Beta-catenin-like protein 1

Overview
NameBeta-catenin-like protein 1
Smed IDSMED30015549
Length (bp)1763
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-catenin-like protein 1 (SMED30015549) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-catenin-like protein 1 (SMED30015549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Beta-catenin-like protein 1 (SMED30015549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Beta-catenin-like protein 1 (SMED30015549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30015549SMESG000029003.1 dd_Smed_v4_1800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015549SMESG000029003.1 dd_Smed_v4_1800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015549SMESG000029003.1 dd_Smed_v4_1800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015549SMESG000029003.1 dd_Smed_v4_1800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-catenin-like protein 1 vs. Ensembl Human
Match: CTNNBL1 (catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:15879])

HSP 1 Score: 233.802 bits (595), Expect = 2.542e-98
Identity = 129/268 (48.13%), Postives = 182/268 (67.91%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTD+S+A +  +  LTD + + E  +  E LI  L+DG++++  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD+LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   77 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR 344          

HSP 2 Score: 147.132 bits (370), Expect = 2.542e-98
Identity = 82/217 (37.79%), Postives = 128/217 (58.99%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL  +   D +++ ++ +     E+  +D ++E    RL  GL VLQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  345 EKKISRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 540          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Human
Match: CTNNBL1 (catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:15879])

HSP 1 Score: 233.802 bits (595), Expect = 2.977e-98
Identity = 129/268 (48.13%), Postives = 182/268 (67.91%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTD+S+A +  +  LTD + + E  +  E LI  L+DG++++  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD+LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   50 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR 317          

HSP 2 Score: 146.747 bits (369), Expect = 2.977e-98
Identity = 82/217 (37.79%), Postives = 128/217 (58.99%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL  +   D +++ ++ +     E+  +D ++E    RL  GL VLQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  318 EKKISRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 513          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Human
Match: CTNNBL1 (catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:15879])

HSP 1 Score: 233.802 bits (595), Expect = 2.977e-98
Identity = 129/268 (48.13%), Postives = 182/268 (67.91%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTD+S+A +  +  LTD + + E  +  E LI  L+DG++++  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD+LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   50 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR 317          

HSP 2 Score: 146.747 bits (369), Expect = 2.977e-98
Identity = 82/217 (37.79%), Postives = 128/217 (58.99%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL  +   D +++ ++ +     E+  +D ++E    RL  GL VLQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  318 EKKISRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 513          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Human
Match: CTNNBL1 (catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:15879])

HSP 1 Score: 228.024 bits (580), Expect = 1.338e-96
Identity = 130/273 (47.62%), Postives = 182/273 (66.67%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDI-----SLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTDI     S+A +  +  LTD + + E  +  E LI  L+DG++++  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD+LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   77 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDILSDLTSVAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR 349          

HSP 2 Score: 146.747 bits (369), Expect = 1.338e-96
Identity = 82/217 (37.79%), Postives = 128/217 (58.99%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL  +   D +++ ++ +     E+  +D ++E    RL  GL VLQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  350 EKKISRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 545          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Human
Match: CTNNBL1 (catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:15879])

HSP 1 Score: 169.088 bits (427), Expect = 7.360e-79
Identity = 90/157 (57.32%), Postives = 116/157 (73.89%), Query Frame = 3
Query:  471 LMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            ++DG++++  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD+LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:    1 MVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR 157          

HSP 2 Score: 146.747 bits (369), Expect = 7.360e-79
Identity = 82/217 (37.79%), Postives = 128/217 (58.99%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL  +   D +++ ++ +     E+  +D ++E    RL  GL VLQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  158 EKKISRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 353          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Celegans
Match: M01E11.2 (pep chromosome:WBcel235:I:5579666:5581979:1 gene:WBGene00019711.1 transcript:M01E11.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M01E11.2)

HSP 1 Score: 204.142 bits (518), Expect = 3.661e-77
Identity = 115/287 (40.07%), Postives = 177/287 (61.67%), Query Frame = 3
Query:   87 KPNESSENVDKTDESILDIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRI-QKRTFDENKLYVSEILAILLLNCKENQEKLGE-LDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            KP +    ++    + + +D+ + K L+IQ+DKK+R N+E R K  D   +FM+SE+EL  ++     + + P+ Y   +    ++I+L L+ HENTDI  A +  +  LTD + + EG D   +LI+ L+ G +I+  +  + +LDE+  DEADGV + L VV+N+         E     F  WL+KR  QK  FD NK+Y SE+L+++L      + KL E +DGID LLR ++V+K+NDP +++E E MENLF++LC AL   +N+++FL GEGLQLM LMLR
Sbjct:   41 KPEDILAALEADQSNYVALDDVQVKKLVIQLDKKMRLNREQRVKNPDDAQKFMESEIELDKAIQEMHSLASQPDLYGSFVEVNGVEILLQLLGHENTDIVCATLSLLRELTDDDVMNEGEDGAAELIESLVSGSIITTLLACVERLDESVKDEADGVHNALGVVDNMIGFRDDITEECVKHGFTVWLLKRCFQKGAFDANKMYASELLSVILQTSDTAKAKLTEKIDGIDILLRTIAVYKKNDPANVDEREYMENLFNSLCAALMHPANRKKFLDGEGLQLMNLMLR 327          

HSP 2 Score: 104.76 bits (260), Expect = 3.661e-77
Identity = 82/241 (34.02%), Postives = 132/241 (54.77%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYV-RLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSR---AVIRIIGDFTNSLEVDSDQTNLTKEWLESLLRK 1707
            E+K +R SA+KVL+ +T G   D+ ++ NCNK V++LGLR IF   MRTP     +KT             +   T  E EEH+  I+++L+   +   + RI+ KF E+  EKV+R VEL +KY  K+ +   EL KKR+++E     S+DD D +  Y+ +L  GL  LQ + +I+ ++ V G    R R  +LF +    +R    +  II +++++L    D  N+ +E +  +L K
Sbjct:  328 EKKQARQSALKVLNHATSG---DEGIE-NCNKLVEMLGLRTIFPLFMRTP-----SKTK------------RKDTTPDEHEEHVCTILSSLLAACSENHRQRIVQKFVEHEHEKVDRAVELFLKYKEKVQR--FELKKKRQSQEAG--TSEDD-DPDRAYLDKLDNGLYTLQRLTLILGEVAV-GVESARLREEKLFQMKMSQNRLDLMLCPIIQEYSDNL---GDDANIEQERVLVMLSK 538          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Fly
Match: CG11964 (gene:FBgn0037644 transcript:FBtr0082015)

HSP 1 Score: 209.149 bits (531), Expect = 6.147e-87
Identity = 123/275 (44.73%), Postives = 174/275 (63.27%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            +DE   K L++  +K+   NQEMR K++D P +FMDSEVEL   +     V   P+ Y +L++   +  +L L+ H+NTDI++A +  +  +TD + + E  +  E LI+ L   ++ +  V  L +L+E   +EADGV + L +VENLTE       E A Q  L WL+KR++ K  FD NKLY SEIL+IL+    EN+  LG LDG+D LL+QL+V+KR+DP S  E E M+NLF+ LC AL  + N++RFL GEGLQLM LMLR   +KMS
Sbjct:  101 LDEQSLKKLILVFEKRNLKNQEMRIKFADSPEKFMDSEVELHTVIQELKGVATVPDLYPILVDLHGLHSLLELLAHQNTDIAVAVVDLLQEVTDVDILGESQEGAESLIEALRKEQICALLVQNLERLNEQVKEEADGVHNTLAIVENLTEIDSEFVKEAAEQGLLAWLLKRLRGKSPFDPNKLYCSEILSILIQTENENRLLLGSLDGVDVLLQQLAVYKRHDPASNEEQEYMQNLFNCLCSALMARENRDRFLSGEGLQLMNLMLR--EKKMS 373          

HSP 2 Score: 132.494 bits (332), Expect = 6.147e-87
Identity = 81/240 (33.75%), Postives = 137/240 (57.08%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYV-RLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL-EVDSDQTNLTKEWLESLLRKF 1710
            E+K+SRN ++KVLD +  G  G D    NCNKFV++LGLR IF   M+TP                 K   +  ++  E EEH+ +++ +++ +  G  + R+L KFTEN+ EKV+RL+ELH+KYL K+   D E+D++ ++  +      +D + E  Y+ RL+ GL  LQ ID I+ ++   GD  ++ R+L++ NL   S + +  I+ ++  +L + D+D     +  + SL+ +F
Sbjct:  369 EKKMSRNGSLKVLDHAMAGQDGRD----NCNKFVEILGLRTIFPLFMKTP-----------------KRNKQRLISADEHEEHVTSVIASMLRNCKGTHRQRMLAKFTENDHEKVDRLLELHLKYLAKVEAIDKEIDQQAKDPTI-----DEDEEAENNYIKRLTGGLFTLQRIDYILLEVSATGD-TVKQRVLQILNLRGASMKTIRSIMREYAGNLGDGDTDWREQEQNHILSLVDRF 581          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Zebrafish
Match: ctnnbl1 (catenin, beta like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1850])

HSP 1 Score: 231.106 bits (588), Expect = 1.859e-98
Identity = 133/305 (43.61%), Postives = 194/305 (63.61%), Query Frame = 3
Query:   57 SENPTPVKRKKPNESSENVDKTDESILDIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMSLI 965
            +E PT     K  E   + D  D     +DE+  K +++  +K+   NQE+R K+ D P +FM++E++L + +    V+   PE Y LL+    +Q +L L+ H+NTDIS+A +  +  LTD + + E  +  E LI  L++G++++  V  + +LDE   +EADGV++ L V+EN+ E       E A Q  + WL+KRI+ K  FD NKLY SEILAILL N  + +E LGE+DGID LL+QLSVFKR++P++  E EMMENLFD LC  L + +N++RFL+GEGLQLM LMLR   +KMS +
Sbjct:   49 TEEPTAGDGDKVLERLMDQDGEDPEAELVDESTVKKMILTFEKRSYKNQELRIKFPDNPEKFMEAELDLNDIIQEMHVIATIPELYHLLVELNAVQSLLGLLSHDNTDISIAVVDLLQELTDIDTLHESEEGAEVLIDALLEGQVVALMVQNMERLDETVKEEADGVYNTLAVIENMAEFRPGLCTEAAQQGLMQWLLKRIKAKMPFDANKLYCSEILAILLQNNDKTRELLGEMDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDALCSCLMLPANRDRFLRGEGLQLMNLMLR--EKKMSRV 351          

HSP 2 Score: 149.443 bits (376), Expect = 1.859e-98
Identity = 80/217 (36.87%), Postives = 127/217 (58.53%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR SA+KVLD+   GP G D    NC+KFVD+LGLR IF   M+TP                 K + K G++  + EEH+ +I+ +++ +  G Q++R+L+KFTEN+CEKV+RL+ELH KYL  +   D  ++ ++ +     E+  D +D E    RL  GL VLQ +  I+ +IC  G P ++ R+ ++ NL   S + V  I+ ++  ++
Sbjct:  345 EKKMSRVSALKVLDYGMIGPEGSD----NCHKFVDILGLRTIFPLFMKTP-----------------KKMKKVGISDKQHEEHVCSIIASMLRNLKGQQRSRLLSKFTENDCEKVDRLMELHFKYLEAVQLADKRIEGEKHDMVRRGEILDDAMDDEFYLRRLDAGLFVLQLLCYIMVEICAAGVPQLQQRVHQILNLRGGSVKVVRHIMREYAENI 540          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Xenopus
Match: ctnnbl1 (catenin beta like 1 [Source:NCBI gene;Acc:394960])

HSP 1 Score: 229.565 bits (584), Expect = 1.232e-97
Identity = 128/275 (46.55%), Postives = 182/275 (66.18%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEK-LIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            +DE   K +++  +K+   NQE+R K+ D P +FM+SE++L + +    V+   P+ Y LL+    +Q +L L+ HENTD+ +A +  +  LTD + +   + G + LI  L++G++++  V  L +LDE+  +EADGV + L ++EN+TE       + A Q  L WL+KR++ K  FD NKLY SEILAILL N  + +E LGELDGID LL+QLSVFKR+DP +  E EMMENLFD LC  L + SN++RFLKGEGLQLM LMLR   +KMS
Sbjct:   67 LDEGAVKRMILNFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVIATIPDLYHLLVELNAVQSLLGLLSHENTDVCIAVVDLLQELTDIDTLHESEEGAQVLIDALLEGQVVALLVQNLERLDESTKEEADGVHNTLAIIENMTEFRPEICSDAAQQGLLHWLLKRLKAKMPFDANKLYCSEILAILLQNNDDTRELLGELDGIDVLLQQLSVFKRHDPGTAEEQEMMENLFDALCSCLMLSSNRDRFLKGEGLQLMNLMLR--EKKMS 339          

HSP 2 Score: 148.673 bits (374), Expect = 1.232e-97
Identity = 79/217 (36.41%), Postives = 132/217 (60.83%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR SA++VLD +  GP G D    NC+KFVD+LGLR IF   M++P                 K   K+G+++ E EEH+ +I+ +L+ +  G Q+ R+L+KFTE++CEKV+RL+EL+ KYL  +   D +++ ++ +     E+  DD+++E    RL  GL +LQ +  + A+IC N  P IR R+L++ N+   S + +  I+ +++ S+
Sbjct:  335 EKKMSRCSALRVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------KKAKKTGVSEKEHEEHVCSILASLLRNLRGQQRTRLLSKFTESDCEKVDRLMELYFKYLEAVRVADKKIEGEKHDMVRRGEILDDDVEEEFYLRRLDAGLFLLQLLCYVTAEICNNNLPQIRQRVLQILNMRGSSVKIMRHILKEYSESI 530          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Xenopus
Match: ctnnbl1 (catenin beta like 1 [Source:NCBI gene;Acc:394960])

HSP 1 Score: 214.542 bits (545), Expect = 3.703e-93
Identity = 123/275 (44.73%), Postives = 177/275 (64.36%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEK-LIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            +DE   K +++  +K+   NQE+R K+ D P +FM+SE++L + +    V+   P+ Y LL+    +Q +L  + H    + +A +  +  LTD + +   + G + LI  L++G++++  V  L +LDE+  +EADGV + L ++EN+TE       + A Q  L WL+KR++ K  FD NKLY SEILAILL N  + +E LGELDGID LL+QLSVFKR+DP +  E EMMENLFD LC  L + SN++RFLKGEGLQLM LMLR   +KMS
Sbjct:   68 LDEGAVKRMILNFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVIATIPDLYHLLVELNAVQSLLGFLPH----VCIAVVDLLQELTDIDTLHESEEGAQVLIDALLEGQVVALLVQNLERLDESTKEEADGVHNTLAIIENMTEFRPEICSDAAQQGLLHWLLKRLKAKMPFDANKLYCSEILAILLQNNDDTRELLGELDGIDVLLQQLSVFKRHDPGTAEEQEMMENLFDALCSCLMLSSNRDRFLKGEGLQLMNLMLR--EKKMS 336          

HSP 2 Score: 149.058 bits (375), Expect = 3.703e-93
Identity = 84/240 (35.00%), Postives = 140/240 (58.33%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL------EVDSDQTNLTKEWLESL 1698
            E+K+SR SA++VLD +  GP G D    NC+KFVD+LGLR IF   M++P                 K   K+G+++ E EEH+ +I+ +L+ +  G Q+ R+L+KFTE++CEKV+RL+EL+ KYL  +   D +++ ++ +     E+  DD+++E    RL  GL +LQ +  + A+IC N  P IR R+L++ N+   S + +  I+ +++ S+      E    +    +E LE+L
Sbjct:  332 EKKMSRCSALRVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------KKAKKTGVSEKEHEEHVCSILASLLRNLRGQQRTRLLSKFTESDCEKVDRLMELYFKYLEAVRVADKKIEGEKHDMVRRGEILDDDVEEEFYLRRLDAGLFLLQLLCYVTAEICNNNLPQIRQRVLQILNMRGSSVKIMRHILKEYSESIGDGKSEEFRESEQKRIQELLETL 550          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Xenopus
Match: ctnnbl1 (catenin beta like 1 [Source:NCBI gene;Acc:394960])

HSP 1 Score: 213.772 bits (543), Expect = 5.265e-74
Identity = 123/275 (44.73%), Postives = 177/275 (64.36%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEK-LIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            +DE   K +++  +K+   NQE+R K+ D P +FM+SE++L + +    V+   P+ Y LL+    +Q +L  + H    + +A +  +  LTD + +   + G + LI  L++G++++  V  L +LDE+  +EADGV + L ++EN+TE       + A Q  L WL+KR++ K  FD NKLY SEILAILL N  + +E LGELDGID LL+QLSVFKR+DP +  E EMMENLFD LC  L + SN++RFLKGEGLQLM LMLR   +KMS
Sbjct:   67 LDEGAVKRMILNFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVIATIPDLYHLLVELNAVQSLLGFLPH----VCIAVVDLLQELTDIDTLHESEEGAQVLIDALLEGQVVALLVQNLERLDESTKEEADGVHNTLAIIENMTEFRPEICSDAAQQGLLHWLLKRLKAKMPFDANKLYCSEILAILLQNNDDTRELLGELDGIDVLLQQLSVFKRHDPGTAEEQEMMENLFDALCSCLMLSSNRDRFLKGEGLQLMNLMLR--EKKMS 335          

HSP 2 Score: 85.8853 bits (211), Expect = 5.265e-74
Identity = 67/222 (30.18%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGP---QKARILTKFTE--NNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR SA++VLD +  GP G D    NC+KFVD+LGLR IF   M++P                 K   K+G+++ E E ++ ++      +  G    Q   I T+  E  N C K       ++KYL  +    +    +R       E+  DD+++E    RL  GL +LQ +  + A+IC N  P IR R+L++ N+   S + +  I+ +++ S+
Sbjct:  331 EKKMSRCSALRVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------KKAKKTGVSEKEHEGNMCSVADTPSRNQDGELLGQLKVITTRDAESLNWCNK-------YIKYLAFVALFIIRDMVRR------GEILDDDVEEEFYLRRLDAGLFLLQLLCYVTAEICNNNLPQIRQRVLQILNMRGSSVKIMRHILKEYSESI 518          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Xenopus
Match: ctnnbl1 (catenin beta like 1 [Source:NCBI gene;Acc:394960])

HSP 1 Score: 79.7221 bits (195), Expect = 1.632e-16
Identity = 43/131 (32.82%), Postives = 79/131 (60.31%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEK-LIKELMDGKLISHCVDVLAKLDEN 530
            +DE   K +++  +K+   NQE+R K+ D P +FM+SE++L + +    V+   P+ Y LL+    +Q +L L+ HENTD+ +A +  +  LTD + +   + G + LI  L++G++++  V  L +LDE+
Sbjct:   67 LDEGAVKRMILNFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVIATIPDLYHLLVELNAVQSLLGLLSHENTDVCIAVVDLLQELTDIDTLHESEEGAQVLIDALLEGQVVALLVQNLERLDES 197          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Mouse
Match: Ctnnbl1 (catenin, beta like 1 [Source:MGI Symbol;Acc:MGI:1913892])

HSP 1 Score: 233.032 bits (593), Expect = 5.377e-98
Identity = 129/268 (48.13%), Postives = 180/268 (67.16%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTD+S+A +  +  LTD + + E  +  E LI  L+DG++ +  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   77 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVAALLVQNLERLDESVREEADGVHNTLAIVENMAEFRPEMCTEAAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDALCSCLMLSSNRERFLKGEGLQLMNLMLR 344          

HSP 2 Score: 145.976 bits (367), Expect = 5.377e-98
Identity = 81/217 (37.33%), Postives = 129/217 (59.45%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL+ +   D +++ ++ +     E+  +D++ E    RL  GL +LQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  345 EKKVSRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLSAMQVADKKIEGEKHDIVRRGEIIDNDMEDEFYLRRLDAGLFILQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 540          
BLAST of Beta-catenin-like protein 1 vs. UniProt/SwissProt
Match: sp|O62703|CTBL1_BOVIN (Beta-catenin-like protein 1 OS=Bos taurus OX=9913 GN=CTNNBL1 PE=2 SV=3)

HSP 1 Score: 233.417 bits (594), Expect = 6.486e-98
Identity = 128/268 (47.76%), Postives = 181/268 (67.54%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTD+S+A +  +  LTD + + E  +  E L   L+DG++++  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD+LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   77 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLTDALVDGQVVALLVQDLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEAAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR 344          

HSP 2 Score: 148.288 bits (373), Expect = 6.486e-98
Identity = 83/217 (38.25%), Postives = 129/217 (59.45%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL+ +   D +++ ++ +     E+  +DI+ E    RL  GL VLQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  345 EKKISRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLDAVQVADKKIEGEKHDMVRRGEIIDNDIEDEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 540          
BLAST of Beta-catenin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q8WYA6|CTBL1_HUMAN (Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 1.113e-97
Identity = 129/268 (48.13%), Postives = 182/268 (67.91%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTD+S+A +  +  LTD + + E  +  E LI  L+DG++++  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD+LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   77 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLR 344          

HSP 2 Score: 147.132 bits (370), Expect = 1.113e-97
Identity = 82/217 (37.79%), Postives = 128/217 (58.99%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL  +   D +++ ++ +     E+  +D ++E    RL  GL VLQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  345 EKKISRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 540          
BLAST of Beta-catenin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q4V8K2|CTBL1_RAT (Beta-catenin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Ctnnbl1 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 2.200e-97
Identity = 129/268 (48.13%), Postives = 181/268 (67.54%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTD+S+A +  +  LTD + + E  +  E LI  L+DG++++  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   77 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVREEADGVHNTLAIVENMAEFRPEMCTEAAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDALCSCLMLSSNRERFLKGEGLQLMNLMLR 344          

HSP 2 Score: 145.591 bits (366), Expect = 2.200e-97
Identity = 81/217 (37.33%), Postives = 128/217 (58.99%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL  +   D +++ ++ +     E+  +D++ E    RL  GL +LQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  345 EKKISRSSALKVLDHAMIGPEGAD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDIVRRGEIIDNDMEDEFYLRRLDAGLFILQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 540          
BLAST of Beta-catenin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9CWL8|CTBL1_MOUSE (Beta-catenin-like protein 1 OS=Mus musculus OX=10090 GN=Ctnnbl1 PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 3.251e-97
Identity = 129/268 (48.13%), Postives = 180/268 (67.16%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    VV   P+ Y LL+    +Q +L L+ H+NTD+S+A +  +  LTD + + E  +  E LI  L+DG++ +  V  L +LDE+  +EADGV + L +VEN+ E       E A Q  L WL+KR++ K  FD NKLY SE+LAILL +  EN+E LGELDGID LL+QLSVFKR++P++  E EMMENLFD LC  L + SN+ERFLKGEGLQLM LMLR
Sbjct:   77 LDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVAALLVQNLERLDESVREEADGVHNTLAIVENMAEFRPEMCTEAAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDALCSCLMLSSNRERFLKGEGLQLMNLMLR 344          

HSP 2 Score: 145.976 bits (367), Expect = 3.251e-97
Identity = 81/217 (37.33%), Postives = 129/217 (59.45%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR+SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M++P                 + + K G T+ E EEH+ +I+ +L+ +  G Q+ R+L KFTEN+ EKV+RL+ELH KYL+ +   D +++ ++ +     E+  +D++ E    RL  GL +LQ+I  I+A+IC    P IR R+ ++ N+   S + V  II ++  ++
Sbjct:  345 EKKVSRSSALKVLDHAMIGPEGTD----NCHKFVDILGLRTIFPLFMKSP-----------------RKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLSAMQVADKKIEGEKHDIVRRGEIIDNDMEDEFYLRRLDAGLFILQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI 540          
BLAST of Beta-catenin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9UUK1|CTBL1_SCHPO (Beta-catenin-like protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctnnbl1 PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 7.000e-43
Identity = 93/290 (32.07%), Postives = 165/290 (56.90%), Query Frame = 3
Query:  117 KTDESILD-IDEAKA------------KHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEA-FGYTKVEIANQQFLGWLIKR--IQKRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            K+++++LD +DE +A            K ++++++K +  NQE+R KYS  P RF++SE +L   + +F V++  P    + +    +   L L+ HEN DI++  ++ ++ LTD E+++  D    L   L+D  L+    + + + DE++ ++  GV+ +L+++ENL         + + N   + WL+ R  + + +   N  Y  EILAI+L N KE + K+  L+GID LLR++S ++  DPT  +E EMMEN+FD LC  +     +  FLK EG++L IL ++
Sbjct:   60 KSEKTVLDFLDEQEAQEEPASLTPTELKRMVVRLEKTINNNQELRIKYSTSPQRFIESEADLDLEIRSFNVLSEYPILIPIFLKLDCVSTFLELMNHENADITITVLELLIELTD-EDVDP-DALNSLFTSLIDSGLLPLLSNTIKRFDESNEEDRHGVYCVLSLMENLLSVDNSICSIIVENTTLVEWLLSRSSVDETSISTNLQYAVEILAIILANSKEAKLKVCNLNGIDLLLRRISPYRLRDPTQGSEEEMMENVFDCLCSLVQETKGKSLFLKEEGIELCILNMK 347          

HSP 2 Score: 50.8322 bits (120), Expect = 7.000e-43
Identity = 49/182 (26.92%), Postives = 83/182 (45.60%), Query Frame = 1
Query: 1009 SRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGP--QKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYV--RLSEGLLVLQNIDIIIADICV 1542
            SR S IKVLD+   GP+        C +FV+  GL+ IF+  M                    KI A   L      EHI+ I+ +L         ++ R L KF EN+ EK++RL +++ +   +L   D       ++++L  + S D  +K  ++   ++  GL   Q+  +I++ +CV
Sbjct:  352 SRYSTIKVLDYLLFGPLS----TPYCIRFVEAGGLKYIFAAFM--------------------KISAADTL------EHILAILASLFRSLPADTVERVRFLRKFIENDFEKMKRLFKIYDRLRIQLKGID-------QSRKL--DFSPDSEEKSTKWFLQQIDHGLFPFQSTVLILSWLCV 494          
BLAST of Beta-catenin-like protein 1 vs. TrEMBL
Match: A0A1E1XQJ8 (DUF1716 domain-containing protein OS=Amblyomma sculptum OX=1581419 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 2.394e-103
Identity = 148/305 (48.52%), Postives = 196/305 (64.26%), Query Frame = 3
Query:   60 ENPTPVKRKKPNESSENVDKTDESILDIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTD----PEEIEGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            E P P  R    E + ++    + I  +++A  K L++  +KK+  NQE+R KY D P +FMDSEVEL + L    +V   PE+Y +L+    +Q IL L+ HENTDIS+A +  +  LTD     E  EG D+   LI  L+D ++++  V  L +LDE+  +EADGV   L +VENLTE      V+ A Q  L W++KR++ K  FD NKLY SEIL+ILL N  EN++ LGE+DGIDTLL+QLS FKR+DP+S NE EMMENLF  LC +L    N+ERFLKGEGLQLM LMLR   +KMS
Sbjct:   54 EEPEPTSR----EETADIPPDSDDIGIVNDAHVKKLILNFEKKVLKNQELRIKYPDLPEKFMDSEVELNDILQEMHIVATQPEFYPILVELNAVQSILGLLSHENTDISIAVVDLLQELTDVDSLHESQEGADM---LIDALIDSQIVAQLVQNLDRLDESVKEEADGVHYTLAIVENLTEFRPDFSVQAAQQGLLAWILKRLKVKMPFDANKLYCSEILSILLQNHDENKKLLGEIDGIDTLLQQLSYFKRHDPSSSNEIEMMENLFGALCSSLMCSPNRERFLKGEGLQLMNLMLR--EKKMS 349          

HSP 2 Score: 152.525 bits (384), Expect = 2.394e-103
Identity = 83/224 (37.05%), Postives = 131/224 (58.48%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSLEVDSDQT 1668
            E+K+SR+ A+KVLDF+T    G D    NCNKFVD+LGLR +F   M+TP                 +   K G +  E EEH+ +++ +++ +    Q+ R+L KFTEN+ EKV+RL+ELH KYL K+   D  +++++EN +L  E  Q D +++    RL  GL  LQ +D I+ DIC +G P I+ R+L++ NL   S + +  I+ ++  +L    D++
Sbjct:  345 EKKMSRSGALKVLDFATSNAEGTD----NCNKFVDILGLRTVFPLFMQTP-----------------RKYKKKGASPEEHEEHVCSVIASMLKNCKPTQRQRLLNKFTENDHEKVDRLMELHFKYLEKVHAIDNVIEREKENPKLQDEDDQMDQEEKFYLRRLDAGLFTLQLVDYIMLDICSSGPPSIKQRVLQILNLRGGSIKTIRNIMREYAGNLGDAKDES 547          
BLAST of Beta-catenin-like protein 1 vs. TrEMBL
Match: A0A4E0RLV4 (Beta catenin protein 1 OS=Fasciola hepatica OX=6192 GN=D915_000700 PE=4 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 9.741e-101
Identity = 129/302 (42.72%), Postives = 185/302 (61.26%), Query Frame = 3
Query:   69 TPVKRKKPNESSENVDKTDESIL------DIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLM-NNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEKLIKELMD----GKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQKR-TFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            T  +      S+  VD  D+ I       ++DE+  + L + ++K+   NQE RTK+ DQP RFM SEV+L  +L    ++  NP  Y +L    + I ++L L+ HENTDISL+ I  +  L +P  +   + G   +  L+D    G+LI   +  +++LDE   DEADGV   L +VENL +      V ++NQ    WL++RIQ++  FD NKLYVSE+L+ILL   + N+  LG++DGID LL+QL+V+KR+DP S  E E+M NLFD LC AL +  N++RFLKGEG+QLM LMLR
Sbjct:   65 TAARHPIAGSSTTEVDDEDDGIPTTVGASEVDESTIRRLTLLLEKRALVNQEARTKFPDQPKRFMQSEVDLQETLEEMQILAANPSLYPVLAAQTRPISLLLGLLAHENTDISLSVIDLLHELLEPNGLT--EAGPSRVNPLLDLLFNGQLIQLLMQNVSRLDETKKDEADGVHKTLGIVENLLDVRPEMNVTMSNQGLFSWLLRRIQRKPAFDRNKLYVSELLSILLQLDETNRRHLGQVDGIDILLQQLAVYKRHDPASREEMELMHNLFDCLCSALMLPENKDRFLKGEGIQLMNLMLR 364          

HSP 2 Score: 167.162 bits (422), Expect = 9.741e-101
Identity = 101/270 (37.41%), Postives = 150/270 (55.56%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFS-----------------------TQGPIGDDS---VQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGS-IPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSLEVDSDQTNLTKEWLESLLRKFVPLIP 1725
            E+ +SR+SA++VLD++                       T+  +  D    V ANC+KFV+VLGLR IF   M +P  +     PG  GS +  K L   G + +E+EEHIINI+  L+ H     K+R+L KF E++ EKV+RLVELH+KY +++   D  +   RE+K+ W   + ++I+ EL    LS GLL LQ +DII  DICVNG P I  RLL+L  +  +S R +++++ D  +SL  ++      K  L  L+R F   +P
Sbjct:  365 EKHMSRDSALRVLDYALCLVAPTSTASASSSTENDPEMPTKSSMNADPEAVVVANCSKFVEVLGLRTIFPLFMHSPRERLA---PGSIGSGMKKKTLG--GPSAAEMEEHIINIIGALLRHCPSALKSRLLAKFVESDHEKVDRLVELHLKYFSQVKSVDSRIRAMREDKQRWTGYTPEEIEDELMVEHLSSGLLALQMLDIIALDICVNGAPTIMDRLLQLLKMRSVSPRTIVQVVQDHVDSLG-EAVTAESEKFRLNDLIRTFTAKLP 628          
BLAST of Beta-catenin-like protein 1 vs. TrEMBL
Match: A0A131Z4D4 (Beta-catenin-like protein 1 OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.009e-100
Identity = 143/302 (47.35%), Postives = 193/302 (63.91%), Query Frame = 3
Query:   69 TPVKRKKPNESSENVDKTDESILDIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTD----PEEIEGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            TP    +P ++ E     D  +  +D+   K L++  +K++  NQE+R KY D P +FMDSEVEL + L    +V   PE Y +L+    +Q IL L+ HENTDIS+A +  +  LTD     E  EG D+   LI  L+DG++++  V  L +LDE   +EA+GV + L +VENL E      ++ A Q  L W++KR++ K  FD NKLY SEIL+ILL N +EN++ LGE+DGIDTLL+QLS FKR+DP S +E EMMENLF  LC +L    N+ERFLKGEGLQLM LMLR   +KMS
Sbjct:   55 TPRVALEPADAPE----PDAGVDILDDTNLKKLILNFEKRVLKNQELRIKYPDLPEKFMDSEVELNDILQEMHIVATQPELYPILVELNAVQSILGLLAHENTDISIAVVDLLQELTDVDSLHESQEGADM---LIDALIDGQIVAQLVQNLERLDETVKEEAEGVHNTLAIVENLAEFRPELSIQAAQQGLLAWILKRLKAKMPFDANKLYCSEILSILLQNHEENKKLLGEIDGIDTLLQQLSYFKRHDPNSSDETEMMENLFGALCSSLMCAPNRERFLKGEGLQLMNLMLR--EKKMS 347          

HSP 2 Score: 152.525 bits (384), Expect = 2.009e-100
Identity = 84/224 (37.50%), Postives = 133/224 (59.38%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSLEVDSDQT 1668
            E+K+SR+ A+KVLDF+T    G D    NCNKFVD+LGLR IF   M+TP                 +   K G +  E EEH+ +++++++ +    Q+ R+L KFTEN+ EKV+RL+ELH KYL K+   D  +++++EN +L  E  Q D++++    RL  GL  LQ +D I+ DIC +G P I+ R+L++ NL   S + +  I+ ++  +L    D++
Sbjct:  343 EKKMSRSGALKVLDFATCNVEGTD----NCNKFVDILGLRTIFPLFMQTP-----------------RKYKKKGASPEEHEEHVCSVISSMLKNCKTTQRQRLLNKFTENDHEKVDRLMELHFKYLEKVHAIDNIIEREKENPKLHDEEDQLDLEEKFYLRRLDAGLFTLQLVDYIMLDICSSGPPSIKQRVLQILNLRGGSIKTIRNIMREYAGNLGDAKDES 545          
BLAST of Beta-catenin-like protein 1 vs. TrEMBL
Match: A0A1E1XAD6 (DUF1716 domain-containing protein OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 4.350e-100
Identity = 141/272 (51.84%), Postives = 183/272 (67.28%), Query Frame = 3
Query:  159 KHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTD----PEEIEGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            K L++  +KK+  NQE+R KY D P +FMDSEVEL + L    VV   PE Y +L+    +Q IL L+ HENTDIS+A +  +  LTD     E  EG D+   LI  L+DG++++  V  L +LDE+  +EA+GV + L +VENLTE      V+ A Q  L W++KR++ K  FD NKLY SEIL+ILL N  EN++ LGE+DGIDTLL+QLS FKR+DP+S +E EMMENLF  LC +L    N+ERFLKGEGLQLM LMLR   +KMS
Sbjct:   85 KKLILNFEKKVLKNQELRIKYPDLPEKFMDSEVELNDILQEMHVVATQPELYPILVELNAVQSILGLLSHENTDISIAVVDLLQELTDVDSLHESQEGADM---LIDALIDGQIVAQLVQNLERLDESIKEEAEGVHNTLAIVENLTEFRPDLSVQAAQQGLLAWILKRLKVKMPFDANKLYCSEILSILLQNHDENKKFLGEIDGIDTLLQQLSYFKRHDPSSSDETEMMENLFGALCSSLMCPPNRERFLKGEGLQLMNLMLR--EKKMS 351          

HSP 2 Score: 151.369 bits (381), Expect = 4.350e-100
Identity = 83/224 (37.05%), Postives = 131/224 (58.48%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSLEVDSDQT 1668
            E+K+SR+ A+KVLDF+T    G D    NCNKFVD+LGLR +F   M+TP                 +   K G +  E EEH+ +++ +++ +    Q+ R+L KFTEN+ EKV+RL+ELH KYL K+   D  +++++EN +L  E  Q D +++    RL  GL  LQ +D I+ DIC +G P I+ R+L++ NL   S + +  I+ ++  +L    D++
Sbjct:  347 EKKMSRSGALKVLDFATSNVEGTD----NCNKFVDILGLRTVFPLFMQTP-----------------RKYKKKGASPEEHEEHVCSVIASMLKNCKPTQRQRLLNKFTENDHEKVDRLMELHFKYLEKVHAIDNVIEREKENPKLQDEDDQMDQEEKFYLRRLDAGLFTLQLVDYIMLDICSSGPPSIKQRVLQILNLRGGSIKTIRNIMREYAGNLGDAKDES 549          
BLAST of Beta-catenin-like protein 1 vs. TrEMBL
Match: A0A023GNS5 (DUF1716 domain-containing protein OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 5.490e-100
Identity = 145/293 (49.49%), Postives = 191/293 (65.19%), Query Frame = 3
Query:   96 ESSENVDKTDESILDIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTD----PEEIEGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            E++E + + D  I  +D+   K L++  +KK+  NQE+R KY D P +FMDSEVEL + L    VV   PE Y +L+    +Q IL L+ HENTDIS+A +  +  LTD     E  EG D+   LI  L+DG++++  V  L +LDE   +EA+GV + L ++ENLTE      V+ A Q  L W++KR++ K  FD NKLY SEIL+ILL N  EN+  LGE+DGIDTLL+QLS FKR+DP S +E EMMENLF  LC +L    N+ERFLKGEGLQLM LMLR   +KMS
Sbjct:   65 ETAE-IPQPDADIDILDDTNLKKLILNFEKKVLKNQELRIKYPDLPEKFMDSEVELNDILQEMHVVATQPELYPILVELNAVQSILGLLSHENTDISIAVVDLLQELTDVDSLHESQEGADM---LIDALIDGQIVAQLVQNLDRLDETIKEEAEGVHNTLAIIENLTEFRPDLSVQAAQQGLLAWILKRLKVKMPFDANKLYCSEILSILLQNHDENKRLLGEIDGIDTLLQQLSYFKRHDPNSSDETEMMENLFGALCSSLMCAPNRERFLKGEGLQLMNLMLR--EKKMS 351          

HSP 2 Score: 150.599 bits (379), Expect = 5.490e-100
Identity = 83/224 (37.05%), Postives = 131/224 (58.48%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSLEVDSDQT 1668
            E+K+SR+ A+KVLDF+T    G D    NCNKFVD+LGLR +F   M+TP                 +   K G +  E EEH+ +++ +++ +    Q+ R+L KFTEN+ EKV+RL+ELH KYL K+   D  +++++EN +L  E  Q D +++    RL  GL  LQ +D I+ DIC +G P I+ R+L++ NL   S + +  I+ ++  +L    D++
Sbjct:  347 EKKMSRSGALKVLDFATSNMEGTD----NCNKFVDILGLRTVFPLFMQTP-----------------RKYKKKGASPEEHEEHVCSVIASMLKNCKPTQRQRLLNKFTENDHEKVDRLMELHFKYLEKVHAIDNLIEQEKENPKLEDEDDQMDQEEKFYLRRLDAGLFTLQLVDYIMLDICSSGPPSIKQRVLQILNLRGGSIKTIRNIMREYAGNLGDAKDES 549          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Cavefish
Match: ctnnbl1 (catenin, beta like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1850])

HSP 1 Score: 213.386 bits (542), Expect = 1.152e-92
Identity = 120/268 (44.78%), Postives = 173/268 (64.55%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DEA  K +++  +K+   NQE+R K+ D P +FM++E++L + +    V+   PE Y LL+    +  +L L+ H    I++A +  +  LTD + + E  +  E LI  L++G++++  V  + +LDE   +EADGV + L +VEN+ E       E A Q  + WL+KRI+ K  FD NKLY SEILAILL N    +E LGELDGID LL+QLSVFKR++P++  E EMMENLFD LC  L + +N++RFL+GEGLQLM LMLR
Sbjct:   75 VDEAMVKKMILTFEKRSYKNQELRIKFPDNPEKFMEAELDLNDIIQEMHVIATIPELYHLLVELNAVHSLLGLLTH----IAIAVVDLLQELTDIDTLHESEEGAEVLIDALLEGQVVALLVQNMERLDETVKEEADGVHNTLAIVENMAEFRPGLCTEAAQQGLMQWLLKRIKAKMPFDANKLYCSEILAILLQNNDSTRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDALCSCLMLPANRDRFLRGEGLQLMNLMLR 338          

HSP 2 Score: 147.902 bits (372), Expect = 1.152e-92
Identity = 85/224 (37.95%), Postives = 129/224 (57.59%), Query Frame = 1
Query:  976 MEIFGRSERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            M +  RS +KLSR S++KVLD    GP G D    NC+KFVD+LGLR IF   M+TP                 K + K+G++  E EEH+ +IM +++ +  G Q++R+L+KFTEN+CEKV+RL+ELH KYL  +   D  ++ ++       E+  D ++ E    RL  GL VLQ I  I+ +I   G P ++ R+ ++ NL   S +AV  I+ ++  S+
Sbjct:  333 MNLMLRS-KKLSRTSSLKVLDHGMIGPEGSD----NCHKFVDILGLRTIFPLFMKTP-----------------KKMRKTGISDKEHEEHVCSIMASMLRNLKGQQRSRLLSKFTENDCEKVDRLMELHFKYLEAVQLADRRIEGEKHEMVRRGEILDDAMEDEFYLRRLDAGLFVLQLICYIMVEISSAGIPQLQQRVHQILNLRGGSVKAVRHIMREYAESI 534          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Cavefish
Match: ctnnbl1 (catenin, beta like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1850])

HSP 1 Score: 207.608 bits (527), Expect = 5.170e-91
Identity = 120/269 (44.61%), Postives = 172/269 (63.94%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELM-DGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +DEA  K +++  +K+   NQE+R K+ D P +FM++E++L + +    V+   PE Y LL+    +  +L L+ H    I++A +  +  LTD + + E  +  E LI  L+  G++++  V  + +LDE   +EADGV + L +VEN+ E       E A Q  + WL+KRI+ K  FD NKLY SEILAILL N    +E LGELDGID LL+QLSVFKR++P++  E EMMENLFD LC  L + +N++RFL+GEGLQLM LMLR
Sbjct:   96 VDEAMVKKMILTFEKRSYKNQELRIKFPDNPEKFMEAELDLNDIIQEMHVIATIPELYHLLVELNAVHSLLGLLTH----IAIAVVDLLQELTDIDTLHESEEGAEVLIDALVRKGQVVALLVQNMERLDETVKEEADGVHNTLAIVENMAEFRPGLCTEAAQQGLMQWLLKRIKAKMPFDANKLYCSEILAILLQNNDSTRELLGELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDALCSCLMLPANRDRFLRGEGLQLMNLMLR 360          

HSP 2 Score: 147.902 bits (372), Expect = 5.170e-91
Identity = 85/224 (37.95%), Postives = 129/224 (57.59%), Query Frame = 1
Query:  976 MEIFGRSERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            M +  RS +KLSR S++KVLD    GP G D    NC+KFVD+LGLR IF   M+TP                 K + K+G++  E EEH+ +IM +++ +  G Q++R+L+KFTEN+CEKV+RL+ELH KYL  +   D  ++ ++       E+  D ++ E    RL  GL VLQ I  I+ +I   G P ++ R+ ++ NL   S +AV  I+ ++  S+
Sbjct:  355 MNLMLRS-KKLSRTSSLKVLDHGMIGPEGSD----NCHKFVDILGLRTIFPLFMKTP-----------------KKMRKTGISDKEHEEHVCSIMASMLRNLKGQQRSRLLSKFTENDCEKVDRLMELHFKYLEAVQLADRRIEGEKHEMVRRGEILDDAMEDEFYLRRLDAGLFVLQLICYIMVEISSAGIPQLQQRVHQILNLRGGSVKAVRHIMREYAESI 556          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Sea Lamprey
Match: ctnnbl1 (catenin, beta like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1850])

HSP 1 Score: 215.312 bits (547), Expect = 2.275e-93
Identity = 121/268 (45.15%), Postives = 171/268 (63.81%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR 938
            +D+   K +++  +K    NQE+R K+ D P +FM+SE++L + +    V+   PE Y LL++   +  +L L+ H+NTDI +  +  +  LTD + + E  +    L   L++ ++++  V  L +LDE   +EA GV + L ++ENLTE       E A Q  + WL+KRI+ K  FD NKLY SEIL+ILL N   N+E LGE++GID LL+QLSVFKR+DP S  E EMMENLFD LC  L + SN+ERFL+GEGLQLM LMLR
Sbjct:   83 LDDNGVKRMVLNFEKTTLKNQELRIKFPDNPEKFMESELDLNDVIQEMHVIATMPELYPLLVDLNSVTSLLGLLSHDNTDIPIEVVDLLQELTDVDTLHESQEGARTLTDALLNEQVVALLVQNLERLDEATKEEAVGVHNTLAIIENLTEFRPEMSTEAARQGLMQWLLKRIRAKMPFDANKLYCSEILSILLQNNDANRELLGEMEGIDVLLQQLSVFKRHDPASGEEGEMMENLFDCLCSCLMLASNRERFLRGEGLQLMNLMLR 350          

HSP 2 Score: 145.976 bits (367), Expect = 2.275e-93
Identity = 82/217 (37.79%), Postives = 127/217 (58.53%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K SRNSA+KVLD +  GP G D    NC+KFVD+LGLR IF   M         KTPG+          K+G+++ E EEH+ +I+++++ +  G Q+ R++ KF E +CEKV+RL+ELH KYL  ++  D +++ ++       E+  D+   +    RL  GL VLQ +D ++ +I  +G   IR R+ ++ NL   S + V  II ++T SL
Sbjct:  351 EKKRSRNSALKVLDHAMVGPDGAD----NCHKFVDILGLRSIFPLFM---------KTPGRA--------KKAGMSEKEHEEHVCSIISSMLRNLKGQQRTRLINKFVETDCEKVDRLMELHFKYLETVSAADKKIEGEKHEMVRRGEIIDDEAQDDFYLRRLDAGLFVLQLVDYVMLEISTSGVAQIRQRVNQILNLRGGSMKVVRHIIREYTESL 546          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Nematostella
Match: EDO40175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S818])

HSP 1 Score: 222.246 bits (565), Expect = 3.257e-91
Identity = 123/275 (44.73%), Postives = 181/275 (65.82%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRI-QKRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            +D +  K +L+  +KK+  NQEMR KY D P +FM+SE++L   +    V+   PE Y  +++   +  +L LI H+NTDIS+A I  +  +TD + + E  +    LI  L++G++I+  V  L +LDE+  +E+DGV + L +VEN+TE      +    Q  L W+++R+ QK  +D NKLY SEIL+ILL N +EN++ LGEL+GIDTLL+ LS++KR DPT+ +E E MENLF+ LC +L    N++ FL+GEGLQLMILMLR   +KMS
Sbjct:   69 LDASAVKKMLLAFEKKVTKNQEMRIKYPDNPEKFMESELDLNEEVQKLHVLATVPEMYHSIVDLNAVNTMLGLISHDNTDISIAVIDLLQEMTDVDTLNESKEGASALIDALLEGQVIALLVQNLERLDESVKEESDGVHNTLGIVENMTELQDNVSLAAGEQGLLSWILRRLKQKPPYDSNKLYASEILSILLQNTEENRQLLGELNGIDTLLQCLSLYKRYDPTTSDETEYMENLFNCLCSSLMFNPNKDLFLRGEGLQLMILMLR--EKKMS 341          

HSP 2 Score: 132.494 bits (332), Expect = 3.257e-91
Identity = 79/219 (36.07%), Postives = 124/219 (56.62%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKE-LRYV-RLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR S++KVLD++ QGP G D    NC KFV+ LGLR +F   M+                 P K   K G ++ E EEH  +I+ +L  + TG  ++R++ KF EN+  KV+RL+ELH KY  ++ + D ++++  E +EL  E  + D D E + Y+ RL  GL  LQ ID I+ + C +G P I+  +L L N H  S + +  ++ ++  S+
Sbjct:  337 EKKMSRRSSLKVLDYAMQGPEGSD----NCGKFVEFLGLRCLFPLFMK-----------------PVKKTKKLGGSEEEYEEHTTSILASLFKNLTGNLRSRLVQKFVENDHIKVDRLMELHFKYYQRVQEVDAKIEE--EKQELIDEGEEIDEDTEDMFYIRRLDAGLFTLQLIDCIMLESCCSGVPSIKQHVLALLNQHGGSMKDIKAVMREYAASV 532          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Medaka
Match: ctnnbl1 (catenin beta like 1 [Source:NCBI gene;Acc:101174021])

HSP 1 Score: 226.098 bits (575), Expect = 3.530e-95
Identity = 124/275 (45.09%), Postives = 181/275 (65.82%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    V+   P+ Y LL+    +  +L L+ HENTD+++A +  +  LTD + + E  +  E LI  L++G++++  V  + +LDE   +E+DG+++ L ++EN+ E       E A Q  + WL+KRI+ K  FD NKLY SEILAILL N    +E LGE+DGID LL+QLSVFKR++P +  E EMMENLFD LC  L + SN+ERFLKGEGLQLM LMLR   +KMS
Sbjct:   92 VDESTVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVIATMPDLYHLLVELNAVHSLLGLLSHENTDVAIAVVDLLQELTDIDTLHESEEGAEVLIDALLEGQVVALLVQNMERLDEQVKEESDGIYNTLAIIENMAEFRPGLCAEAAQQGLMQWLLKRIKAKMPFDANKLYCSEILAILLQNNDNTRELLGEMDGIDVLLQQLSVFKRHNPNTAEEQEMMENLFDALCSCLMLASNRERFLKGEGLQLMNLMLR--EKKMS 364          

HSP 2 Score: 143.665 bits (361), Expect = 3.530e-95
Identity = 80/217 (36.87%), Postives = 125/217 (57.60%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSL 1647
            E+K+SR SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M+TP                 K + K+G+ + E EEH+ +I+ +++ +    Q+ R+L KFTEN+CEKV+RL+ELH KYL  + + D  ++ ++       E+  D ++ E  + RL  GL VLQ I  I+ +I  +G   ++ R+ ++ NL   S + V  I+ ++  SL
Sbjct:  360 EKKMSRTSALKVLDHAMIGPEGLD----NCHKFVDILGLRTIFPLFMKTP-----------------KKMKKAGVPEKEHEEHVCSIIASMLRNLKSQQRTRLLNKFTENDCEKVDRLMELHFKYLEAVQQADKRIEGEKHEMVQRGEILDDSMEDEFYFRRLDAGLFVLQLICYIMVEISNSGISQLQQRVHQILNLRGGSVKVVRHIMREYAESL 555          
BLAST of Beta-catenin-like protein 1 vs. Ensembl Medaka
Match: ctnnbl1 (catenin beta like 1 [Source:NCBI gene;Acc:101174021])

HSP 1 Score: 225.713 bits (574), Expect = 9.297e-92
Identity = 124/275 (45.09%), Postives = 181/275 (65.82%), Query Frame = 3
Query:  141 IDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEI-EGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQ-KRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            +DE+  K +++  +K+   NQE+R K+ D P +FM+SE++L + +    V+   P+ Y LL+    +  +L L+ HENTD+++A +  +  LTD + + E  +  E LI  L++G++++  V  + +LDE   +E+DG+++ L ++EN+ E       E A Q  + WL+KRI+ K  FD NKLY SEILAILL N    +E LGE+DGID LL+QLSVFKR++P +  E EMMENLFD LC  L + SN+ERFLKGEGLQLM LMLR   +KMS
Sbjct:   92 VDESTVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVIATMPDLYHLLVELNAVHSLLGLLSHENTDVAIAVVDLLQELTDIDTLHESEEGAEVLIDALLEGQVVALLVQNMERLDEQVKEESDGIYNTLAIIENMAEFRPGLCAEAAQQGLMQWLLKRIKAKMPFDANKLYCSEILAILLQNNDNTRELLGEMDGIDVLLQQLSVFKRHNPNTAEEQEMMENLFDALCSCLMLASNRERFLKGEGLQLMNLMLR--EKKMS 364          

HSP 2 Score: 132.109 bits (331), Expect = 9.297e-92
Identity = 72/184 (39.13%), Postives = 108/184 (58.70%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNG 1548
            E+K+SR SA+KVLD +  GP G D    NC+KFVD+LGLR IF   M+TP                 K + K+G+ + E EEH+ +I+ +++ +    Q+ R+L KFTEN+CEKV+RL+ELH KYL  + + D  ++ ++       E+  D ++ E  + RL  GL VLQ I  I+ +I  +G
Sbjct:  360 EKKMSRTSALKVLDHAMIGPEGLD----NCHKFVDILGLRTIFPLFMKTP-----------------KKMKKAGVPEKEHEEHVCSIIASMLRNLKSQQRTRLLNKFTENDCEKVDRLMELHFKYLEAVQQADKRIEGEKHEMVQRGEILDDSMEDEFYFRRLDAGLFVLQLICYIMVEISNSG 522          
BLAST of Beta-catenin-like protein 1 vs. Planmine SMEST
Match: SMESG000029003.1 (SMESG000029003.1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 309/313 (98.72%), Postives = 310/313 (99.04%), Query Frame = 3
Query:   21 MNVDEVFKDFLKSENPTPVKRKKPNESSENVDKTDESILDIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQKRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR*NMRKMS 959
            MNVDEVFKDFLKSENPTPVKRKKPNESSENVDKTDESILDIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQKRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR   RK+S
Sbjct:    1 MNVDEVFKDFLKSENPTPVKRKKPNESSENVDKTDESILDIDEAKAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNNPEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIGEKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGYTKVEIANQQFLGWLIKRIQKRTFDENKLYVSEILAILLLNCKENQEKLGELDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLKGEGLQLMILMLR--ERKLS 311          

HSP 2 Score: 496.893 bits (1278), Expect = 0.000e+0
Identity = 243/243 (100.00%), Postives = 243/243 (100.00%), Query Frame = 1
Query:  997 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSLEVDSDQTNLTKEWLESLLRKFVPLIP 1725
            ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSLEVDSDQTNLTKEWLESLLRKFVPLIP
Sbjct:  307 ERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIFSYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIYHTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENKELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLLELFNLHKLSSRAVIRIIGDFTNSLEVDSDQTNLTKEWLESLLRKFVPLIP 549          
The following BLAST results are available for this feature:
BLAST of Beta-catenin-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTNNBL12.542e-9848.13catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CTNNBL12.977e-9848.13catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CTNNBL12.977e-9848.13catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CTNNBL11.338e-9647.62catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CTNNBL17.360e-7957.32catenin beta like 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
M01E11.23.661e-7740.07pep chromosome:WBcel235:I:5579666:5581979:1 gene:W... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG119646.147e-8744.73gene:FBgn0037644 transcript:FBtr0082015[more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctnnbl11.859e-9843.61catenin, beta like 1 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ctnnbl11.232e-9746.55catenin beta like 1 [Source:NCBI gene;Acc:394960][more]
ctnnbl13.703e-9344.73catenin beta like 1 [Source:NCBI gene;Acc:394960][more]
ctnnbl15.265e-7444.73catenin beta like 1 [Source:NCBI gene;Acc:394960][more]
ctnnbl11.632e-1632.82catenin beta like 1 [Source:NCBI gene;Acc:394960][more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ctnnbl15.377e-9848.13catenin, beta like 1 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O62703|CTBL1_BOVIN6.486e-9847.76Beta-catenin-like protein 1 OS=Bos taurus OX=9913 ... [more]
sp|Q8WYA6|CTBL1_HUMAN1.113e-9748.13Beta-catenin-like protein 1 OS=Homo sapiens OX=960... [more]
sp|Q4V8K2|CTBL1_RAT2.200e-9748.13Beta-catenin-like protein 1 OS=Rattus norvegicus O... [more]
sp|Q9CWL8|CTBL1_MOUSE3.251e-9748.13Beta-catenin-like protein 1 OS=Mus musculus OX=100... [more]
sp|Q9UUK1|CTBL1_SCHPO7.000e-4332.07Beta-catenin-like protein 1 homolog OS=Schizosacch... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1E1XQJ82.394e-10348.52DUF1716 domain-containing protein OS=Amblyomma scu... [more]
A0A4E0RLV49.741e-10142.72Beta catenin protein 1 OS=Fasciola hepatica OX=619... [more]
A0A131Z4D42.009e-10047.35Beta-catenin-like protein 1 OS=Rhipicephalus appen... [more]
A0A1E1XAD64.350e-10051.84DUF1716 domain-containing protein OS=Amblyomma aur... [more]
A0A023GNS55.490e-10049.49DUF1716 domain-containing protein OS=Amblyomma tri... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctnnbl11.152e-9244.78catenin, beta like 1 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
ctnnbl15.170e-9144.61catenin, beta like 1 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctnnbl12.275e-9345.15catenin, beta like 1 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO401753.257e-9144.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctnnbl13.530e-9545.09catenin beta like 1 [Source:NCBI gene;Acc:10117402... [more]
ctnnbl19.297e-9245.09catenin beta like 1 [Source:NCBI gene;Acc:10117402... [more]
back to top
BLAST of Beta-catenin-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029003.10.000e+098.72SMESG000029003.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015549 ID=SMED30015549|Name=Beta-catenin-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1763bp
ATTTCATCTACCATTCAAACATGAATGTAGATGAAGTCTTCAAGGATTTT
TTAAAATCTGAAAATCCTACACCAGTTAAAAGAAAGAAACCTAATGAATC
TAGCGAAAATGTAGATAAAACTGACGAATCTATTTTAGATATAGATGAAG
CAAAAGCTAAGCATCTTCTGATACAGGTGGACAAAAAACTCAGAGCTAAT
CAAGAAATGCGAACCAAATATTCTGATCAACCTATGAGATTTATGGACAG
TGAAGTTGAATTATTCAATAGTTTAAATAATTTTATGGTTGTCACAAATA
ATCCGGAGTACTATGAACTATTAATGAATAATAAAATGATACAAATCATA
TTAGTTTTAATTCTTCATGAAAATACGGATATTTCTCTTGCAGCTATTAA
GTTTATTTTACTTTTAACAGACCCAGAAGAAATAGAAGGTCTTGATATTG
GTGAAAAGTTGATTAAAGAGCTGATGGATGGAAAATTGATATCCCACTGT
GTTGATGTTTTGGCAAAATTAGATGAAAATGATCCTGATGAAGCTGATGG
AGTCTTTTCTATATTGAATGTTGTTGAAAATTTAACCGAAGCGTTTGGAT
ATACAAAAGTTGAAATTGCAAACCAACAATTTCTCGGATGGCTTATCAAA
CGTATTCAAAAAAGAACATTTGATGAAAACAAGTTATATGTTTCAGAAAT
TTTAGCTATTTTGCTTCTTAATTGTAAAGAAAATCAAGAAAAATTGGGAG
AGTTAGATGGCATTGATACTCTGCTTCGACAGTTATCAGTATTCAAACGG
AACGATCCAACAAGTTTAAATGAATTTGAAATGATGGAAAATCTATTTGA
TACTCTTTGCTATGCTCTCTTTGTTAAATCTAACCAGGAAAGATTCCTGA
AAGGGGAAGGCCTACAACTAATGATACTGATGTTACGGTAAAATATGCGT
AAAATGTCATTAATATTATCATGATATGGAAATATTTGGGCGCAGTGAAA
GAAAACTCAGCCGCAATAGTGCTATTAAGGTTTTAGATTTCTCCACTCAA
GGACCCATTGGCGACGACTCAGTTCAAGCTAACTGCAATAAATTTGTCGA
CGTTCTCGGTCTTAGAGTGATATTCAGTTATCTAATGAGAACTCCAGACC
CGAAAGCTACTACTAAAACTCCAGGCCAGAACGGATCTATTCCGACGAAA
ATATTGGCCAAATCGGGCCTCACGAAATCGGAACTAGAAGAGCACATCAT
CAACATAATGACCAATCTCATTTATCACACCACCGGGCCTCAGAAAGCTC
GAATTCTCACGAAATTCACGGAGAATAATTGCGAGAAAGTCGAACGGCTT
GTGGAGTTGCACATGAAATATCTGAATAAGCTAACCAAAACCGACGTGGA
GCTTGACAAGAAAAGAGAAAACAAGGAGTTGTGGAAAGAAGTGTCCCAGG
ATGATATCGATAAGGAATTGCGATACGTGCGACTGAGTGAAGGCCTACTG
GTGTTACAGAATATCGACATAATAATCGCAGATATTTGTGTTAATGGCGA
TCCGATTATTCGTGCTCGGTTGTTGGAGTTGTTCAATTTGCACAAATTAT
CCTCGCGGGCCGTTATTAGGATCATCGGAGATTTTACAAACTCTCTCGAA
GTGGACTCGGATCAAACCAATCTAACTAAGGAATGGCTCGAGAGCTTGCT
TAGGAAATTCGTTCCATTGATACCTTAATCATAACAAATCAATCAATTGT
GTTTATAAAAAAA
back to top

protein sequence of SMED30015549-orf-1

>SMED30015549-orf-1 ID=SMED30015549-orf-1|Name=SMED30015549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=313bp
FIYHSNMNVDEVFKDFLKSENPTPVKRKKPNESSENVDKTDESILDIDEA
KAKHLLIQVDKKLRANQEMRTKYSDQPMRFMDSEVELFNSLNNFMVVTNN
PEYYELLMNNKMIQIILVLILHENTDISLAAIKFILLLTDPEEIEGLDIG
EKLIKELMDGKLISHCVDVLAKLDENDPDEADGVFSILNVVENLTEAFGY
TKVEIANQQFLGWLIKRIQKRTFDENKLYVSEILAILLLNCKENQEKLGE
LDGIDTLLRQLSVFKRNDPTSLNEFEMMENLFDTLCYALFVKSNQERFLK
GEGLQLMILMLR*
back to top

protein sequence of SMED30015549-orf-2

>SMED30015549-orf-2 ID=SMED30015549-orf-2|Name=SMED30015549-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=251bp
MEIFGRSERKLSRNSAIKVLDFSTQGPIGDDSVQANCNKFVDVLGLRVIF
SYLMRTPDPKATTKTPGQNGSIPTKILAKSGLTKSELEEHIINIMTNLIY
HTTGPQKARILTKFTENNCEKVERLVELHMKYLNKLTKTDVELDKKRENK
ELWKEVSQDDIDKELRYVRLSEGLLVLQNIDIIIADICVNGDPIIRARLL
ELFNLHKLSSRAVIRIIGDFTNSLEVDSDQTNLTKEWLESLLRKFVPLIP
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
GO:0005829cytosol
GO:0000974Prp19 complex
GO:0005575cellular_component
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005681spliceosomal complex
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR039678CTNNBL1
IPR013180CTNNBL1_N
IPR011989ARM-like
IPR016024ARM-type_fold
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003674molecular_function
GO:0019899enzyme binding
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0006915apoptotic process
GO:0008150biological_process
GO:0008380RNA splicing
GO:0016445somatic diversification of immunoglobulins
GO:0043065positive regulation of apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013180Beta-catenin-like protein 1, N-terminalSMARTSM01156DUF1716_2coord: 26..132
e-value: 5.4E-23
score: 92.4
IPR013180Beta-catenin-like protein 1, N-terminalPFAMPF08216CTNNBLcoord: 37..132
e-value: 8.3E-26
score: 90.2
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 46..312
e-value: 5.6E-88
score: 297.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 22..41
IPR039678Beta-catenin-like protein 1PANTHERPTHR14978BETA-CATENIN-LIKE PROTEIN 1 NUCLEAR ASSOCIATED PROTEINcoord: 26..312
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 91..311