGIQGETGEKGETGATGEKGDTGATGATGAQGEQGLKGDTGATGAQGIQGEKGDTGAQGEQGIQGETGATGATGAQGEQGLKGDT---------------GATGAQGIQGEKGDTGATG---AKGDQGIQGETGATGEKGDKGATGEKGDKGDTGAQGIQGEKGETGATGATGATGEKGETGATGEKGDKGDQGTQGETGATGATGAQGEQGLKGATGATGAKGDTGAQGDQGIQGEKGETGATGEK---GETGATGATGATGAKGDKGDQGIQGEKGNTGATGATGAQGTQGETGATGEKGDKGDTGAQGEQGIQGEKGDTGATGAKG 330          
BLAST of Collagen alpha-1(IV) chain vs. TrEMBL
Match: A0A4E0RFF2 (Collagen alpha-1(IV) chain OS=Fasciola hepatica OX=6192 GN=D915_002897 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.062e-78
Identity = 462/1262 (36.61%), Postives = 600/1262 (47.54%), Query Frame = 2
Query:  206 STNKSEKCLNICTSDRCKCVGIKXXXXXXXXXXXXXXXXLKGNRXXXXXXXXXXXXXXXXXXXXXXIKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK--PKIQEGDKGEKGMSGKDGENCTD--TGRS-SNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGS------ECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV-MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGI---------------PGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSK--VKANEF----------------KDRNKGEKG---------FPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGD----------NGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGF---------KSINITHGDKGDKGDEGPSGVNGTTGYV 3772
             T +SE+C  ICT D+C+CVG  G  G PG  G  GP G  G  G PG  GP G +G     GK G KG+ G PG  G  G  G QG+ G  G  G KGD GCDGEPG +G+ G  G  GT G  G +G +G +G  G    G  G+ GE G  G+ GI G  G +GP+G+ G  G +G  G++G  G+ G  G+        +++GD G  G  G+ G  C +    R+     + + G +G+ G KG+KG  G+ G+ G PG  G  G  GEKG  G PG  G  G  G  G PGE G  G  G +G+ G  G+KGD G  G++ +RG +G +G      C      KG  G K      G  G KG  G PG  G  G+ GL G +GP G+      +C  G VG PG+ GN G  G+ G  G  G PG  G  G  G +  +  GE G  G +G +G KG     G +GEKG  G+  +G  G  G+PGD    G  G+ G  G  G KGE    C L CP G  G RGD GD G  G+ G  G  G  G+ G +G  G  G +   G KG  G  G  G  G+ GE   + R    +                 GDQGE+G PG                 G +G  G  GE+G  G  G  G+ GD G  G PG +  + + G  G KG  G +G +G  G  G + +C    K  +  NE                 ++  KGE+G          P + G  GP GP GEKG  G +G +GS+G  G                      VGE GE G PG +G EG+       G  G +G+ GD G+ G  S GDKG  G KG+ G QG  G  G +G++G+ G     G+DG  G KGD G+ G  G +G  + +   G PG KG  G  G  G  G  G +  C  +GL G+ G  G PG+ G  GD+G  G++GD          NGT G+TG +G  G  G  G KG+ G  G  G +G +         G  GE G  G  G +G  GE G+ GD G  G S  GE+G+ G  G KG  G  G  G+  + G  G  G  +  +KG+ GP G++      G+ G +G  G +GE G  G  G++G+ G RGK G  G+RG  G+KG  GE G+ G  G KGD G+ GE G+      G  G+ GH G +GF         K    T G+ GD+G+ GP G  GT G V
Sbjct:   44 QTQQSERCSLICTPDKCQCVGKTGKPGRPGAMGTYGPEGPPGEPGKPGPPGPTGDKGDPSPRGKEGQKGQAGEPGLPGFAGVHGMQGYPGEPGLPGEKGDNGCDGEPGDIGLKGDRGEPGTKGLPGFEGLKGMKGFAGDTRQGLMGEKGEIGEPGSVGIEGDPGPKGPEGYPGPRGPDGMPGARGLPGDVGPPGRPGTYIVTIVEKGDMGLPGPRGEPGYPCDEGMVNRTIEELARIAFGPTGEMGEKGDKGATGLPGDDGEPGHPGLPGLKGEKGYPGSPGREGDVGDIGPPGEPGEAGDSGVDGPRGDPGDFGEKGDPGPYGRDGQRGPKGRQGPPGKYECPIDQMPKGVIGEK------GYKGEKGEHGEPGERGKMGEKGLPGAEGPKGTQGYAGKQCQAGPVGEPGQKGNYGSSGDPGWPGEPGEPGKTGERGPPGDDAVVEVGEVGRDGVQGFRGPKGAPGDPGEQGEKGLSGDHDIGAPGAPGEPGDLGDPGPIGLPGLPGMPGPKGERLATCPL-CPDGLDGPRGDPGDDGVAGYKGAAGLDGDSGDPGPMGEDGPTGETGIKGAKGSIGEPGHEGEKGDPGEAAIVTRDVEGVIP---------------GDQGEEGKPGATGDPGDRGDDGPPGETGDEGPKGPEGEIGEPGPIGEHGELGDVGSPGLPGENITDIV-GELGQKGEPGVRGAKGMPGRPGLSYNCTLDKKDFLVENETDIDGERGEKGEPGEVGEEGPKGERGRKGETGKAPLPAERGDRGPPGPQGEKGDLGPMGIEGSVGPDGPE-------------------GVGEQGETGDPGERGPEGL------KGYKGEQGDFGDNGIGGPLSEGDKGEAGPKGDDGEQGDLGEDGLKGDVGEKGLP---GVDGGPGEKGDVGETGDPGPKGQPSVDMEDGEPGEKGEQGPDGPAGLVGEPGDEAICIEIGLRGDDGPQGEPGEAGPEGDQGEEGDVGDAGEDAPGPAMNGTKGDTGAEGLPGLEGEDGPKGEPGAVGPEGEKGDI---------GPAGEVGDPGPDGPVGKDGEPGVDGDPGPDGESIKGEQGDTGIQGPKGNDGEAGEPGVAGETGEPGEAGEESAMVKGEQGPPGEDAEPAVPGEPGPDGEPGPKGEAGEAGPEGEKGDPGVRGKPGKAGQRGPQGEKGKIGEPGEDGPVGPKGDVGEPGEPGEPSELIPGASGKPGHPGLKGFVGEPGEVGDKGETGTEGEPGDEGEVGPLGPEGTAGPV 1245          

HSP 2 Score: 268.855 bits (686), Expect = 3.030e-68
Identity = 139/325 (42.77%), Postives = 195/325 (60.00%), Query Frame = 2
Query: 4604 GKQGDRGGSGPTGLRIKGKMGIKGTPGIPGDTGIKGERAAI------------------NRSEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLP-IQNPVKVNEVKSLISRCVVCSAPANVYAFHKQSTLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQV-TDMNSFTKPLGETF-GTQMELEKTISRCRVCVKNM*FESW*KFERR*CNYFIYSM**IVKKNLFYISL 5515
            G+ G++G  G  G+ ++G  GI+G PG  G+ G  G +  +                  N S +LFARH+Q  T +    CPEGT+++ TGYS+VM GG + L +MDLG+P+SCL KFS+ P+  C+R   C  N+R+ RSYWL++ +P  + P+ VNE    I+RCVVC AP +V+AFH Q+   + PCP TW ELW G SLI+HTSG  GG QQLSSPGSC+E  R++P+IECNN    CH W DAKVYYLR +      F KPLG T   T+  +   +S+CRVC+KN+                +Y++   +  ++  I++
Sbjct: 1499 GETGEKGEKGQPGI-VEGPRGIEGEPGERGEQGHIGPQGLVGEPGPPGPEGKKGEPGETNYSTVLFARHYQ--TPDVDLVCPEGTSMLFTGYSYVMGGGVDDLVSMDLGTPSSCLIKFSSLPLTQCERDTMCQSNMRHERSYWLATSVPRSEKPLPVNETSDRIARCVVCEAPTHVFAFHSQAETME-PCPNTWKELWTGVSLILHTSGKHGGGQQLSSPGSCMEQFRYSPVIECNNNVGMCHYWSDAKVYYLRALDPSRTQFEKPLGFTMKATEGPVLNNVSKCRVCMKNVVIHFGLLSNVTGTKITVYALCYSLTTDIICIAV 1819          

HSP 3 Score: 255.373 bits (651), Expect = 3.845e-64
Identity = 134/301 (44.52%), Postives = 172/301 (57.14%), Query Frame = 2
Query: 4598 TKGKQGDRGGSGPTGLR-----IKGKMGIKGTPGIPGDTGIKGERAAINR------------SEILFARHFQKLTDNDTYECPEGTNLIRTGYSFVMSGGNEHLTAMDLGSPASCLEKFSATPVIHCDRQPGCHFNIRNARSYWLSSLLPI-QNPVKVNEVKSLISRCVVCSAPANVYAFHKQ-STLQKTPCPETWTELWRGYSLIMHTXXXXXXXXXXXXXXXCLEYLRFAPIIECNNVANKCHQWPDAKVYYLRQVTDMNSFTKPLGETFGTQMELEKT----ISRCRVCVKNM*FESW 5431
             KG +G+ G  GP G        KG+ G++G PG  G  G+ G+R                 S  LF RHFQ    +    CP G+N I  GYSFVM+ GN  L  MDLGS +SC+  FS  P   C R   C   +R  RSYWL++  P+   P+ V EV+  ++RCV+C AP   YAFH Q + L    CP  W+ELW GYS +MHT+GS GG QQLSSPGSCLEY R++P++ECNN  + CH W DAK YYLR V++   F KP+G+        + T    ISRCRVC+K   F+S+
Sbjct: 3306 PKGSKGEMGLPGPQGREPGMPGAKGEPGVRGPPGDVGPRGMPGDRGPTGPMGPGGPPGQALLSTYLFTRHFQ--NPDAELTCPLGSNKIGEGYSFVMANGNGELVTMDLGSHSSCISMFSIMPFFQCLRDGTCQLGVRADRSYWLATTEPLPMMPLDVAEVRRRVARCVICEAPTQPYAFHAQGNQLHDVYCPNGWSELWNGYSFVMHTAGSTGGGQQLSSPGSCLEYFRYSPLLECNNGMSLCHYWSDAKAYYLRHVSNGTEFQKPIGKYMTEDARDDTTVLREISRCRVCLKRR-FQSY 3603          

HSP 4 Score: 229.18 bits (583), Expect = 4.186e-56
Identity = 421/1247 (33.76%), Postives = 544/1247 (43.62%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSI----GTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANK-------PKIQEGD---------------KGEKGMSGKDGENCTDT--GRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDR---------GLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLK---GPDGPL---GSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNV-MGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSV--GESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGD------IGQKGIQGPSNPNATMGIPG--------------------SKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGF---------------------PGTPGDNGTIGDRGRRG------EMGDNGTIGNTGPD---GENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSS-------PGEKGEVGSP--------------GLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXX---XXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            G  G  GE G  G DG  G +G RGP G  G  G  GE GT G  G+ G  G PG  G+KGD GD G  G   +    G  G++GERG  G  G  G +G  GP+G  G  G+ G  G  G  G+ GL G E ++       P  + GD               +GE G  G  G+NCT T          G  G  GK G KG  G +G QG+ G  G +G  G  GE G +G PG +         GLKGI G DGL GE+G P      G +G  GD G+ GL G   E GE G         CT     +            G  G  GS G PGL G  GD GLK   GP GP+   G +C  G  G PG  G+ G+ G  G  G  G PG  G+ G++G++G  I G  G  G  G  G  G K  +GV+GE+G  G    G  GP G+ G+    G+ G +GK G  G +GE   +C   C +G  G++GD GD+G  G PG  G  G+KGE G  G  G  G    PG +G  G +G  G  G KGE G        +                   +G +G PG+      +G  G+ G  G  G  G++GD+G  G PG           G +G+ G KG +G SGEKG+        K +  E     KG+KG PG+ G+ G  G  G  G                                + N +V  G+ GE G+PG +GD+                     G       GD G +G KG  GR G  G KG  G  G+ G  G  G  G  G  G +GD      +G +GI G        G+PG                     +G PG+ G QGD G +G  G     G MG +GF                     PG PG +G  G++G +G      E G+ G  G  GPD   GE G +G+ GE+G AG  G  G +G  G  G  G+ G +G+ G +G  G +G +G +G+ G +G++G          PGEKGE+G P              G+ G  G KG  G P   G +G  G+ A  + G+    GD G +G++G  G+ G  G  G  G+ GT G  G KG +G+ G PG RG  GK    G  G TG  G  G KG RG  G +G+   +  G  G+ G  G+RG   I    G++G  GD GP GV G  G +
Sbjct: 1906 GPVGLKGEKGDPGADGPDGPVGDRGPPGDFGQPGIHGEHGTSGEPGEKGAKGIPGCPGNKGDPGDAGDMGHRGVDGERGPPGEDGERGDVGDSG-PGRRGAPGPRGDPGMPGMKGDMGPIGPRGDPGLPGPEGDRGEDGSSGPMGEPGDPGESIIESQTPVKGVRGEPGDPGDPGQNCTVTMLDPERKALIGPPGDRGKPGPKGYPGPKGAQGDRGHDGTIGDPGNKGEPGRDGAPGPKGFQGNMGQPGLKGIAGRDGLIGERGLP------GPKGNPGDPGEDGLRGPYGEPGEPG-----GSKECTGILPGRPGPR--------GMPGLPGSKGQPGLPGVDGDRGLKGAIGPQGPMGDTGPDCPIGPPGRPGPKGSPGEPGRPGLAGFPGRPGDDGLPGEKGESGRGIRGMPGDPGDRGPDGPPGPKGPKGVQGERGPPGTKGAGLPGPMGEKGEKGIAGLMGKRGKPGSPGPEGEPGDRCS-PCRQGIPGQKGDKGDQGIPGTPGPRGRDGSKGERGDRGAPGNPGRMGPPGYEGVAGERGIPGPKGFKGEPGETRTEYQGVV------------------KGPKGYPGV------DGVKGQKGIKGIFGDAGEKGDRGLEGPPGDL---------GMRGLPGQKGPKGMSGEKGF--------KGQPAEVMMGLKGDKGTPGRPGLPGEPGVPGIPG------------------------NCTVNVIRSDNITVEKGDRGEKGEPGPRGDK-----------------GKPGGEGPPGKPGDDGIRGAKGIPGRPGPPGPKGATGYPGEPGERGDSGDPGLPGPVGPKGDRGAPGPVGDRGILGAKGEKGPAGLPGLGEKGDRGIPGRPGFAGLKGERGEPGLPGAQGDPGPDGLPGLPGDRGDMGPKGFEGDPGPSGGSGIKGVKGDSGKPGEPGLSGRPGEKGIQGQCLGPAEKGNTGLPGPRGPDGRKGEMGLKGMKGERGPAGEVGVPGEKGDTGPTGFPGLNGEVGDPGPSGRPGAVGPKGFEGMPGPKGLQGEPGAPGVDGLPGEKGEMGQPGQASIGEKGDVGDVGMPGEPGEKGATGRPGMRGDKGEPGLVADAIPGEV---GDPGDMGEKGFPGLPGDPGQAGPRGDPGTPGPIGPKGLQGEPGQPGVRGRPGKPGLDGRPGATGPKGFPGEKGARGVKGSRGEPGPTLVGRDGEPGDNGDRGASGIPGPKGNRGLPGDMGPKGVAGIPGRM 3046          

HSP 5 Score: 223.787 bits (569), Expect = 1.744e-54
Identity = 412/1178 (34.97%), Postives = 552/1178 (46.86%), Query Frame = 2
Query:  410 GEQGFPG-----EMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTH--GTPGKIGDKGDEGDRGPNGTFSI----------------------GTRGDNGERGI---NGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCT--DTGRS----SNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDR-----GLKGIKGDDGLPGEKGTPGRPG----------------EQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGT-----TGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSEGVPGVKGKRGFKGDKGEAAT-----KCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGLHSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGK---MGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTD---------GNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGSSPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNG--TIGLEGEIGNNGTIGDQGEKGRRGKTGLPGERXXXXXXXXXXXXXXXXXXXNKGDRGKIG--EKGDSVNSTKGDIGQKGHRGNRGF 3688
            GE+G PG     E+G  G DG QGF   RGP G  GD      PG  G  G +G H  G PG  G+ GD GD GP G   +                      G RGD G+ G+    G  G++G  G+ GP G +G  G  G KG+KG IGE G +G        ++GD GE  +  +D E     D G      +    G  G  G  G  G++G +G +GEIG PG +G++G  G+ G  G+PG+      G  G KG+ G+ G KG PGRPG                E    G+ G+KG+ G  G+   +GERG KG            D+G  G +G KG +G +G +GS+G  G  G      TGD G +GP+G                               +G  G +G FG  G  G L EG+ G  G                KG+ G  G+ +G++G +GD G+   +G+PGV G  G KGD GE        +  +D   G  GE+G+ G  G  G  G+ G +    E   +G++G DG   +PGE G +G +G  G VG+ GE       A N T G+ G +G  G  G  G +GE G  G  G  G  G  GE+G  G +G +G  G+ G  G+PG    E+I+G QG  GI+G KGN G +GE G A +     +  A E     KGE+G PG+     V G  GP+GE G KG  G+ G  G KGD G  G+ G+ G++G     G +GE GEDG  G KGD G  GE G    +                 G+ G  G KG  G +G  G +GE G +G  GT G +G DG+ G  G  G +G+ G  G   P+   G    +GL G  G +GDRG   +D         G   ++G  G RG PG+ G+ G IG++G+ G +G    IG+ G  GE+G  GL GE+G  G  G  G  G    +G     G  GERG  G  G++G +G  G+RG  G KG      KGEVGSPG  G  G  G  G+      +G+ G    G +G  G  G+ G  G +G KG+ G  T G +GE+  +G  GD GE G  GK G PGE                G++G KG++G+ G  E    +    G+ G++GH G +G 
Sbjct:  472 GERGPPGDDAVVEVGEVGRDGVQGF---RGPKGAPGD------PGEQGEKGLSGDHDIGAPGAPGEPGDLGDPGPIGLPGLPGMPGPKGERLATCPLCPDGLDGPRGDPGDDGVAGYKGAAGLDGDSGDPGPMGEDGPTGETGIKGAKGSIGEPGHEG--------EKGDPGEAAIVTRDVEGVIPGDQGEEGKPGATGDPGDRGDDGPPGETGDEGPKGPEGEIGEPGPIGEHGELGDVGSPGLPGENITDIVGELGQKGEPGVRGAKGMPGRPGLSYNCTLDKKDFLVENETDIDGERGEKGEPGEVGEEGPKGERGRKGETGKAPLPAERGDRGPPGPQGEKGDLGPMGIEGSVGPDGPEGVGEQGETGDPGERGPEG------------------------------LKGYKGEQGDFGDNGIGGPLSEGDKGEAG---------------PKGDDGEQGD-LGEDGLKGDVGE---KGLPGVDGGPGEKGDVGETGDPGPKGQPSVDMEDGEPGEKGEQGPDGPAGLVGEPGDEAICIE---IGLRGDDGPQGEPGEAGPEGDQGEEGDVGDAGE--DAPGPAMNGTKGDTGAEGLPGLEGEDGPKGEPGAVGPEGEKGDIGPAGEVGDPGPDGPVGKDGEPGVDGDPG-PDGESIKGEQGDTGIQGPKGNDGEAGEPGVAGETGEPGE--AGEESAMVKGEQGPPGEDAEPAVPGEPGPDGEPGPKGEAGEAGPEGEKGDPGVRGKPGKAGQRGPQGEKGKIGEPGEDGPVGPKGDVGEPGEPGEPSELIPGASGKPGHPGLKGFVGEPGEVGDKGETGTEGEPGDEGEVGPLGPEGTAGPVGPDGDQGPVGPEGPVGEPGEDGAQGPSGDYG---ERGLKGSAGEKGDRGPIASDCPPGSPGEPGMIGNVGEPGPRGEPGSKGETGRIGNKGKPGSVG----IGSWGEPGESGLPGLPGEQGLPGEQGPPGPPGQEAPEGDA---GEPGERGPTGQPGEVGEQGVAGLRGPDGPKG-----FKGEVGSPGPDGQDGADGEPGL------KGDVGPE--GERGSDGAPGETGPAGIDGPKGVAGVATKGEKGELAEDGERGDTGEPGEDGKDGEPGE---------------DGETGEKGEKGQPGIVEGPRGIEGEPGERGEQGHIGPQGL 1537          

HSP 6 Score: 221.476 bits (563), Expect = 9.191e-54
Identity = 409/1209 (33.83%), Postives = 532/1209 (44.00%), Query Frame = 2
Query:  467 FMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKGKEANKPKIQEGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGKLGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASII--NCTXXXXXXXXXXXXXXXXXVGE------IGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTL-IEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGDPGDDSSE---GVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERG------------------DLGDKGTTGFPGKNGTKGAKGENG-----------------------------TLGIKGKDGT--SEKPGEKGRKGSKGSNGLVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGE------------MGANGTNGVIGDR---GDKGFSGEPGLHSNE---TIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFK---------------GLKGERGEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGLPGIKGVQGDRGNNGTDGNCTSLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGI---------RGDQGIKGGSSP-GEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAI-GLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLP--GERXXXXXXXXXXXXXXXXXXXNKGDRGKIGEKGDSVNSTKGDIGQKGHRGNRGFKSINITHGDKGDKGDEGPSGVNGTTGYV 3772
            F    GP+G  GD G  G PG  G  G  G  G  G  G+KGD G  GP+G   +G RG  G+ G  G  G +GT GE G KG +G  G  G KG  G  G+ G +G +           GE+G  G+DGE   D G S                               PG+ G  G  G+ G+ G+ GD G  G +GD GLPG +G  G  G  G  G+ GD G+  +  +   +G RG+ G       NCT    D   K   G  G  G+       G KG+ G+ G +GT GD G KG  G  G+   KG  G  G+ G KG  G +G  G RG+PG KG  G  G++G     GE G  G                 G K   G + G+ GPRG PG   S+   G+PGV G RG KG  G          P+G +G+ G                  + G  G  GFPG+ G  G  GE G                               G +G  GT  +  PG  G KG KG  GL+G++G+ G           G+      +G PG +GD+G+QGIPG PG  G++G+ GE            MG  G  GV G+R   G KGF GEPG    E    ++G +GY G+ G KG +G  G  G            A E  DR  G +G PG +G+ G  G  G KG+                     +     Q      G  G+ G  G+PG+ G+ G+          G  G      ++ ++ T +KG++G KG  G +G K               G++G +G  G+ G  G  G  G  G  G+RGD G  G+ GP  P    G PG  G  GI G +G++G  G  G    LG  G+RG PG PG  G    +G RGE G  G  G+ GPD   G  GL G++GD G  G     G  G  G  GI+GV G+ G  G  G  G  GE+GI         +G+ G+ G   P G KGE+G  G+KG  G  G  G+P + G  G TG   + G  GD GP G  G +G +G +GM G  GL+GE G  G  G  GEKG  G+ G    GE+G +G  G+ GE G+ G +G  G RG  GE G   ++  G++G  G  G +GF  +       GD G  GP G  GT G +
Sbjct: 1874 FCSCYGPMGPMGDPGPRGFPGPAGPKGYPGEPGPVGLKGEKGDPGADGPDG--PVGDRGPPGDFGQPGIHGEHGTSGEPGEKGAKGIPGCPGNKGDPGDAGDMGHRGVD-----------GERGPPGEDGER-GDVGDSG------------------------------PGRRGAPGPRGDPGMPGMKGDMGPIGPRGDPGLPGPEGDRGEDGSSGPMGEPGDPGESIIESQTPVKGVRGEPGDPGDPGQNCTVTMLDPERKALIGPPGDRGKPGPKGYPGPKGAQGDRGHDGTIGDPGNKGEPGRDGAPGPKGFQGNMGQPGLKGIAGRDGLIGERGLPGPKGNPGDPGEDGLRGPYGEPGEPG-----------------GSKECTGILPGRPGPRGMPGLPGSKGQPGLPGVDGDRGLKGAIG----------PQGPMGDTGPDCPIGPPGRPGPKGSPGEPGRPGLAGFPGRPGDDGLPGEKGESGRGIRGMPGDPGDRGPDGPPGPKGPKGVQGERGPPGTKGAGLPGPMGEKGEKGIAGLMGKRGKPG---SPGPEGEPGDRCSPCRQGIPGQKGDKGDQGIPGTPGPRGRDGSKGERGDRGAPGNPGRMGPPGYEGVAGERGIPGPKGFKGEPGETRTEYQGVVKGPKGYPGVDGVKGQKGIKGIFG-----------DAGEKGDR--GLEGPPGDLGMRGLPGQKGPKGM-------------------SGEKGFKGQPAEVMMGLKGDKGTPGRPGLPGEPGV---------PGIPGNCTVNVIRSDNITVEKGDRGEKGEPGPRGDKGKPGGEGPPGKPGDDGIRGAKGIPGRPGPPGPKGATGYPGEPGERGDSGDPGLPGPVGPKGDRGAPGPVGDRGILGAKGEKGPAGLPG----LGEKGDRGIPGRPGFAGL---KGERGEPGLPGAQGDPGPD---GLPGLPGDRGDMGPKGF---EGDPGPSGGSGIKGVKGDSGKPGEPGLSGRPGEKGIQGQCLGPAEKGNTGLPGPRGPDGRKGEMGLKGMKGERGPAGEVGVPGEKGDTGPTGFPGLNGEVGDPGPSGRPGAVGPKGFEGMPGPKGLQGEPGAPGVDGLPGEKGEMGQPGQASIGEKGDVGDVGMPGEPGEKGATGRPGMRGDKGEPGLVADAIPGEVGDPGDMGEKGFPGL------PGDPGQAGPRGDPGTPGPI 2948          

HSP 7 Score: 213.386 bits (542), Expect = 2.305e-51
Identity = 364/1107 (32.88%), Postives = 479/1107 (43.27%), Query Frame = 2
Query:  404 IKGEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERG--------INGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGLKG--------------------KEANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGK-----LGKNGTDGEKGLEGIPGDRGLKGIKGDDGLPGEKGTPGRPGEQGEQGKIGDKGDRGLTGKNMERGERGDKGTASIINCTXXXXXXXXXXXXXXXXXVGEIGSKGSIGNPGLNGTTGDIGLKGPDGPLGSECVKGGVXXXXXXXXXXXXXXXXXXXHRGIPGAKGMFGKEGKNGTLIEGETGSIXXXXXXXXXXXXXXXXVKGEKGYYGNVMGKEGPRGD------PGDDSSEGVPGVKGKRGFKGDKGEAATKCELDCPKGSIGERGDLGDKGTTGFPGKNGTKGAKGENGTLGIKGKDGTSEKPGEKGRKGSKGSNG---------LVGEKGEIGYINRTAANITHXXXXXXXXXXXXXXXXDQGEQGIPGIPGTDGQNGTNGEMGANGTNGVIGDRGDKGFSGEPGL--HSNETIQGLQGYKGIKGDKGNRGPSGEKGWAEDCNATSKVKANEFKDRNKGEKGFPGKMGVAGPVGPNGEKGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATNGSVGESGEDGKPGMKGDEGIXXXXXXXXXXXXXXXXXXXXXXXNSSTGDKGNKGLKGNQGRQGFKGLKGER---GEIGQNGTTGRIGMDGNNGTKGDRGDIGQKGIQGPSNPNATMGIPGSKGL------PGIKGVQGDRGNNGTDGNCT--SLGLMGERGFPGTPGDNGTIGDRGRRGEMGDNGTIGNTGPDGENGTRGLTGEKGDAGLNGTIXXXXXXXXXXXXXIEGVIGERGINGSKGKIGARGEQGIRGDQGIKGGS-SPGEKGEVGSPGLKGYFGGKGVQGMPAKDGRRGNTGITAIGLKGDSGPDGDNGTIGDEGDKGMNGTIGLEGEIGNNGTIGDQGEKGRRGKTGLPGER 3532
             +G++G  G +G  G  G+ G  G  GP G +G++G   +PG  GI G++G  G  G  G KG+ GD G +G    G  G+ GE G        + G  G  G  G  G KG  G  GV+G +G KG IG +G  G                     E  +P +    G  G+ G+ G+ GE    +GR      G  G  G +G  G KG +G+QGE G PG       G  G  GEKG+ G+ G RG  G  G +G PG++ +P R   QG  G+ GDKGD+G+ G    RG  G K                           GE G +G+ GNPG  G  G  G+ G                                  RGIPG KG  G+ G+  T  +G          KG KG     GVKG+KG  G + G  G +GD      PGD    G+PG KG +G  G+KG      E+      +G +GD G  G  G PG+ G  G  G N T+ +   D  + + G++G KG  G  G           G+ G+ G           G  G KG  G PG  G++G+ G PG+PG  G  G  G  G  G  G++G +G+KG +G PGL    +  I G  G+ G+KG++G  G  G +G                   + G  G PG  G  G +GP G +                  G  G  G  G +G    +G  GE G  G+PG KG +G                    G     +TG  G +G  G +G  G KG+KGER   GE+G  G  G  G  G  G  G+ GD G  G  G   P    G+PG KGL      PG+ G+ G++G  G  G  +    G +G+ G PG PG+ G  G  G RG+ G+ G + +  P GE G  G  GEKG  GL G                 G  G RG  G+ G IG +G QG  G  G++G    PG  G  G+ G KG+ G KG +G+    G RG  G T +G  G+    GDNG  G  G  G  G  GL G++G  G  G  G  G  G+ GLPGE+
Sbjct: 2115 AQGDRGHDGTIGDPGNKGEPGRDGAPGPKGFQGNMG---QPGLKGIAGRDGLIGERGLPGPKGNPGDPGEDGLR--GPYGEPGEPGGSKECTGILPGRPGPRGMPGLPGSKGQPGLPGVDGDRGLKGAIGPQGPMGDTGPDCPIGPPGRPGPKGSPGEPGRPGLAGFPGRPGDDGLPGEKGE----SGRGIRGMPGDPGDRGPDGPPGPKGPKGVQGERGPPGTKGAGLPGPMGEKGEKGIAGLMGKRGKPGSPGPEGEPGDRCSPCR---QGIPGQKGDKGDQGIPGTPGPRGRDGSK---------------------------GERGDRGAPGNPGRMGPPGYEGVAG---------------------------------ERGIPGPKGFKGEPGETRTEYQGVV--------KGPKGYPGVDGVKGQKGIKG-IFGDAGEKGDRGLEGPPGDLGMRGLPGQKGPKGMSGEKGFKGQPAEV-----MMGLKGDKGTPGRPGLPGEPGVPGIPG-NCTVNVIRSDNITVEKGDRGEKGEPGPRGDKGKPGGEGPPGKPGDDGIRGAKGIPGRPGPPGPKGATGYPGEPGERGDSGDPGLPGPVGPKGDRGAPGPVGDRGILGAKGEKGPAGLPGLGEKGDRGIPGRPGFAGLKGERGEPGLPGAQG-------------------DPGPDGLPGLPGDRGDMGPKGFE------------------GDPGPSGGSGIKGVKGDSGKPGEPGLSGRPGEKGIQG-----------------QCLGPAEKGNTGLPGPRGPDGRKGEMGLKGMKGERGPAGEVGVPGEKGDTGPTGFPGLNGEVGDPGPSGRPGAVGPKGFEGMPGPKGLQGEPGAPGVDGLPGEKGEMGQPGQASIGEKGDVGDVGMPGEPGEKGATGRPGMRGDKGEPGLVADAIP-GEVGDPGDMGEKGFPGLPGD---------------PGQAGPRGDPGTPGPIGPKGLQGEPGQPGVRGRPGKPGLDGRPGATGPKGFPGEKGARGV---KGSRGEPGPTLVGRDGEP---GDNGDRGASGIPGPKGNRGLPGDMGPKGVAGIPGRMGEVGQPGLPGEK 3058          

HSP 8 Score: 204.527 bits (519), Expect = 1.242e-48
Identity = 413/1266 (32.62%), Postives = 530/1266 (41.86%), Query Frame = 2
Query:  410 GEQGFPGEMGHNGTDGQQGFMGYRGPVGLKGDIGCDGEPGTVGIDGKNGTHGTPGKIGDKGDEGDRGPNGTFSIGTRGDNGERGINGTQGINGTKGERGPKGFEGTMGVNGTKGSKGRIGEKGL--------------KGKEANKPKIQ--EGDKGEKGMSGKDGENCTDTGRSSNFYXXXXXXXXXXXXXXXXXXXXIQGEIGIPGK-----LGKNGTDGEKG