Cyclic AMP-responsive element-binding protein 3

Overview
NameCyclic AMP-responsive element-binding protein 3
Smed IDSMED30015546
Length (bp)2411
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclic AMP-responsive element-binding protein 3 (SMED30015546) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclic AMP-responsive element-binding protein 3 (SMED30015546) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclic AMP-responsive element-binding protein 3 (SMED30015546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclic AMP-responsive element-binding protein 3 (SMED30015546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015546SMESG000059546.1 dd_Smed_v4_1032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30015546SMESG000059546.1 dd_Smed_v6_1032_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Human
Match: CREB3L1 (cAMP responsive element binding protein 3 like 1 [Source:HGNC Symbol;Acc:HGNC:18856])

HSP 1 Score: 138.658 bits (348), Expect = 6.982e-34
Identity = 80/150 (53.33%), Postives = 105/150 (70.00%), Query Frame = 2
Query: 1034 SSKISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIF 1453
            S+ IS++ L   P      +G L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE +  ENN+L K++E+ E+ N++L+ Q++ LQ L+        +  +    TCLMV  LCF L+ 
Sbjct:  238 STAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNKISRPYKMAATQTGTCLMVAALCFVLVL 387          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Human
Match: CREB3L1 (cAMP responsive element binding protein 3 like 1 [Source:HGNC Symbol;Acc:HGNC:18856])

HSP 1 Score: 121.709 bits (304), Expect = 6.922e-32
Identity = 61/87 (70.11%), Postives = 74/87 (85.06%), Query Frame = 2
Query: 1082 TGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLN 1342
            +G L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE +  ENN+L K++E+ E+ N
Sbjct:   17 SGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENAN 103          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Human
Match: CREB3L4 (cAMP responsive element binding protein 3 like 4 [Source:HGNC Symbol;Acc:HGNC:18854])

HSP 1 Score: 129.798 bits (325), Expect = 7.713e-32
Identity = 70/148 (47.30%), Postives = 98/148 (66.22%), Query Frame = 2
Query: 1070 PIPQTGIL-----ILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSPTMRPPES 1498
            P+P T +L      LT+EEKR L  E  S+P+ LPLTK EER LKKVRRKI+NK SAQ+SRR+KKEY++ LE +V   + +N +L+K+++  E  N SLV+Q+R LQ L+ +  +  A T   V +L FSL  + +P+ SP    PE+
Sbjct:  155 PVPCTTLLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEA 302          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Human
Match: CREB3L4 (cAMP responsive element binding protein 3 like 4 [Source:HGNC Symbol;Acc:HGNC:18854])

HSP 1 Score: 129.798 bits (325), Expect = 1.025e-31
Identity = 70/148 (47.30%), Postives = 98/148 (66.22%), Query Frame = 2
Query: 1070 PIPQTGIL-----ILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSPTMRPPES 1498
            P+P T +L      LT+EEKR L  E  S+P+ LPLTK EER LKKVRRKI+NK SAQ+SRR+KKEY++ LE +V   + +N +L+K+++  E  N SLV+Q+R LQ L+ +  +  A T   V +L FSL  + +P+ SP    PE+
Sbjct:  175 PVPCTTLLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEA 322          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Human
Match: CREB3L4 (cAMP responsive element binding protein 3 like 4 [Source:HGNC Symbol;Acc:HGNC:18854])

HSP 1 Score: 129.798 bits (325), Expect = 1.025e-31
Identity = 70/148 (47.30%), Postives = 98/148 (66.22%), Query Frame = 2
Query: 1070 PIPQTGIL-----ILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSPTMRPPES 1498
            P+P T +L      LT+EEKR L  E  S+P+ LPLTK EER LKKVRRKI+NK SAQ+SRR+KKEY++ LE +V   + +N +L+K+++  E  N SLV+Q+R LQ L+ +  +  A T   V +L FSL  + +P+ SP    PE+
Sbjct:  175 PVPCTTLLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEA 322          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Celegans
Match: crh-2 (CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9])

HSP 1 Score: 106.301 bits (264), Expect = 1.131e-25
Identity = 54/112 (48.21%), Postives = 77/112 (68.75%), Query Frame = 2
Query: 1016 SRDSLYSSKISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSL 1351
            +R+ ++   I    +    I   G L+L+ EE+RTL+ E YSIP + PLTK EE +LK VRRKIKNK+SAQESRRK+KEY++ALE ++  ++ EN  LKK++   E+ N+ L
Sbjct:   95 ARNKMHEMAIRQHLITDQNITANGDLVLSAEERRTLVQEGYSIPQKYPLTKSEEESLKIVRRKIKNKLSAQESRRKRKEYIDALEGRLHCFSEENKSLKKQVHQLEASNRDL 206          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Celegans
Match: crh-2 (CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9])

HSP 1 Score: 105.916 bits (263), Expect = 1.705e-25
Identity = 54/112 (48.21%), Postives = 77/112 (68.75%), Query Frame = 2
Query: 1016 SRDSLYSSKISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSL 1351
            +R+ ++   I    +    I   G L+L+ EE+RTL+ E YSIP + PLTK EE +LK VRRKIKNK+SAQESRRK+KEY++ALE ++  ++ EN  LKK++   E+ N+ L
Sbjct:  100 ARNKMHEMAIRQHLITDQNITANGDLVLSAEERRTLVQEGYSIPQKYPLTKSEEESLKIVRRKIKNKLSAQESRRKRKEYIDALEGRLHCFSEENKSLKKQVHQLEASNRDL 211          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Celegans
Match: crh-2 (CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9])

HSP 1 Score: 105.916 bits (263), Expect = 1.705e-25
Identity = 54/112 (48.21%), Postives = 77/112 (68.75%), Query Frame = 2
Query: 1016 SRDSLYSSKISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSL 1351
            +R+ ++   I    +    I   G L+L+ EE+RTL+ E YSIP + PLTK EE +LK VRRKIKNK+SAQESRRK+KEY++ALE ++  ++ EN  LKK++   E+ N+ L
Sbjct:  100 ARNKMHEMAIRQHLITDQNITANGDLVLSAEERRTLVQEGYSIPQKYPLTKSEEESLKIVRRKIKNKLSAQESRRKRKEYIDALEGRLHCFSEENKSLKKQVHQLEASNRDL 211          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Celegans
Match: crh-2 (CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9])

HSP 1 Score: 107.457 bits (267), Expect = 4.458e-25
Identity = 54/112 (48.21%), Postives = 77/112 (68.75%), Query Frame = 2
Query: 1016 SRDSLYSSKISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSL 1351
            +R+ ++   I    +    I   G L+L+ EE+RTL+ E YSIP + PLTK EE +LK VRRKIKNK+SAQESRRK+KEY++ALE ++  ++ EN  LKK++   E+ N+ L
Sbjct:  205 ARNKMHEMAIRQHLITDQNITANGDLVLSAEERRTLVQEGYSIPQKYPLTKSEEESLKIVRRKIKNKLSAQESRRKRKEYIDALEGRLHCFSEENKSLKKQVHQLEASNRDL 316          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Celegans
Match: crh-2 (CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9])

HSP 1 Score: 106.686 bits (265), Expect = 1.145e-24
Identity = 54/112 (48.21%), Postives = 77/112 (68.75%), Query Frame = 2
Query: 1016 SRDSLYSSKISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSL 1351
            +R+ ++   I    +    I   G L+L+ EE+RTL+ E YSIP + PLTK EE +LK VRRKIKNK+SAQESRRK+KEY++ALE ++  ++ EN  LKK++   E+ N+ L
Sbjct:  227 ARNKMHEMAIRQHLITDQNITANGDLVLSAEERRTLVQEGYSIPQKYPLTKSEEESLKIVRRKIKNKLSAQESRRKRKEYIDALEGRLHCFSEENKSLKKQVHQLEASNRDL 338          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Fly
Match: CrebA (gene:FBgn0004396 transcript:FBtr0075558)

HSP 1 Score: 117.857 bits (294), Expect = 2.390e-27
Identity = 71/116 (61.21%), Postives = 87/116 (75.00%), Query Frame = 2
Query: 1043 ISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGR 1390
            I +  +   P   TG L+LTEEEKRTLL E Y IP +LPLTK EE++LKK+RRKIKNKISAQESRRKKKEYM+ LE++VEI   EN+D KKRLE  E  N +L+SQ+  LQ L+ +
Sbjct:  395 IHTPLISSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSK 510          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Fly
Match: CrebA (gene:FBgn0004396 transcript:FBtr0075557)

HSP 1 Score: 117.857 bits (294), Expect = 2.390e-27
Identity = 71/116 (61.21%), Postives = 87/116 (75.00%), Query Frame = 2
Query: 1043 ISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGR 1390
            I +  +   P   TG L+LTEEEKRTLL E Y IP +LPLTK EE++LKK+RRKIKNKISAQESRRKKKEYM+ LE++VEI   EN+D KKRLE  E  N +L+SQ+  LQ L+ +
Sbjct:  395 IHTPLISSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSK 510          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Zebrafish
Match: creb3l1 (cAMP responsive element binding protein 3-like 1 [Source:ZFIN;Acc:ZDB-GENE-030219-181])

HSP 1 Score: 139.813 bits (351), Expect = 2.052e-34
Identity = 82/153 (53.59%), Postives = 105/153 (68.63%), Query Frame = 2
Query: 1034 SSKISSTRLFQNPIP---QTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIFVGM 1462
            S+ ISS+ L   P      +G L+LTEEEKRTL+ E Y +P +LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ E+ N+SL+ Q++ LQ L+        +  S    TCLMV  LCF L+   +
Sbjct:  243 STAISSSPLLTAPHKLQGTSGPLMLTEEEKRTLIAEGYPVPNKLPLTKTEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVENYTSENNELWKKVETLENANRSLLQQLQRLQALVSGKVPRSCKIASTQTGTCLMVVALCFVLVLGSL 395          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Zebrafish
Match: creb3l1 (cAMP responsive element binding protein 3-like 1 [Source:ZFIN;Acc:ZDB-GENE-030219-181])

HSP 1 Score: 138.272 bits (347), Expect = 3.665e-34
Identity = 76/134 (56.72%), Postives = 97/134 (72.39%), Query Frame = 2
Query: 1082 TGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIFVGM 1462
            +G L+LTEEEKRTL+ E Y +P +LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ E+ N+SL+ Q++ LQ L+        +  S    TCLMV  LCF L+   +
Sbjct:  239 SGPLMLTEEEKRTLIAEGYPVPNKLPLTKTEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVENYTSENNELWKKVETLENANRSLLQQLQRLQALVSGKVPRSCKIASTQTGTCLMVVALCFVLVLGSL 372          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Zebrafish
Match: creb3l1 (cAMP responsive element binding protein 3-like 1 [Source:ZFIN;Acc:ZDB-GENE-030219-181])

HSP 1 Score: 122.479 bits (306), Expect = 5.302e-32
Identity = 61/89 (68.54%), Postives = 75/89 (84.27%), Query Frame = 2
Query: 1082 TGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKS 1348
            +G L+LTEEEKRTL+ E Y +P +LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ E+ N+S
Sbjct:    6 SGPLMLTEEEKRTLIAEGYPVPNKLPLTKTEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVENYTSENNELWKKVETLENANRS 94          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Zebrafish
Match: creb3l2 (cAMP responsive element binding protein 3-like 2 [Source:NCBI gene;Acc:791169])

HSP 1 Score: 131.339 bits (329), Expect = 1.083e-31
Identity = 80/142 (56.34%), Postives = 105/142 (73.94%), Query Frame = 2
Query: 1082 TGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIFVG--MPNRSPT 1480
            +G L+LTEEEKRTL+ E Y +PT+LPL+K EE+ LKK+RRKIKNKISAQESRRKKKEY++ALEKKVE  ++EN++L++++E+ E  NKSL+ Q+  LQ ++        R      STCLMV +LCFSL F+G   P  SP 
Sbjct:  258 SGPLLLTEEEKRTLIAEGYPVPTKLPLSKAEEKALKKIRRKIKNKISAQESRRKKKEYVDALEKKVETCSNENHELRRKVENLECTNKSLLQQLHSLQAVVAGKVPRSCRVTGTQTSTCLMVVVLCFSL-FLGSFYPGLSPC 398          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Zebrafish
Match: creb3l2 (cAMP responsive element binding protein 3-like 2 [Source:NCBI gene;Acc:791169])

HSP 1 Score: 131.339 bits (329), Expect = 1.083e-31
Identity = 80/142 (56.34%), Postives = 105/142 (73.94%), Query Frame = 2
Query: 1082 TGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIFVG--MPNRSPT 1480
            +G L+LTEEEKRTL+ E Y +PT+LPL+K EE+ LKK+RRKIKNKISAQESRRKKKEY++ALEKKVE  ++EN++L++++E+ E  NKSL+ Q+  LQ ++        R      STCLMV +LCFSL F+G   P  SP 
Sbjct:  258 SGPLLLTEEEKRTLIAEGYPVPTKLPLSKAEEKALKKIRRKIKNKISAQESRRKKKEYVDALEKKVETCSNENHELRRKVENLECTNKSLLQQLHSLQAVVAGKVPRSCRVTGTQTSTCLMVVVLCFSL-FLGSFYPGLSPC 398          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Xenopus
Match: CREB3L1 (cAMP responsive element binding protein 3-like 1 [Source:NCBI gene;Acc:100496679])

HSP 1 Score: 142.124 bits (357), Expect = 1.791e-35
Identity = 82/147 (55.78%), Postives = 105/147 (71.43%), Query Frame = 2
Query: 1043 ISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLL-------GRAGSNTASTCLMVFLLCFSLIF 1453
            ISS+ L   P      +G L+LTEEE+RTL+ E Y IPT+LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE +  +NNDL K++E+ E+ N+SL+ Q++ LQ L+        +  +   STCLMV +LCF L F
Sbjct:  210 ISSSPLLTAPHKLQGTSGPLMLTEEERRTLIAEGYPIPTKLPLTKTEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSQNNDLWKKVETLENANRSLLQQLQKLQALVTGKVPRPCKLAATQTSTCLMVMVLCFVLAF 356          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Xenopus
Match: CREB3L2 (cAMP responsive element binding protein 3 like 2 [Source:HGNC Symbol;Acc:HGNC:23720])

HSP 1 Score: 120.168 bits (300), Expect = 6.164e-28
Identity = 78/148 (52.70%), Postives = 109/148 (73.65%), Query Frame = 2
Query: 1037 SKISSTRLFQNP--IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLL-------GRAGSNTASTCLMVFLLCFSLIF 1453
            S +S++ L   P  +  TG L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LKK+RRKIKNKISAQESRRKKKEYM++LEK+VE  + EN++L+K++E  E+ N++L+ Q++ LQ ++        +A      TCLM+ +LCF++IF
Sbjct:  237 SALSNSPLLTAPHKLQGTGPLMLTEEEKRTLVAEGYPIPTKLPLTKAEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKRVENCSSENSELRKKVEVLETTNRTLLQQLQRLQAMVTGKVTRSCKAAGTQTGTCLMMVVLCFAVIF 384          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Xenopus
Match: CREB3L2 (cAMP responsive element binding protein 3 like 2 [Source:HGNC Symbol;Acc:HGNC:23720])

HSP 1 Score: 119.783 bits (299), Expect = 9.259e-28
Identity = 78/148 (52.70%), Postives = 109/148 (73.65%), Query Frame = 2
Query: 1037 SKISSTRLFQNP--IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLL-------GRAGSNTASTCLMVFLLCFSLIF 1453
            S +S++ L   P  +  TG L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LKK+RRKIKNKISAQESRRKKKEYM++LEK+VE  + EN++L+K++E  E+ N++L+ Q++ LQ ++        +A      TCLM+ +LCF++IF
Sbjct:  249 SALSNSPLLTAPHKLQGTGPLMLTEEEKRTLVAEGYPIPTKLPLTKAEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKRVENCSSENSELRKKVEVLETTNRTLLQQLQRLQAMVTGKVTRSCKAAGTQTGTCLMMVVLCFAVIF 396          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Xenopus
Match: CREB3L2 (cAMP responsive element binding protein 3 like 2 [Source:HGNC Symbol;Acc:HGNC:23720])

HSP 1 Score: 119.783 bits (299), Expect = 1.121e-27
Identity = 78/148 (52.70%), Postives = 109/148 (73.65%), Query Frame = 2
Query: 1037 SKISSTRLFQNP--IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLL-------GRAGSNTASTCLMVFLLCFSLIF 1453
            S +S++ L   P  +  TG L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LKK+RRKIKNKISAQESRRKKKEYM++LEK+VE  + EN++L+K++E  E+ N++L+ Q++ LQ ++        +A      TCLM+ +LCF++IF
Sbjct:  249 SALSNSPLLTAPHKLQGTGPLMLTEEEKRTLVAEGYPIPTKLPLTKAEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKRVENCSSENSELRKKVEVLETTNRTLLQQLQRLQAMVTGKVTRSCKAAGTQTGTCLMMVVLCFAVIF 396          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Xenopus
Match: creb3l4 (cAMP responsive element binding protein 3-like 4 [Source:NCBI gene;Acc:780164])

HSP 1 Score: 105.916 bits (263), Expect = 3.895e-24
Identity = 58/112 (51.79%), Postives = 78/112 (69.64%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTA--STCL 1420
            L LTEEEKR L  E  ++P  LPLTK EER LKKVRRKI+NK SAQ+SRR+KKEY++ LE +V   + +N +L K++   E  N SL++Q+R LQ L+ +  +  A  STC+
Sbjct:  186 LHLTEEEKRLLSQEGVALPNNLPLTKAEERILKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSSQNQELHKKVVELEKHNISLITQLRKLQTLIKQTSNKAAQTSTCV 297          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Mouse
Match: Creb3l1 (cAMP responsive element binding protein 3-like 1 [Source:MGI Symbol;Acc:MGI:1347062])

HSP 1 Score: 141.354 bits (355), Expect = 6.302e-35
Identity = 81/150 (54.00%), Postives = 105/150 (70.00%), Query Frame = 2
Query: 1034 SSKISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIF 1453
            S+ IS++ L   P      +G L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ E+ N++L+ Q++ LQ L+        +  +    TCLMV  LCF L+ 
Sbjct:  238 STAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTLVTSKISRPYKMAATQTGTCLMVAALCFVLVL 387          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Mouse
Match: Creb3l3 (cAMP responsive element binding protein 3-like 3 [Source:MGI Symbol;Acc:MGI:2384786])

HSP 1 Score: 123.25 bits (308), Expect = 3.867e-29
Identity = 64/131 (48.85%), Postives = 93/131 (70.99%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNT--ASTCLMVFLLCFSLIFVGMPNRSP 1477
            L+LTE+EK+ L  E  ++PT+LPLTK EER LKK+RRKI+NK SAQESR+KKKEY++ LE ++     +N +L++++   E  N SL+ Q++HLQ L+ ++ S    A TC+ V LL F+LI   +P+ SP
Sbjct:  209 LVLTEDEKKLLAKEGVTLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQRKVLHLEKQNLSLLEQLKHLQALVVQSTSKPAHAGTCIAVLLLSFALII--LPSISP 337          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Mouse
Match: Creb3l4 (cAMP responsive element binding protein 3-like 4 [Source:MGI Symbol;Acc:MGI:1916603])

HSP 1 Score: 119.013 bits (297), Expect = 1.942e-28
Identity = 60/129 (46.51%), Postives = 87/129 (67.44%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSP 1477
            L LT+EEK+ L  E  ++P+ LPLTK EER LKK+RRKI+NK SAQ+SRR+KKEY++ LE +V   + +N  L+++++  E  N  L+ Q+R LQ+L  +  S  A T   V +L FSL  + +P+ SP
Sbjct:  163 LFLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYLDGLESRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKLTAQTSSRAAQTSTCVLILLFSLALIILPSFSP 291          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Mouse
Match: Creb3l4 (cAMP responsive element binding protein 3-like 4 [Source:MGI Symbol;Acc:MGI:1916603])

HSP 1 Score: 119.013 bits (297), Expect = 1.942e-28
Identity = 60/129 (46.51%), Postives = 87/129 (67.44%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSP 1477
            L LT+EEK+ L  E  ++P+ LPLTK EER LKK+RRKI+NK SAQ+SRR+KKEY++ LE +V   + +N  L+++++  E  N  L+ Q+R LQ+L  +  S  A T   V +L FSL  + +P+ SP
Sbjct:  163 LFLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYLDGLESRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKLTAQTSSRAAQTSTCVLILLFSLALIILPSFSP 291          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Mouse
Match: Creb3l2 (cAMP responsive element binding protein 3-like 2 [Source:MGI Symbol;Acc:MGI:2442695])

HSP 1 Score: 115.931 bits (289), Expect = 1.506e-26
Identity = 79/149 (53.02%), Postives = 106/149 (71.14%), Query Frame = 2
Query: 1037 SKISSTRLFQNP--IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQ--------MRHLQQLLGRAGSNTASTCLMVFLLCFSLIF 1453
            S +S++ L   P  +  +G L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LKK+RRKIKNKISAQESRRKKKEYM++LEKKVE  + EN +L+K++E  E+ N++L+ Q        M  + +    AG+ T  TCLMV +LCF++ F
Sbjct:  244 SALSTSPLLTAPHKLQGSGPLVLTEEEKRTLVAEGYPIPTKLPLTKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTG-TCLMVVVLCFAVAF 391          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q9Z125|CR3L1_MOUSE (Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Mus musculus OX=10090 GN=Creb3l1 PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 3.895e-34
Identity = 81/150 (54.00%), Postives = 105/150 (70.00%), Query Frame = 2
Query: 1034 SSKISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIF 1453
            S+ IS++ L   P      +G L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ E+ N++L+ Q++ LQ L+        +  +    TCLMV  LCF L+ 
Sbjct:  238 STAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTLVTSKISRPYKMAATQTGTCLMVAALCFVLVL 387          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q66HA2|CR3L1_RAT (Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Creb3l1 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 4.660e-34
Identity = 81/150 (54.00%), Postives = 105/150 (70.00%), Query Frame = 2
Query: 1034 SSKISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIF 1453
            S+ IS++ L   P      +G L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ E+ N++L+ Q++ LQ L+        +  +    TCLMV  LCF L+ 
Sbjct:  237 STAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTLVTSKISRPYKMAATQTGTCLMVAALCFVLVL 386          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q96BA8|CR3L1_HUMAN (Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Homo sapiens OX=9606 GN=CREB3L1 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.353e-33
Identity = 80/150 (53.33%), Postives = 105/150 (70.00%), Query Frame = 2
Query: 1034 SSKISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIF 1453
            S+ IS++ L   P      +G L+LTEEEKRTL+ E Y IPT+LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE +  ENN+L K++E+ E+ N++L+ Q++ LQ L+        +  +    TCLMV  LCF L+ 
Sbjct:  238 STAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNKISRPYKMAATQTGTCLMVAALCFVLVL 387          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q8TEY5|CR3L4_HUMAN (Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 4.922e-31
Identity = 70/148 (47.30%), Postives = 98/148 (66.22%), Query Frame = 2
Query: 1070 PIPQTGIL-----ILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSPTMRPPES 1498
            P+P T +L      LT+EEKR L  E  S+P+ LPLTK EER LKKVRRKI+NK SAQ+SRR+KKEY++ LE +V   + +N +L+K+++  E  N SLV+Q+R LQ L+ +  +  A T   V +L FSL  + +P+ SP    PE+
Sbjct:  175 PVPCTTLLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEA 322          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. UniProt/SwissProt
Match: sp|Q5UEM8|CR3L4_MACFA (Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Macaca fascicularis OX=9541 GN=CREB3L4 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.062e-31
Identity = 70/148 (47.30%), Postives = 98/148 (66.22%), Query Frame = 2
Query: 1070 PIPQTGIL-----ILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSPTMRPPES 1498
            P+P T +L      LT+EEKR L  E  S+P+ LPLTK EER LKKVRRKI+NK SAQ+SRR+KKEY++ LE +V   + +N +L+K+++  E  N SLV+Q+R LQ L+ +  +  A T   V +L FSL  + +P+ SP    PE+
Sbjct:  175 PVPCTTLLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQGRPEA 322          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. TrEMBL
Match: A0A4S2ME39 (BZIP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000646 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 7.777e-44
Identity = 95/174 (54.60%), Postives = 116/174 (66.67%), Query Frame = 2
Query: 1046 SSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------------------------RAGS---------NTASTCLMVFLLCFSLIFVGMP 1465
            S TR+ ++ + Q GIL+LT+EEKRTLL E YSIPTRLPL+KQEERNLK+VRRKIKNKISAQESRRKKKEY+EALE+K+   A EN DLK+R +  ES N+SL+ Q+R +QQLL                          +AGS          +ASTCLMVF LCF+ + VG P
Sbjct:  130 SPTRIERSDVSQAGILVLTDEEKRTLLAEGYSIPTRLPLSKQEERNLKRVRRKIKNKISAQESRRKKKEYVEALERKLNACAQENMDLKRRNDGLESTNRSLLGQLRLMQQLLNKSKTTSGGATGTAVSNSHTNNPEGPKAGSRHNSGNGSVGSASTCLMVFALCFAALLVGQP 303          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. TrEMBL
Match: A0A4S2MEF0 (BZIP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000646 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.208e-43
Identity = 99/200 (49.50%), Postives = 126/200 (63.00%), Query Frame = 2
Query:  977 NRLYEVKYKLEKSSRDSLY--SSKISS-TRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------------------------RAGS---------NTASTCLMVFLLCFSLIFVGMP 1465
            +R+  + Y     S D  Y  +S++S+   + +  + Q GIL+LT+EEKRTLL E YSIPTRLPL+KQEERNLK+VRRKIKNKISAQESRRKKKEY+EALE+K+   A EN DLK+R +  ES N+SL+ Q+R +QQLL                          +AGS          +ASTCLMVF LCF+ + VG P
Sbjct:   89 SRISGLNYLPLDDSADGQYFQASRLSAQNGVLRGHVSQAGILVLTDEEKRTLLAEGYSIPTRLPLSKQEERNLKRVRRKIKNKISAQESRRKKKEYVEALERKLNACAQENMDLKRRNDGLESTNRSLLGQLRLMQQLLNKSKTTSGGATGTAVSNSHTNNPEGPKAGSRHNSGNGSVGSASTCLMVFALCFAALLVGQP 288          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. TrEMBL
Match: A0A074ZDA1 (BZIP domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_10456 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.147e-42
Identity = 118/251 (47.01%), Postives = 149/251 (59.36%), Query Frame = 2
Query: 1046 SSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG--------------------------RAGS---------NTASTCLMVFLLCFSLIFVGMP-------NRSPTMRP-PESVLIVSNMHKFGYGSFGNIQRTQMKAMQRYFPPDIDAMVLNSNSKLASTHH--NESAY 1663
            S TR+ ++ + Q GIL+LT+EEKRTLL E YSIPTRLPL+KQEERNLK+VRRKIKNKISAQESRRKKKEY+EALE+K+   A EN DLK+R +  ES N+SL+ Q+R +QQLL                           +AGS          +ASTCLMVF LCF+ + VG P       +   T  P P S+L  +N+   G GS  +I  T   +  R    D DA+ +   SK A+ HH  N SA+
Sbjct:  310 SPTRIERSDVSQPGILVLTDEEKRTLLAEGYSIPTRLPLSKQEERNLKRVRRKIKNKISAQESRRKKKEYVEALERKLNACAQENMDLKRRNDGLESTNRSLLGQLRLMQQLLNKSKTTSAGATGTTAVSNSHTSNSEGPKAGSRHTSGNGSVGSASTCLMVFALCFAALLVGQPPDLNSHTSVGLTFGPHPHSLL--NNLITNGPGSLSHIGYTW--STHR----DYDAVSI---SKHANRHHGSNCSAF 549          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. TrEMBL
Match: A0A1S8WIG9 (BZIP transcription factor (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09970 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.137e-41
Identity = 123/277 (44.40%), Postives = 159/277 (57.40%), Query Frame = 2
Query:  977 NRLYEVKYKLEKSSRDSLY--SSKISS-TRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG--------------------------RAGS---------NTASTCLMVFLLCFSLIFVGMP-------NRSPTMRP-PESVLIVSNMHKFGYGSFGNIQRTQMKAMQRYFPPDIDAMVLNSNSKLASTHH--NESAY 1663
            +R+  + Y     S D  Y  +S++S+   + +  + Q GIL+LT+EEKRTLL E YSIPTRLPL+KQEERNLK+VRRKIKNKISAQESRRKKKEY+EALE+K+   A EN DLK+R +  ES N+SL+ Q+R +QQLL                           +AGS          +ASTCLMVF LCF+ + VG P       +   T  P P S+L  +N+   G GS  +I  T   +  R    D DA+   S SK A+ HH  N SA+
Sbjct:  344 SRISGLNYLPLDDSTDGQYFQASRLSAQNAVLRGQVSQPGILVLTDEEKRTLLAEGYSIPTRLPLSKQEERNLKRVRRKIKNKISAQESRRKKKEYVEALERKLNACAQENMDLKRRNDGLESTNRSLLGQLRLMQQLLNKSKTTSAGATGTTAVSNSHTSNSEGPKAGSRHTSGNGSVGSASTCLMVFALCFAALLVGQPPDLNSHTSVGLTFGPHPHSLL--NNLITNGPGSLSHIGYTW--STHR----DYDAV---SISKHANRHHGSNCSAF 609          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. TrEMBL
Match: G7YBW3 (Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Clonorchis sinensis OX=79923 GN=CLF_104552 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.834e-41
Identity = 96/174 (55.17%), Postives = 116/174 (66.67%), Query Frame = 2
Query: 1046 SSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLL-----------GRAGSNT-----------------------ASTCLMVFLLCFSLIFVGMP 1465
            S TR+ ++ + Q GIL+LT+EEKRTLL E YSIPTRLPL+KQEERNLK+VRRKIKNKISAQESRRKKKEY+EALE+K+   A EN DLK+R +  ES N+SL+ Q+R +QQLL           G A SN+                       ASTCLMVF LCF+ + VG P
Sbjct:  334 SPTRIERSDVSQAGILVLTDEEKRTLLAEGYSIPTRLPLSKQEERNLKRVRRKIKNKISAQESRRKKKEYVEALERKLNACAQENMDLKRRNDGLESTNRSLLGQLRLMQQLLNKSKTTSGGATGTAVSNSHPNNSEGPKAGSRHNSGSGSVGSASTCLMVFALCFAALLVGQP 507          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Cavefish
Match: creb3l1 (cAMP responsive element binding protein 3 like 1 [Source:NCBI gene;Acc:103042370])

HSP 1 Score: 140.198 bits (352), Expect = 1.120e-34
Identity = 83/150 (55.33%), Postives = 103/150 (68.67%), Query Frame = 2
Query: 1034 SSKISSTRLFQNPIP---QTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIF 1453
            S  ISS+ L   P      +G L+LTEEEKRTL+ E Y +P +LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ ES N+SL+ Q++ LQ L+        +  S    TCLMV  LCF L+ 
Sbjct:  241 SVAISSSPLLTAPHKLQGTSGPLMLTEEEKRTLMAEGYPVPNKLPLTKTEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVENYTSENNELWKKVETLESANRSLLQQLQKLQALVSGKVPRSCKMASTQTGTCLMVVALCFVLVL 390          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Cavefish
Match: creb3l2 (cAMP responsive element binding protein 3 like 2 [Source:NCBI gene;Acc:103023873])

HSP 1 Score: 132.88 bits (333), Expect = 3.453e-32
Identity = 75/133 (56.39%), Postives = 104/133 (78.20%), Query Frame = 2
Query: 1082 TGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIFVG 1459
            +G L+LTEEE+RTL+ E Y +PT+LPL+K EE+ LKK+RRKIKNKISAQESRRKKKEYM+ALEKKVE  ++EN++L++++E+ E+ NKSL+ Q++ LQ ++        R      STCLMV +LCF+ +F+G
Sbjct:  268 SGPLLLTEEERRTLIAEGYPVPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDALEKKVETCSNENSELRRKMETLENTNKSLMQQLQSLQAVVAGKVPRSCRMAGTQTSTCLMVVVLCFA-VFLG 399          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Cavefish
Match: creb3l1 (cAMP responsive element binding protein 3 like 1 [Source:NCBI gene;Acc:103042370])

HSP 1 Score: 126.331 bits (316), Expect = 4.079e-31
Identity = 78/140 (55.71%), Postives = 97/140 (69.29%), Query Frame = 2
Query: 1034 SSKISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLM 1423
            S  ISS+ L   P      +G L+LTEEEKRTL+ E Y +P +LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ ES N+SL+ Q++ LQ L+        +  S    TCLM
Sbjct:  209 SVAISSSPLLTAPHKLQGTSGPLMLTEEEKRTLMAEGYPVPNKLPLTKTEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVENYTSENNELWKKVETLESANRSLLQQLQKLQALVSGKVPRSCKMASTQTGTCLM 348          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Cavefish
Match: creb3l1 (cAMP responsive element binding protein 3 like 1 [Source:NCBI gene;Acc:103042370])

HSP 1 Score: 127.102 bits (318), Expect = 4.292e-31
Identity = 84/163 (51.53%), Postives = 104/163 (63.80%), Query Frame = 2
Query: 1034 SSKISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLM-VFLLCFSLIFVGMPNRSPTMRP 1489
            S  ISS+ L   P      +G L+LTEEEKRTL+ E Y +P +LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY+E LEKKVE Y  ENN+L K++E+ ES N+SL+ Q++ LQ L+        +  S    TCLM     C S+       R P  RP
Sbjct:  241 SVAISSSPLLTAPHKLQGTSGPLMLTEEEKRTLMAEGYPVPNKLPLTKTEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVENYTSENNELWKKVETLESANRSLLQQLQKLQALVSGKVPRSCKMASTQTGTCLMSAPAACSSM------RRVPRWRP 397          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Cavefish
Match: CREB3L4 (cAMP responsive element binding protein 3 like 4 [Source:HGNC Symbol;Acc:HGNC:18854])

HSP 1 Score: 120.168 bits (300), Expect = 4.102e-28
Identity = 64/131 (48.85%), Postives = 89/131 (67.94%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTA--STCLMVFLLCFSLIFVGMPNRSP 1477
            L LTEEE++ L  E  S+P  LPLTK EER LKKVRRKI+NK SAQ+SRR+KKEY++ LE +V   + +N +LK+ ++  E  N SL++Q+R LQ L+ +  +  A  STC+M+ L  FSL  +  P+  P
Sbjct:  245 LQLTEEEQKLLNQEGISLPNNLPLTKAEERILKKVRRKIRNKQSAQDSRRRKKEYVDGLESRVAACSAQNKELKRTVDQLEKHNMSLLAQLRRLQALVKQTATKAAQTSTCIMILL--FSLALLVFPSYCP 373          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Sea Lamprey
Match: CREB3L4 (cAMP responsive element binding protein 3 like 4 [Source:HGNC Symbol;Acc:HGNC:18854])

HSP 1 Score: 128.642 bits (322), Expect = 2.033e-34
Identity = 66/131 (50.38%), Postives = 96/131 (73.28%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTA--STCLMVFLLCFSLIFVGMPNRSP 1477
            + L+EEE++ L  E  S+P+ LPLTK EER LKKVRRKI+NK SAQESR++KKEY++ LE +V   + +N +LK++++  E+ N +LV+Q++ LQ ++ +  S  A  STC+MVFLLCF+L+    PN SP
Sbjct:    6 ITLSEEERKLLEQEGLSLPSHLPLTKAEERMLKKVRRKIRNKQSAQESRKRKKEYVDGLEGRVAACSTQNEELKRKVDQLEAQNITLVTQLKKLQAMVTQTSSKAAQTSTCVMVFLLCFALLV--FPNYSP 134          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003374.1 (pep scaffold:Pmarinus_7.0:GL487331:4739:6208:-1 gene:ENSPMAG00000003090.1 transcript:ENSPMAT00000003374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 4.408e-27
Identity = 66/131 (50.38%), Postives = 94/131 (71.76%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTA--STCLMVFLLCFSLIFVGMPNRSP 1477
            L+L+EEEK+ LL E   +PT LPLTK EER L+KVRRKI+NKISAQESRRKKK+YM+ LE +V     +N  L++R++  +  N SL++Q++ LQ L+ +  +  A  STC++VF+L F+LI    P+ +P
Sbjct:   11 LVLSEEEKKLLLEEGADLPTDLPLTKAEERVLRKVRRKIRNKISAQESRRKKKDYMDGLESRVATCTAQNVQLQRRVDQLQKQNMSLLAQLKKLQALVRQTTNKNAPTSTCILVFVLSFALIL--FPSINP 139          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Sea Lamprey
Match: creb3l2 (cAMP responsive element binding protein 3-like 2 [Source:NCBI gene;Acc:791169])

HSP 1 Score: 102.834 bits (255), Expect = 1.323e-24
Identity = 75/160 (46.88%), Postives = 95/160 (59.38%), Query Frame = 2
Query: 1034 SSKISSTRLFQNP---IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEK--------KVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGM-PNRSP 1477
            SS +S+T L   P       G L+LTEEEKRTL+ E Y +PT+LPLTK EE+ LKK+RRKIKNKISAQESRRKKKEY+E LEK         V +   E N +     S     + L + +       G+  +   STCLMV  LCF+L+  G+ P+ SP
Sbjct:   68 SSALSNTTLLTAPHKLQGAAGPLMLTEEEKRTLITEGYPVPTKLPLTKAEEKALKKIRRKIKNKISAQESRRKKKEYVECLEKNTATGIDVGVALGKKEKNTICTTTWSLLQQLQRLQTLVASKVPRPGKVATTQTSTCLMVVALCFALVLGGLTPSLSP 227          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Nematostella
Match: EDO38303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC6])

HSP 1 Score: 140.969 bits (354), Expect = 4.876e-39
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query: 1097 LTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG-------RAGSNTASTCLMVFLLCFSLIFVG 1459
            LT+EE+RTL+ E   +P+ LPLTK EER LKKVRRKIKNKISAQESRRKKKEYME LEK+VE  + EN +L+K+L+S E+ N++L+ Q++ LQ L+         A S   STCLMV +LCF+ +FVG
Sbjct:   10 LTDEERRTLISEGLPVPSGLPLTKVEERALKKVRRKIKNKISAQESRRKKKEYMETLEKRVETCSSENLELRKKLDSLENTNRNLIGQLQKLQALISPKVQRPVNARSTQTSTCLMVVVLCFA-VFVG 136          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Nematostella
Match: EDO39530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S3])

HSP 1 Score: 120.168 bits (300), Expect = 4.843e-29
Identity = 62/136 (45.59%), Postives = 89/136 (65.44%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRA--GSNTASTCLMVFLLCFSLIFVGM--PNRSPTMR 1486
            L+LTEEEK+ L  E   +PT + LTK EER LKKVRRKIKNK SAQESR+KKK+Y++ LE +V++   +N  L+K++++ E  N +L+ Q++ LQ ++           TCLMV +L F L+   M   N +PT +
Sbjct:  199 LVLTEEEKKLLAQEGVELPTGVSLTKAEERVLKKVRRKIKNKQSAQESRKKKKDYVDGLEMRVKVCTEKNTSLQKKVDNLEKQNLTLMDQLKQLQAIVAATHPTKTQTGTCLMVLILAFGLVIFPMNGINTAPTAK 334          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Medaka
Match: creb3l1 (cAMP responsive element binding protein 3 like 1 [Source:NCBI gene;Acc:101167274])

HSP 1 Score: 133.265 bits (334), Expect = 1.592e-32
Identity = 73/132 (55.30%), Postives = 95/132 (71.97%), Query Frame = 2
Query: 1082 TGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG--------RAGSNTASTCLMVFLLCFSLIF 1453
            +G L+LTEEEKRTL+ E Y +P +LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY++ LEKKVE Y  EN DL +++E+ E+ N+SL+ Q++ LQ L+         +  S    TCLM+  LCF L+ 
Sbjct:  270 SGPLMLTEEEKRTLVAEGYPVPNKLPLTKSEEKALKRVRRKIKNKISAQESRRKKKEYVDCLEKKVESYTSENGDLWRKVENLETANRSLLQQLQKLQSLISGKVIPRSCKIASTQTGTCLMMVALCFVLVL 401          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Medaka
Match: creb3l1 (cAMP responsive element binding protein 3 like 1 [Source:NCBI gene;Acc:101167274])

HSP 1 Score: 133.265 bits (334), Expect = 1.598e-32
Identity = 73/132 (55.30%), Postives = 95/132 (71.97%), Query Frame = 2
Query: 1082 TGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLG--------RAGSNTASTCLMVFLLCFSLIF 1453
            +G L+LTEEEKRTL+ E Y +P +LPLTK EE+ LK+VRRKIKNKISAQESRRKKKEY++ LEKKVE Y  EN DL +++E+ E+ N+SL+ Q++ LQ L+         +  S    TCLM+  LCF L+ 
Sbjct:  270 SGPLMLTEEEKRTLVAEGYPVPNKLPLTKSEEKALKRVRRKIKNKISAQESRRKKKEYVDCLEKKVESYTSENGDLWRKVENLETANRSLLQQLQKLQSLISGKVIPRSCKIASTQTGTCLMMVALCFVLVL 401          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Medaka
Match: ENSORLT00000004983.2 (cyclic AMP-responsive element-binding protein 3-like protein 3 [Source:NCBI gene;Acc:101164317])

HSP 1 Score: 123.635 bits (309), Expect = 2.133e-29
Identity = 62/123 (50.41%), Postives = 87/123 (70.73%), Query Frame = 2
Query: 1091 LILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQL--LGRAGSNTASTCLMVFLLCFSLIF 1453
            ++L+EEEKR L  E  +IPT +PLTK EER LK+VRRKI+NK SAQESR+KKK Y++ LE +V I    N +L+K+++  +  N SL+ Q++ LQ +  +    ++T STC+MVFLL F LI 
Sbjct:  223 IVLSEEEKRLLAKEGLTIPTHMPLTKAEERTLKRVRRKIRNKQSAQESRKKKKVYVDGLENRVAICTAHNLELQKKVQMLQKQNMSLIEQLKKLQAIVKMSTLKASTTSTCVMVFLLSFCLII 345          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Medaka
Match: creb3l2 (cAMP responsive element binding protein 3 like 2 [Source:NCBI gene;Acc:101165931])

HSP 1 Score: 121.324 bits (303), Expect = 2.244e-28
Identity = 83/151 (54.97%), Postives = 117/151 (77.48%), Query Frame = 2
Query: 1037 SKISSTRLFQNP--IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLL-GR-------AGSNTASTCLMVFLLCFSLIFVG 1459
            S +S++ L   P  +  +G LILTEEE+RTL+ E Y +PT+LPLTK EE+ LKK+RRKIKNKISAQESRRKKKEYM++LEKKVE  ++EN+DL++++E+ E+ NK+L+ Q++ LQ ++ G+       AG+ T S+CLMV +LCF+L F+G
Sbjct:  265 SSLSNSPLLTAPHKLQGSGPLILTEEERRTLVAEGYPVPTKLPLTKAEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVETCSNENSDLRRKVETLENTNKTLLQQLQSLQAMVTGKLPKSCRVAGTQT-SSCLMVVVLCFAL-FLG 413          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Medaka
Match: creb3l2 (cAMP responsive element binding protein 3 like 2 [Source:NCBI gene;Acc:101165931])

HSP 1 Score: 121.324 bits (303), Expect = 2.244e-28
Identity = 83/151 (54.97%), Postives = 117/151 (77.48%), Query Frame = 2
Query: 1037 SKISSTRLFQNP--IPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLL-GR-------AGSNTASTCLMVFLLCFSLIFVG 1459
            S +S++ L   P  +  +G LILTEEE+RTL+ E Y +PT+LPLTK EE+ LKK+RRKIKNKISAQESRRKKKEYM++LEKKVE  ++EN+DL++++E+ E+ NK+L+ Q++ LQ ++ G+       AG+ T S+CLMV +LCF+L F+G
Sbjct:  265 SSLSNSPLLTAPHKLQGSGPLILTEEERRTLVAEGYPVPTKLPLTKAEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVETCSNENSDLRRKVETLENTNKTLLQQLQSLQAMVTGKLPKSCRVAGTQT-SSCLMVVVLCFAL-FLG 413          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Planmine SMEST
Match: SMESG000059546.1 (SMESG000059546.1)

HSP 1 Score: 1280.39 bits (3312), Expect = 0.000e+0
Identity = 640/650 (98.46%), Postives = 647/650 (99.54%), Query Frame = 2
Query:  101 MESPFNDEIFDHENDEIFQSNQLETDSLWCNSLIDIAEYDNQFFHDDSNFSDILTNNTNYTQSHDTSRFSLDIEDDNNQIISDFELSPIRLKPESTFDSKLYSNIQKQNLKYAYNRSVTSTPKSKSEPFMPDHSSQNKHVNTITESHELNNDLNGCNDDIDSFSTLFSYKQNETELADNRTCNNNGRKNVFYFNQTNSINRRQNPTIYVTKRNSLSNIRKPLSRIRRHDNSSVYSIYQDSGNRVQAERLKYXXXXXXXXXXXXXXXXXXGNGFQQSFNDDVSAVFNKNNDTPNRLYEVKYKLEKSSRDSLYSSKISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSPTMRPPESVLIVSNMHKFGYGSFGNIQRTQMKAMQRYFPPDIDAMVLNSNSKLASTHHNESAYLKEKDKGNEPIESIFNVNNVIITNPRKGILLESSKEEEDDCVQYGPKYQWWRFHSANSISNGEQEVSTVSVIGDTVSHAFEDQNSNTSIMTMSDRTTLIRTSSVTVNKSQPNTDLDWSNRTEDQFQLSF 2050
            MESPFNDEIFDHENDEIFQSNQLETDSLWCNSLIDIAEYDNQFFHDDSNFSDILTNNTNYTQSHDTSRFSLDIEDDNNQIISDFELSPIRLKPESTFDSKLYSNIQKQNLKYAYNRSVTSTPKSKSEPFMPDHSSQNKHVNTITESHELNNDLNGCNDDIDSFSTLFSYKQNETELADNRTCNNNGRKNVFYFNQTNSINRRQNPTIYVTKRNSLSNIRKPLS+IRRHDNSSVYSIYQDSGNRVQ ERLKYSLSPSTSSPDSIIDSSLSGNGFQQSF+D+VSAVFNKNNDTPNR +EVKYKL KSSRDSLYSSK+SSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSPTMRPPESVLIVSNMHKFGYGSFGNIQRTQMKAMQRYFPPDIDAMVLNSNSKLASTHHNESAYLKEKDKGNEPIESIFNVNNVIITNPRKGILLE+SKEEEDDCVQYGPKYQWWRFHSANSISNGEQEVSTVSVIGDTVSHAFEDQNS+TSIMTMSDRTTLIRTSSVTVNKSQPNTDLDWSNRTEDQFQLSF
Sbjct:    1 MESPFNDEIFDHENDEIFQSNQLETDSLWCNSLIDIAEYDNQFFHDDSNFSDILTNNTNYTQSHDTSRFSLDIEDDNNQIISDFELSPIRLKPESTFDSKLYSNIQKQNLKYAYNRSVTSTPKSKSEPFMPDHSSQNKHVNTITESHELNNDLNGCNDDIDSFSTLFSYKQNETELADNRTCNNNGRKNVFYFNQTNSINRRQNPTIYVTKRNSLSNIRKPLSKIRRHDNSSVYSIYQDSGNRVQEERLKYSLSPSTSSPDSIIDSSLSGNGFQQSFSDEVSAVFNKNNDTPNRFFEVKYKLGKSSRDSLYSSKMSSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLIFVGMPNRSPTMRPPESVLIVSNMHKFGYGSFGNIQRTQMKAMQRYFPPDIDAMVLNSNSKLASTHHNESAYLKEKDKGNEPIESIFNVNNVIITNPRKGILLENSKEEEDDCVQYGPKYQWWRFHSANSISNGEQEVSTVSVIGDTVSHAFEDQNSDTSIMTMSDRTTLIRTSSVTVNKSQPNTDLDWSNRTEDQFQLSF 650          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Planmine SMEST
Match: SMESG000065680.1 (SMESG000065680.1)

HSP 1 Score: 186.422 bits (472), Expect = 2.993e-50
Identity = 96/165 (58.18%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1061 FQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQ-QLLGR--AGSNTASTCLMVFLLCFSLIFVG--MPNRSPTMRPPESVLIV-SNMHKFGYG 1537
            FQ PIPQTG L LT+EEKRTL+ ENY IPTR+PLTKQEERNLKKVRRKIKNK+SAQESRRKKKEY++ LEKKVE+Y     + K+R+E+ E+  ++L +Q+RH Q QL+ +    +NT ST LM+F++CF+LI VG  +P+    M  P+S L+  S+++  GYG
Sbjct:  297 FQTPIPQTGTLYLTDEEKRTLIQENYPIPTRVPLTKQEERNLKKVRRKIKNKLSAQESRRKKKEYVDTLEKKVELYEQREIENKRRIETLENQQRTLQNQIRHYQHQLMNKITGTANTTSTGLMLFMVCFALILVGNSVPSSYRAMNLPKSSLVSRSSLYYMGYG 461          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Planmine SMEST
Match: SMESG000065680.1 (SMESG000065680.1)

HSP 1 Score: 186.422 bits (472), Expect = 3.673e-50
Identity = 96/165 (58.18%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1061 FQNPIPQTGILILTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQ-QLLGR--AGSNTASTCLMVFLLCFSLIFVG--MPNRSPTMRPPESVLIV-SNMHKFGYG 1537
            FQ PIPQTG L LT+EEKRTL+ ENY IPTR+PLTKQEERNLKKVRRKIKNK+SAQESRRKKKEY++ LEKKVE+Y     + K+R+E+ E+  ++L +Q+RH Q QL+ +    +NT ST LM+F++CF+LI VG  +P+    M  P+S L+  S+++  GYG
Sbjct:  309 FQTPIPQTGTLYLTDEEKRTLIQENYPIPTRVPLTKQEERNLKKVRRKIKNKLSAQESRRKKKEYVDTLEKKVELYEQREIENKRRIETLENQQRTLQNQIRHYQHQLMNKITGTANTTSTGLMLFMVCFALILVGNSVPSSYRAMNLPKSSLVSRSSLYYMGYG 473          
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Planmine SMEST
Match: SMESG000062724.1 (SMESG000062724.1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.734e-20
Identity = 55/133 (41.35%), Postives = 81/133 (60.90%), Query Frame = 2
Query: 1097 LTEEEKRTLLMENYSIPTRLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHENNDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSN--TASTCLMVFLLCFSLIFVGMPNRSPTMRP 1489
            L+ EEK  L+ +  S+PT  PLTK EER LK +RRKI+NKISA+ SR KK+ Y+E LE+++ + + EN+ L+ +L   E    +L  Q+ +LQ+ L +   N  T+ T LM+  L F +I       +PT  P
Sbjct:  159 LSREEKELLIRDGCSLPTHFPLTKSEERALKTIRRKIRNKISAKNSRAKKENYVEGLEQRIFVCSKENSMLRMKLAETEKDKMNLYQQVVNLQKQLSKFLPNPTTSGTSLMLLFLTFLVIL------TPTFDP 285          
The following BLAST results are available for this feature:
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CREB3L16.982e-3453.33cAMP responsive element binding protein 3 like 1 [... [more]
CREB3L16.922e-3270.11cAMP responsive element binding protein 3 like 1 [... [more]
CREB3L47.713e-3247.30cAMP responsive element binding protein 3 like 4 [... [more]
CREB3L41.025e-3147.30cAMP responsive element binding protein 3 like 4 [... [more]
CREB3L41.025e-3147.30cAMP responsive element binding protein 3 like 4 [... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crh-21.131e-2548.21CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9][more]
crh-21.705e-2548.21CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9][more]
crh-21.705e-2548.21CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9][more]
crh-24.458e-2548.21CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9][more]
crh-21.145e-2448.21CREB Homolog [Source:UniProtKB/TrEMBL;Acc:Q4JFH9][more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CrebA2.390e-2761.21gene:FBgn0004396 transcript:FBtr0075558[more]
CrebA2.390e-2761.21gene:FBgn0004396 transcript:FBtr0075557[more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creb3l12.052e-3453.59cAMP responsive element binding protein 3-like 1 [... [more]
creb3l13.665e-3456.72cAMP responsive element binding protein 3-like 1 [... [more]
creb3l15.302e-3268.54cAMP responsive element binding protein 3-like 1 [... [more]
creb3l21.083e-3156.34cAMP responsive element binding protein 3-like 2 [... [more]
creb3l21.083e-3156.34cAMP responsive element binding protein 3-like 2 [... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CREB3L11.791e-3555.78cAMP responsive element binding protein 3-like 1 [... [more]
CREB3L26.164e-2852.70cAMP responsive element binding protein 3 like 2 [... [more]
CREB3L29.259e-2852.70cAMP responsive element binding protein 3 like 2 [... [more]
CREB3L21.121e-2752.70cAMP responsive element binding protein 3 like 2 [... [more]
creb3l43.895e-2451.79cAMP responsive element binding protein 3-like 4 [... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Creb3l16.302e-3554.00cAMP responsive element binding protein 3-like 1 [... [more]
Creb3l33.867e-2948.85cAMP responsive element binding protein 3-like 3 [... [more]
Creb3l41.942e-2846.51cAMP responsive element binding protein 3-like 4 [... [more]
Creb3l41.942e-2846.51cAMP responsive element binding protein 3-like 4 [... [more]
Creb3l21.506e-2653.02cAMP responsive element binding protein 3-like 2 [... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z125|CR3L1_MOUSE3.895e-3454.00Cyclic AMP-responsive element-binding protein 3-li... [more]
sp|Q66HA2|CR3L1_RAT4.660e-3454.00Cyclic AMP-responsive element-binding protein 3-li... [more]
sp|Q96BA8|CR3L1_HUMAN3.353e-3353.33Cyclic AMP-responsive element-binding protein 3-li... [more]
sp|Q8TEY5|CR3L4_HUMAN4.922e-3147.30Cyclic AMP-responsive element-binding protein 3-li... [more]
sp|Q5UEM8|CR3L4_MACFA5.062e-3147.30Cyclic AMP-responsive element-binding protein 3-li... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2ME397.777e-4454.60BZIP domain-containing protein OS=Opisthorchis fel... [more]
A0A4S2MEF04.208e-4349.50BZIP domain-containing protein OS=Opisthorchis fel... [more]
A0A074ZDA11.147e-4247.01BZIP domain-containing protein OS=Opisthorchis viv... [more]
A0A1S8WIG91.137e-4144.40BZIP transcription factor (Fragment) OS=Opisthorch... [more]
G7YBW32.834e-4155.17Cyclic AMP-responsive element-binding protein 3-li... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creb3l11.120e-3455.33cAMP responsive element binding protein 3 like 1 [... [more]
creb3l23.453e-3256.39cAMP responsive element binding protein 3 like 2 [... [more]
creb3l14.079e-3155.71cAMP responsive element binding protein 3 like 1 [... [more]
creb3l14.292e-3151.53cAMP responsive element binding protein 3 like 1 [... [more]
CREB3L44.102e-2848.85cAMP responsive element binding protein 3 like 4 [... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CREB3L42.033e-3450.38cAMP responsive element binding protein 3 like 4 [... [more]
ENSPMAT00000003374.14.408e-2750.38pep scaffold:Pmarinus_7.0:GL487331:4739:6208:-1 ge... [more]
creb3l21.323e-2446.88cAMP responsive element binding protein 3-like 2 [... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO383034.876e-3958.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395304.843e-2945.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creb3l11.592e-3255.30cAMP responsive element binding protein 3 like 1 [... [more]
creb3l11.598e-3255.30cAMP responsive element binding protein 3 like 1 [... [more]
ENSORLT00000004983.22.133e-2950.41cyclic AMP-responsive element-binding protein 3-li... [more]
creb3l22.244e-2854.97cAMP responsive element binding protein 3 like 2 [... [more]
creb3l22.244e-2854.97cAMP responsive element binding protein 3 like 2 [... [more]
back to top
BLAST of Cyclic AMP-responsive element-binding protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000059546.10.000e+098.46SMESG000059546.1[more]
SMESG000065680.12.993e-5058.18SMESG000065680.1[more]
SMESG000065680.13.673e-5058.18SMESG000065680.1[more]
SMESG000062724.12.734e-2041.35SMESG000062724.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015546 ID=SMED30015546|Name=Cyclic AMP-responsive element-binding protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2411bp
TTTAAAGTTCAGTTATTAAATGTTTTTTAAAACTTTCGCTAGTTTCAATA
AATAGATTTGTAAATATCACTTTTAGTAATTATTTAAATTGGTTTTATTA
ATGGAATCGCCGTTTAACGATGAAATATTTGATCATGAAAATGACGAAAT
ATTTCAAAGCAACCAATTAGAAACAGATTCTCTATGGTGCAATAGTTTAA
TTGATATTGCAGAATATGACAATCAATTTTTTCACGATGACTCGAATTTC
AGTGATATTCTTACAAATAACACGAATTATACACAATCCCATGATACAAG
TCGCTTTTCTTTAGACATTGAAGATGATAATAATCAAATAATTTCCGATT
TTGAATTGAGTCCGATTCGCCTGAAACCCGAAAGTACATTCGATTCTAAA
CTCTATAGTAATATCCAAAAGCAAAACCTCAAATATGCCTATAATAGATC
TGTCACTTCAACTCCCAAATCAAAATCAGAGCCATTTATGCCAGACCATT
CTTCACAAAATAAACACGTTAATACCATAACGGAATCTCACGAACTGAAT
AACGATTTGAACGGTTGCAATGATGATATTGACAGTTTTTCCACTTTATT
TTCCTACAAGCAAAACGAAACCGAACTCGCAGACAATCGAACTTGCAATA
ATAATGGTAGAAAAAATGTGTTCTACTTCAATCAAACCAACTCAATAAAT
CGCCGACAAAACCCAACAATTTATGTCACTAAGCGAAACTCGTTATCGAA
TATTAGAAAACCGCTTTCGAGAATCAGGCGGCACGACAATTCATCCGTGT
ATTCTATTTATCAGGACTCCGGGAACCGTGTCCAGGCAGAACGATTGAAA
TATTCTCTCAGTCCTTCAACAAGTAGTCCAGATTCCATTATAGACTCCAG
TTTATCTGGAAACGGCTTCCAGCAGTCATTCAATGATGACGTTTCAGCAG
TATTTAACAAAAACAATGATACTCCCAACCGACTCTATGAAGTCAAATAT
AAACTGGAAAAGTCATCAAGAGATAGTTTGTATTCGTCAAAAATATCCTC
AACTCGATTGTTTCAAAACCCGATTCCTCAGACTGGTATTCTAATTCTCA
CAGAAGAAGAGAAACGAACTTTACTAATGGAGAATTATTCCATTCCGACG
CGATTACCATTAACGAAACAGGAGGAGAGAAATTTGAAAAAAGTTCGAAG
GAAAATCAAAAACAAAATCAGTGCACAAGAAAGTCGGAGAAAAAAGAAAG
AGTATATGGAGGCGTTGGAAAAAAAGGTTGAAATATATGCCCACGAAAAC
AATGACTTGAAAAAACGGTTGGAAAGTCAAGAAAGCCTTAATAAATCCCT
TGTTAGTCAAATGAGGCATTTGCAACAATTGTTAGGTCGAGCCGGTTCTA
ATACTGCTTCCACTTGTTTAATGGTATTTCTATTGTGCTTCTCACTTATA
TTCGTTGGAATGCCGAACCGATCACCAACAATGAGACCACCTGAGTCGGT
TTTGATAGTCAGTAACATGCATAAATTCGGTTATGGCTCTTTTGGTAACA
TTCAAAGGACACAAATGAAAGCAATGCAGAGATATTTCCCTCCAGATATC
GATGCAATGGTGTTGAACTCGAACTCAAAACTAGCATCAACTCATCACAA
TGAATCGGCTTATTTGAAGGAGAAAGACAAGGGCAATGAACCAATCGAGT
CCATATTCAATGTAAATAACGTCATAATAACAAATCCAAGAAAAGGTATT
TTATTGGAGAGTAGCAAAGAGGAAGAAGATGATTGTGTTCAATATGGACC
AAAATATCAGTGGTGGCGATTTCATTCAGCAAATTCAATTTCGAATGGAG
AGCAAGAAGTATCGACAGTATCAGTTATTGGCGATACTGTATCCCATGCA
TTTGAGGATCAAAATAGTAACACGTCTATAATGACAATGTCTGATCGGAC
GACTCTCATTCGAACCTCATCGGTCACTGTTAATAAATCCCAGCCGAATA
CTGATCTGGATTGGTCGAATAGAACAGAAGATCAATTTCAACTTAGTTTT
CTCAGTATTTCAACGTGAATATAATATTATATCACAATAACTATAATAAT
TGTTATTATGTTGATCAAGAAATCAATGTCAATTATTATTTAACAGAAAT
ATTTCAAAGTAATTGAAGATTTAAATTTAAATTTTATTTTTTAATTAAAA
TGTGATGGGTTAAGGTCATTTTTAAATGGAATTTTTTGGTCAGTCAATTT
TATTTTCGGATTTGTAGTGATGCATTTTTTTGTTTCTTCTTATTATTATT
GATATTGTTTTTATTGATATATTGTGATGTAATCAGTGATTTGTGGCGGC
TGTGGGCGATCTGGTATTAAAATTTGTCATCGTTTAAATATACACTTGGA
TTGGAAAAAAA
back to top

protein sequence of SMED30015546-orf-1

>SMED30015546-orf-1 ID=SMED30015546-orf-1|Name=SMED30015546-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=656bp
MESPFNDEIFDHENDEIFQSNQLETDSLWCNSLIDIAEYDNQFFHDDSNF
SDILTNNTNYTQSHDTSRFSLDIEDDNNQIISDFELSPIRLKPESTFDSK
LYSNIQKQNLKYAYNRSVTSTPKSKSEPFMPDHSSQNKHVNTITESHELN
NDLNGCNDDIDSFSTLFSYKQNETELADNRTCNNNGRKNVFYFNQTNSIN
RRQNPTIYVTKRNSLSNIRKPLSRIRRHDNSSVYSIYQDSGNRVQAERLK
YSLSPSTSSPDSIIDSSLSGNGFQQSFNDDVSAVFNKNNDTPNRLYEVKY
KLEKSSRDSLYSSKISSTRLFQNPIPQTGILILTEEEKRTLLMENYSIPT
RLPLTKQEERNLKKVRRKIKNKISAQESRRKKKEYMEALEKKVEIYAHEN
NDLKKRLESQESLNKSLVSQMRHLQQLLGRAGSNTASTCLMVFLLCFSLI
FVGMPNRSPTMRPPESVLIVSNMHKFGYGSFGNIQRTQMKAMQRYFPPDI
DAMVLNSNSKLASTHHNESAYLKEKDKGNEPIESIFNVNNVIITNPRKGI
LLESSKEEEDDCVQYGPKYQWWRFHSANSISNGEQEVSTVSVIGDTVSHA
FEDQNSNTSIMTMSDRTTLIRTSSVTVNKSQPNTDLDWSNRTEDQFQLSF
LSIST*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR004827bZIP
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 386..420
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 363..415
e-value: 1.2E-12
score: 49.6
NoneNo IPR availablePANTHERPTHR46004FAMILY NOT NAMEDcoord: 40..507
NoneNo IPR availableCDDcd14689bZIP_CREB3coord: 362..422
e-value: 1.07264E-26
score: 101.073
NoneNo IPR availableSUPERFAMILYSSF57959Leucine zipper domaincoord: 362..421
NoneNo IPR availableTMHMMTMhelixcoord: 431..453
IPR004827Basic-leucine zipper domainSMARTSM00338brlzneucoord: 359..423
e-value: 1.8E-14
score: 64.1
IPR004827Basic-leucine zipper domainPFAMPF00170bZIP_1coord: 359..420
e-value: 1.0E-12
score: 47.9
IPR004827Basic-leucine zipper domainPROSITEPS00036BZIP_BASICcoord: 366..381
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 361..424
score: 10.887