Diphthine--ammonia ligase-like Protein

Overview
NameDiphthine--ammonia ligase-like Protein
Smed IDSMED30015541
Length (bp)1868
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Diphthine--ammonia ligase-like Protein (SMED30015541) t-SNE clustered cells

Violin plots show distribution of expression levels for Diphthine--ammonia ligase-like Protein (SMED30015541) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Diphthine--ammonia ligase-like Protein (SMED30015541) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Diphthine--ammonia ligase-like Protein (SMED30015541) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015541

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015541SMESG000003033.1 SmedASXL_012654SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015541SMESG000003033.1 SmedASXL_012654SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Human
Match: DPH6 (diphthamine biosynthesis 6 [Source:HGNC Symbol;Acc:HGNC:30543])

HSP 1 Score: 209.92 bits (533), Expect = 1.040e-62
Identity = 110/228 (48.25%), Postives = 156/228 (68.42%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK---SPDLYRSHKEIY 784
            ELDSYMYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK+   ++  IS GAILS+YQR RVEN+C+RL L  +A+LWQR+Q +LL+ M+   ++ ++IK+AALGLD   HLGK L  +   +++ S ++G++ CGEGGEYET TLD P F+K+I + SS V+  + D +A V YL+ +E+ L+DK    PD YR+   IY
Sbjct:   44 ELDSYMYQTVGHHAIDLYAEAMA-LPLYRRTIRGRSLDTRQVYTKCEG----DEVEDLYELLKLVKEK-EEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIY 265          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Human
Match: DPH6 (diphthamine biosynthesis 6 [Source:HGNC Symbol;Acc:HGNC:30543])

HSP 1 Score: 169.088 bits (427), Expect = 9.385e-49
Identity = 86/175 (49.14%), Postives = 122/175 (69.71%), Query Frame = 2
Query:  125 MYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQK 649
            MYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK+   ++  IS GAILS+YQR RVEN+C+RL L  +A+LWQR+Q +LL+ M+   ++ ++IK+AALGLD   HLGK L  +   +++ S ++G++ CGEGGEYET TLD P F+K
Sbjct:    1 MYQTVGHHAIDLYAEAMA-LPLYRRTIRGRSLDTRQVYTKCEG----DEVEDLYELLKLVKEK-EEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKK 169          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Human
Match: DPH6 (diphthamine biosynthesis 6 [Source:HGNC Symbol;Acc:HGNC:30543])

HSP 1 Score: 130.183 bits (326), Expect = 9.892e-35
Identity = 60/126 (47.62%), Postives = 91/126 (72.22%), Query Frame = 2
Query:  371 RVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            RVEN+C+RL L  +A+LWQR+Q +LL+ M+   ++ ++IK+AALGLD   HLGK L  +   +++ S ++G++ CGEGGEYET TLD P F+K+I + SS V+  + D +A V YL+ +E+ L+DK
Sbjct:    1 RVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDK 126          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Human
Match: DPH6 (diphthamine biosynthesis 6 [Source:HGNC Symbol;Acc:HGNC:30543])

HSP 1 Score: 64.6994 bits (156), Expect = 1.684e-18
Identity = 40/106 (37.74%), Postives = 60/106 (56.60%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQ 427
            ELDSYMYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK        I+   +L+ Y    +++    L + S A +++
Sbjct:   44 ELDSYMYQTVGHHAIDLYAEAMA-LPLYRRTIRGRSLDTRQVYTKCEG----DEVEDLYELLKLVK-------GITRMTLLAEYDALNLQDFHMHLKVGSQAIVYR 137          

HSP 2 Score: 48.9062 bits (115), Expect = 1.684e-18
Identity = 20/33 (60.61%), Postives = 28/33 (84.85%), Query Frame = 1
Query:    1 AALISGGKDSTFNILECLNQGHELVALINLYPS 99
            AALISGGKDS +N+++C+  GH++VAL NL P+
Sbjct:    4 AALISGGKDSCYNMMQCIAAGHQIVALANLRPA 36          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Celegans
Match: E01A2.5 (Diphthine--ammonia ligase [Source:UniProtKB/TrEMBL;Acc:Q966L4])

HSP 1 Score: 185.652 bits (470), Expect = 2.686e-54
Identity = 96/213 (45.07%), Postives = 141/213 (66.20%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            ELDSYMYQSVG + ++    A+  +PLY+  I+G   + +  Y   +G    DEVEDLF++L  VKK  P++  +S+GAILS+YQ+ RVE+IC RL L+ + FLW+R Q  LL  M+   ++ ILIK+AA+GL E+ HLGK L  ++  +    D++G++PCGEGGE+E+   D P F+KRI I  +  +T  +D  A V YL++ +M L+DK
Sbjct:   43 ELDSYMYQSVGADGVELYGEAM-QLPLYRREITGEPKNQKSDYEKTDG----DEVEDLFELLCEVKKHHPEVKGVSAGAILSSYQKVRVEDICRRLDLVPLCFLWEREQNGLLAEMVENGLDAILIKVAAIGLGEQ-HLGKTLSEMAPIMKVLQDKYGVHPCGEGGEFESFVRDCPLFKKRIVIDETETVTHQDDPIAPVFYLRLKKMHLEDK 249          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Fly
Match: CG1578 (gene:FBgn0030336 transcript:FBtr0345160)

HSP 1 Score: 201.445 bits (511), Expect = 8.898e-60
Identity = 103/213 (48.36%), Postives = 140/213 (65.73%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            ELDS+MYQ+VGH  I+ LA A+G +PLY+    G +  T  +Y   +    +DEVEDL+ +L   K +   + A++ GAILS+YQR RVEN+C RL LIS+A+LW+R Q ELLQ M+ CQ+  I+IK+AALGL    HLGK LR +   +LK  D++GLN CGEGGEYET TLD P F++RI +   + I  + D    V Y+   ++ LQ K
Sbjct:   40 ELDSFMYQTVGHMGIEILASAMG-LPLYRRETKGKSTQTGKQYVPTD----DDEVEDLYSLLETCKHEL-QVDAVAVGAILSDYQRVRVENVCSRLNLISLAYLWRRDQTELLQEMIDCQVHAIIIKVAALGLVPDRHLGKSLREMQPHLLKMRDKYGLNVCGEGGEYETFTLDCPLFRQRIVVEDIQTIISSADPICPVGYINFTKLTLQPK 246          

HSP 2 Score: 49.6766 bits (117), Expect = 8.898e-60
Identity = 18/31 (58.06%), Postives = 28/31 (90.32%), Query Frame = 1
Query:    4 ALISGGKDSTFNILECLNQGHELVALINLYP 96
            A++SGGKDS +N+++C+ +GHE+VAL NL+P
Sbjct:    5 AMVSGGKDSCYNMMQCVAEGHEIVALANLHP 35          

HSP 3 Score: 97.0561 bits (240), Expect = 1.702e-20
Identity = 65/242 (26.86%), Postives = 112/242 (46.28%), Query Frame = 2
Query:  986 KAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVE-------------TSENATILHCYINVDDR-----------YNIRSN-MHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAW---IHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQ 1627
            + I + + + L  ++ L   KG+    + Y  L V  + ++  +N +Y + F   N P R CVE              +    +     + ++R            N R N MH+Q  SHWAPA+IGPYSQ+  +   +  +SGQIA+ P  +T+I+G    +C L+LRH++R+A     HG +    + + IC+      +  ++  +     N         + ++ + ALP+ A VEWQ
Sbjct:  482 EGIEQGMQQALDTLRDLCQAKGYDLQDLCYVTLYVRSIGEYPLLNRVYHRAFDFHNPPTRVCVECPLPDGCHVVMEAIAYRQPVAGTISSAEERDREGEETAAALLNGRRNTMHVQGISHWAPANIGPYSQSTRIG-DITYISGQIALVPGSMTIIEGGIRPQCKLTLRHISRIAKAMNAHGQL--RDVVHGICFVTHPAFIGEARRQWERRTTNAI-------MDYIVLPALPREALVEWQ 713          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Fly
Match: CG1578 (gene:FBgn0030336 transcript:FBtr0339749)

HSP 1 Score: 201.445 bits (511), Expect = 8.898e-60
Identity = 103/213 (48.36%), Postives = 140/213 (65.73%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            ELDS+MYQ+VGH  I+ LA A+G +PLY+    G +  T  +Y   +    +DEVEDL+ +L   K +   + A++ GAILS+YQR RVEN+C RL LIS+A+LW+R Q ELLQ M+ CQ+  I+IK+AALGL    HLGK LR +   +LK  D++GLN CGEGGEYET TLD P F++RI +   + I  + D    V Y+   ++ LQ K
Sbjct:   40 ELDSFMYQTVGHMGIEILASAMG-LPLYRRETKGKSTQTGKQYVPTD----DDEVEDLYSLLETCKHEL-QVDAVAVGAILSDYQRVRVENVCSRLNLISLAYLWRRDQTELLQEMIDCQVHAIIIKVAALGLVPDRHLGKSLREMQPHLLKMRDKYGLNVCGEGGEYETFTLDCPLFRQRIVVEDIQTIISSADPICPVGYINFTKLTLQPK 246          

HSP 2 Score: 49.6766 bits (117), Expect = 8.898e-60
Identity = 18/31 (58.06%), Postives = 28/31 (90.32%), Query Frame = 1
Query:    4 ALISGGKDSTFNILECLNQGHELVALINLYP 96
            A++SGGKDS +N+++C+ +GHE+VAL NL+P
Sbjct:    5 AMVSGGKDSCYNMMQCVAEGHEIVALANLHP 35          

HSP 3 Score: 97.0561 bits (240), Expect = 1.702e-20
Identity = 65/242 (26.86%), Postives = 112/242 (46.28%), Query Frame = 2
Query:  986 KAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVE-------------TSENATILHCYINVDDR-----------YNIRSN-MHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAW---IHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQ 1627
            + I + + + L  ++ L   KG+    + Y  L V  + ++  +N +Y + F   N P R CVE              +    +     + ++R            N R N MH+Q  SHWAPA+IGPYSQ+  +   +  +SGQIA+ P  +T+I+G    +C L+LRH++R+A     HG +    + + IC+      +  ++  +     N         + ++ + ALP+ A VEWQ
Sbjct:  482 EGIEQGMQQALDTLRDLCQAKGYDLQDLCYVTLYVRSIGEYPLLNRVYHRAFDFHNPPTRVCVECPLPDGCHVVMEAIAYRQPVAGTISSAEERDREGEETAAALLNGRRNTMHVQGISHWAPANIGPYSQSTRIG-DITYISGQIALVPGSMTIIEGGIRPQCKLTLRHISRIAKAMNAHGQL--RDVVHGICFVTHPAFIGEARRQWERRTTNAI-------MDYIVLPALPREALVEWQ 713          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Fly
Match: CG1578 (gene:FBgn0030336 transcript:FBtr0073607)

HSP 1 Score: 201.445 bits (511), Expect = 8.898e-60
Identity = 103/213 (48.36%), Postives = 140/213 (65.73%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            ELDS+MYQ+VGH  I+ LA A+G +PLY+    G +  T  +Y   +    +DEVEDL+ +L   K +   + A++ GAILS+YQR RVEN+C RL LIS+A+LW+R Q ELLQ M+ CQ+  I+IK+AALGL    HLGK LR +   +LK  D++GLN CGEGGEYET TLD P F++RI +   + I  + D    V Y+   ++ LQ K
Sbjct:   40 ELDSFMYQTVGHMGIEILASAMG-LPLYRRETKGKSTQTGKQYVPTD----DDEVEDLYSLLETCKHEL-QVDAVAVGAILSDYQRVRVENVCSRLNLISLAYLWRRDQTELLQEMIDCQVHAIIIKVAALGLVPDRHLGKSLREMQPHLLKMRDKYGLNVCGEGGEYETFTLDCPLFRQRIVVEDIQTIISSADPICPVGYINFTKLTLQPK 246          

HSP 2 Score: 49.6766 bits (117), Expect = 8.898e-60
Identity = 18/31 (58.06%), Postives = 28/31 (90.32%), Query Frame = 1
Query:    4 ALISGGKDSTFNILECLNQGHELVALINLYP 96
            A++SGGKDS +N+++C+ +GHE+VAL NL+P
Sbjct:    5 AMVSGGKDSCYNMMQCVAEGHEIVALANLHP 35          

HSP 3 Score: 97.0561 bits (240), Expect = 1.702e-20
Identity = 65/242 (26.86%), Postives = 112/242 (46.28%), Query Frame = 2
Query:  986 KAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVE-------------TSENATILHCYINVDDR-----------YNIRSN-MHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAW---IHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQ 1627
            + I + + + L  ++ L   KG+    + Y  L V  + ++  +N +Y + F   N P R CVE              +    +     + ++R            N R N MH+Q  SHWAPA+IGPYSQ+  +   +  +SGQIA+ P  +T+I+G    +C L+LRH++R+A     HG +    + + IC+      +  ++  +     N         + ++ + ALP+ A VEWQ
Sbjct:  482 EGIEQGMQQALDTLRDLCQAKGYDLQDLCYVTLYVRSIGEYPLLNRVYHRAFDFHNPPTRVCVECPLPDGCHVVMEAIAYRQPVAGTISSAEERDREGEETAAALLNGRRNTMHVQGISHWAPANIGPYSQSTRIG-DITYISGQIALVPGSMTIIEGGIRPQCKLTLRHISRIAKAMNAHGQL--RDVVHGICFVTHPAFIGEARRQWERRTTNAI-------MDYIVLPALPREALVEWQ 713          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Zebrafish
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:503603])

HSP 1 Score: 234.958 bits (598), Expect = 1.118e-69
Identity = 152/424 (35.85%), Postives = 230/424 (54.25%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNL--HLHSRTDMNSIESNLREELD---QIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETS-ENATILHCYINVDDR----------------YNIRSNMHIQSFSHWAPASIGPYSQAVSV 1315
            ELDSYMYQ+VGH+A+D +A A+G +PLY+  I G+++  + +YS  +G    DEVEDL+Q+L  VK++   +  +S GAILS+YQR RVEN+C RL L  +A+LW+R Q  LL  M+   +  ILIK+AA GL    HLGK L  +   + + S+++G++ CGEGGEYET TLD P F+K+I I ++  +  ++D +A V +L+  +M  +DK+            +  CQ+    +    +     ++++ E     Q   Q +   E S + S S     ++  S L     +P+  I          ++S L E G     ++   L VS M  FG +N+IY++ F   N PAR CV+ S      L   + + D+                +  R  +H+QS SHWAPA+IGPYSQA  V
Sbjct:   43 ELDSYMYQTVGHQAVDLIAEAMG-LPLYRRTIEGSSVHIDREYSPTDG----DEVEDLYQLLKHVKEEM-HVDGVSVGAILSDYQRVRVENVCARLQLQPLAYLWRRDQAALLSEMISSGLHAILIKVAAFGLHPDKHLGKSLAEMELYLHELSEKYGVHICGEGGEYETFTLDCPLFKKKIIIDATETVIHSDDAFAPVGFLRFTKMHTEDKTEGSGGPPPPSLSACPCQSAIDRMTEELEYADKTADVQRECPSHTQSTWQLDEGCEVSHSSSSSG-FQWISGLSALPS--EHPD--IQSQAQHVFTLLQSRLQEMGSALRHVLLVHLYVSSMQDFGLINSIYSRLF-THNPPARVCVQASLPVGQQLQMDVLLQDQTKASPSSSSSVCEEECFPQRETLHVQSVSHWAPANIGPYSQATQV 454          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Zebrafish
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:503603])

HSP 1 Score: 196.823 bits (499), Expect = 4.588e-58
Identity = 98/214 (45.79%), Postives = 146/214 (68.22%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKS 751
            ELDSYMYQ+VGH+A+D +A A+G +PLY+  I G+++  + +YS  +G    DEVEDL+Q+L  VK++   +  +S GAILS+YQR RVEN+C RL L  +A+LW+R Q  LL  M+   +  ILIK+AA GL    HLGK L  +   + + S+++G++ CGEGGEYET TLD P F+K+I I ++  +  ++D +A V +L+  +M  +DK+
Sbjct:   43 ELDSYMYQTVGHQAVDLIAEAMG-LPLYRRTIEGSSVHIDREYSPTDG----DEVEDLYQLLKHVKEEM-HVDGVSVGAILSDYQRVRVENVCARLQLQPLAYLWRRDQAALLSEMISSGLHAILIKVAAFGLHPDKHLGKSLAEMELYLHELSEKYGVHICGEGGEYETFTLDCPLFKKKIIIDATETVIHSDDAFAPVGFLRFTKMHTEDKT 250          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Xenopus
Match: DPH6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:100497052])

HSP 1 Score: 277.715 bits (709), Expect = 1.120e-83
Identity = 187/522 (35.82%), Postives = 278/522 (53.26%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREE--LDQIYDQFNGSIETSRNKSISSILHI-LTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENAT------ILHCYINVDDRYN----IRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVA-WIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQAV 1633
            ELDSYMYQ+VGH A++  A A+G +P+Y+  + GT++ T   Y+   G    DEVEDL+++L LVK+    + ++S GAILS+YQR RVEN+C+RLGL  +AFLW+R Q ELL  M+   ++ ILIK+AA GLD   HLGK L  +   + + SD++G++ CGEGGEYETLTLD P F+KRI + S+ V   + D +A V YL++ ++ L+DK   +  +   +     C N          + E +  EE  L  I +    S+    +++ S+         SE+  +  N    ++E+  + L+ +K  + E G      V   L V  M  F  +N +Y   F     PAR CV+     +       L C  ++ D  +     ++ MH+QS SHWAPA+IGPYSQAV V P +   +GQIA+ P  + L+ G    E  +SL HV RV   I+      H+  + CY      + I+   + S     A       +  V V  LP+ A+VEW  +
Sbjct:   42 ELDSYMYQTVGHHALELYAEAMG-LPIYRATLQGTSLDTGRAYAPQEG----DEVEDLYRLLKLVKEK-EAVDSVSVGAILSDYQRVRVENVCQRLGLQPLAFLWRRKQEELLDEMISSGLKAILIKVAAFGLDPDKHLGKTLEDMRPYLKQLSDKYGVHVCGEGGEYETLTLDCPLFKKRIVVDSAEVTMHSNDAFAPVAYLRLSKLHLEDK---ITNTAVTLQRECPCSNGFPAEPASCATKECDNSEERPLPWIPNSLP-SVPMCESRTCSAPSQCGFQWISEITASEGN----VLEASHRALSSLKDQVQELGLQMSDAVLIHLYVKSMEDFSDINRVYGTLFPSAP-PARVCVQCCLPGSAFFKMDALFCCPSLADASSDCVPKKTAMHVQSISHWAPANIGPYSQAVQVGPGL-FCAGQIALKPCTMQLVSGGATVEAQVSLCHVERVLDAINLGTSLAHVLLVQCYVTNRSYIPIALAAWGSRNAQEAD---IVPLTVVVVPMLPRGASVEWHVI 544          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Xenopus
Match: DPH6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:100497052])

HSP 1 Score: 277.715 bits (709), Expect = 1.576e-83
Identity = 187/522 (35.82%), Postives = 278/522 (53.26%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREE--LDQIYDQFNGSIETSRNKSISSILHI-LTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENAT------ILHCYINVDDRYN----IRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVA-WIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQAV 1633
            ELDSYMYQ+VGH A++  A A+G +P+Y+  + GT++ T   Y+   G    DEVEDL+++L LVK+    + ++S GAILS+YQR RVEN+C+RLGL  +AFLW+R Q ELL  M+   ++ ILIK+AA GLD   HLGK L  +   + + SD++G++ CGEGGEYETLTLD P F+KRI + S+ V   + D +A V YL++ ++ L+DK   +  +   +     C N          + E +  EE  L  I +    S+    +++ S+         SE+  +  N    ++E+  + L+ +K  + E G      V   L V  M  F  +N +Y   F     PAR CV+     +       L C  ++ D  +     ++ MH+QS SHWAPA+IGPYSQAV V P +   +GQIA+ P  + L+ G    E  +SL HV RV   I+      H+  + CY      + I+   + S     A       +  V V  LP+ A+VEW  +
Sbjct:   54 ELDSYMYQTVGHHALELYAEAMG-LPIYRATLQGTSLDTGRAYAPQEG----DEVEDLYRLLKLVKEK-EAVDSVSVGAILSDYQRVRVENVCQRLGLQPLAFLWRRKQEELLDEMISSGLKAILIKVAAFGLDPDKHLGKTLEDMRPYLKQLSDKYGVHVCGEGGEYETLTLDCPLFKKRIVVDSAEVTMHSNDAFAPVAYLRLSKLHLEDK---ITNTAVTLQRECPCSNGFPAEPASCATKECDNSEERPLPWIPNSLP-SVPMCESRTCSAPSQCGFQWISEITASEGN----VLEASHRALSSLKDQVQELGLQMSDAVLIHLYVKSMEDFSDINRVYGTLFPSAP-PARVCVQCCLPGSAFFKMDALFCCPSLADASSDCVPKKTAMHVQSISHWAPANIGPYSQAVQVGPGL-FCAGQIALKPCTMQLVSGGATVEAQVSLCHVERVLDAINLGTSLAHVLLVQCYVTNRSYIPIALAAWGSRNAQEAD---IVPLTVVVVPMLPRGASVEWHVI 556          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Mouse
Match: Dph6 (diphthamine biosynthesis 6 [Source:MGI Symbol;Acc:MGI:1913882])

HSP 1 Score: 198.364 bits (503), Expect = 8.678e-59
Identity = 102/213 (47.89%), Postives = 147/213 (69.01%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            ELDSYMYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK+   ++  +S GAILS+YQR RVEN+C+RL L  +A+LWQR+Q +LL+ M+   ++ I+IK+AALGLD   HLGK L  +   +L+ S ++G++ CGEGGEYET TLD P F+K+I + SS  +  + D +A V YL++  + L++K
Sbjct:   44 ELDSYMYQTVGHHAIDLYAEAMA-LPLYRRAIRGRSLETGRVYTQCEG----DEVEDLYELLKLVKEK-EEIEGVSVGAILSDYQRGRVENVCKRLNLQPLAYLWQRNQEDLLREMIASNIKAIIIKVAALGLDPDKHLGKTLVEMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIVVDSSEAVMHSADAFAPVAYLRLSRLHLEEK 250          

HSP 2 Score: 49.6766 bits (117), Expect = 8.678e-59
Identity = 20/32 (62.50%), Postives = 28/32 (87.50%), Query Frame = 1
Query:    1 AALISGGKDSTFNILECLNQGHELVALINLYP 96
            AALISGGKDS +N+++C+ +GH++VAL NL P
Sbjct:    4 AALISGGKDSCYNMMQCIAEGHQIVALANLRP 35          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Mouse
Match: Dph6 (diphthamine biosynthesis 6 [Source:MGI Symbol;Acc:MGI:1913882])

HSP 1 Score: 198.364 bits (503), Expect = 9.584e-59
Identity = 102/213 (47.89%), Postives = 147/213 (69.01%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            ELDSYMYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK+   ++  +S GAILS+YQR RVEN+C+RL L  +A+LWQR+Q +LL+ M+   ++ I+IK+AALGLD   HLGK L  +   +L+ S ++G++ CGEGGEYET TLD P F+K+I + SS  +  + D +A V YL++  + L++K
Sbjct:   44 ELDSYMYQTVGHHAIDLYAEAMA-LPLYRRAIRGRSLETGRVYTQCEG----DEVEDLYELLKLVKEK-EEIEGVSVGAILSDYQRGRVENVCKRLNLQPLAYLWQRNQEDLLREMIASNIKAIIIKVAALGLDPDKHLGKTLVEMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIVVDSSEAVMHSADAFAPVAYLRLSRLHLEEK 250          

HSP 2 Score: 49.6766 bits (117), Expect = 9.584e-59
Identity = 20/33 (60.61%), Postives = 28/33 (84.85%), Query Frame = 1
Query:    1 AALISGGKDSTFNILECLNQGHELVALINLYPS 99
            AALISGGKDS +N+++C+ +GH++VAL NL P 
Sbjct:    4 AALISGGKDSCYNMMQCIAEGHQIVALANLRPD 36          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Mouse
Match: Dph6 (diphthamine biosynthesis 6 [Source:MGI Symbol;Acc:MGI:1913882])

HSP 1 Score: 140.584 bits (353), Expect = 1.682e-41
Identity = 74/143 (51.75%), Postives = 101/143 (70.63%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPL 538
            ELDSYMYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK+   ++  +S GAILS+YQR RVEN+C+RL L  +A+LWQR+Q +LL+ M+   ++ I+IK+AALGLD   HLGK L
Sbjct:   44 ELDSYMYQTVGHHAIDLYAEAMA-LPLYRRAIRGRSLETGRVYTQCEG----DEVEDLYELLKLVKEK-EEIEGVSVGAILSDYQRGRVENVCKRLNLQPLAYLWQRNQEDLLREMIASNIKAIIIKVAALGLDPDKHLGKTL 180          

HSP 2 Score: 49.6766 bits (117), Expect = 1.682e-41
Identity = 20/32 (62.50%), Postives = 28/32 (87.50%), Query Frame = 1
Query:    1 AALISGGKDSTFNILECLNQGHELVALINLYP 96
            AALISGGKDS +N+++C+ +GH++VAL NL P
Sbjct:    4 AALISGGKDSCYNMMQCIAEGHQIVALANLRP 35          
BLAST of Diphthine--ammonia ligase-like Protein vs. UniProt/SwissProt
Match: sp|Q9USQ7|DPH6_SCHPO (Diphthine--ammonia ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug71 PE=1 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.643e-79
Identity = 184/533 (34.52%), Postives = 278/533 (52.16%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK---SPDLYRS----HKEIYGSEFCQNLHLHSR----------TDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVE---TSENATILHCYINVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQAVFSSNT 1648
            E+DS+MYQSVGH+ I   A    D+PLY+  I G +I+  L Y F       DE EDL++++  V  + PDL A+S+GAILS YQRTRVEN+C+RLGL S++FLWQ+ Q +LL  M+   +  ILIK+AA+GL  R  LGK L  + + +L  + +F L+PCGEGGEYETL LD P F+KRI +    V+   E     V YLK ++  ++DK    P   +S    ++E+ G E+    H  S+          T  + I   LRE     + Q  GS     N        ++ ++   +      E AI          +  LL   G++   + +  + +S M++F   N++Y ++F   N P+R+CV     SE   ++ C   V D    R+ +H+Q  S+WAPA+IGPYSQ++  +  V  +SGQI + P  + L   D + E +L+L+H  RVA     M    L   + Y   S +      ++     N       + V    V ALP+ A+VEWQ +++ ++
Sbjct:   41 EIDSFMYQSVGHDVIPLYAECF-DLPLYREKIGGQSINQNLDYQFT----EKDETEDLYRLIKRVLTNHPDLEAVSTGAILSTYQRTRVENVCKRLGLKSLSFLWQKDQEKLLNDMVVSGLNAILIKVAAIGLT-RKDLGKSLAEMQDKLLTLNKKFELHPCGEGGEYETLVLDCPLFKKRIVLTDKEVV---EHSSGEVCYLK-VKACVKDKPEWQPISLKSELVPNEELLGEEYSHIYHTISKKYELIDDQEETPTSLIPIPLRE---SAFQQKKGSFLVLGN--------VVATKGSYNTFQGEAESAI--------NNLNELLGTYGYSNKNVYFVTVILSSMSKFAEFNSVYNKYFDFTNPPSRSCVAAPLASEYRIVMSCI--VGDVTEKRA-LHVQGQSYWAPANIGPYSQSICAN-GVVFISGQIGLIPSVMELKLHDKIFEMVLALQHANRVA---KAMRVGSLIACLAYVCDSRDADCVVKIWSEYTKNTGES---SPVLVALVDALPRNASVEWQLLYNDSS 534          
BLAST of Diphthine--ammonia ligase-like Protein vs. UniProt/SwissProt
Match: sp|Q2HJF5|DPH6_BOVIN (Diphthine--ammonia ligase OS=Bos taurus OX=9913 GN=DPH6 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 1.084e-64
Identity = 114/230 (49.57%), Postives = 159/230 (69.13%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK---SPDLYRSHKEIYGS 790
            ELDSYMYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK+   ++  IS GAILS+YQR RVEN+C+RL L  +A+LWQR+Q +LLQ M+   ++ I+IK+AALGLD   HLGKPL  +   +L+ S ++G++ CGEGGEYET TLD P F+K+I + SS V+T + D +A V YL+ +E+ L+DK    PD  R+  +I+ S
Sbjct:   44 ELDSYMYQTVGHHAIDLYAEAMA-LPLYRRTIRGKSVDTGPVYTKCEG----DEVEDLYELLKLVKEK-EEVEGISVGAILSDYQRVRVENVCKRLNLQPLAYLWQRNQEDLLQEMISSNIQAIIIKVAALGLDPDKHLGKPLDQMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVTHSADAFAPVAYLRFLELHLEDKVSPVPDNCRTSNDIHNS 267          
BLAST of Diphthine--ammonia ligase-like Protein vs. UniProt/SwissProt
Match: sp|Q7L8W6|DPH6_HUMAN (Diphthine--ammonia ligase OS=Homo sapiens OX=9606 GN=DPH6 PE=1 SV=3)

HSP 1 Score: 209.92 bits (533), Expect = 4.994e-62
Identity = 110/228 (48.25%), Postives = 156/228 (68.42%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK---SPDLYRSHKEIY 784
            ELDSYMYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK+   ++  IS GAILS+YQR RVEN+C+RL L  +A+LWQR+Q +LL+ M+   ++ ++IK+AALGLD   HLGK L  +   +++ S ++G++ CGEGGEYET TLD P F+K+I + SS V+  + D +A V YL+ +E+ L+DK    PD YR+   IY
Sbjct:   44 ELDSYMYQTVGHHAIDLYAEAMA-LPLYRRTIRGRSLDTRQVYTKCEG----DEVEDLYELLKLVKEK-EEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIY 265          
BLAST of Diphthine--ammonia ligase-like Protein vs. UniProt/SwissProt
Match: sp|Q12429|DPH6_YEAST (Diphthine--ammonia ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DPH6 PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 4.614e-61
Identity = 165/569 (29.00%), Postives = 280/569 (49.21%), Query Frame = 2
Query:  107 HELDSYMYQSVGHEAIDYLALAIGDVPLYKH-VISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQM-----------------EPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKR-IEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSH----------KEIYGS---EFCQNL-HLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNL----PARTCVETSENATILHCYINV--------DDRYNI-RSNMHIQSFSHWAPASIGPYSQAVSV---SPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHGNMIWDHLANMICYCVKSDNMMISQTL----FHSVICNLASGCLCNR-------VCWVTVSALPKAANVEWQAV 1633
             ELDS+M+Q+VGH+ IDY +  IG VPL++  ++  T+ + EL Y+       +DE+E+LF++L  VK   PDL A+S GAILS+YQRTRVEN+C RLGL+ +++LWQR Q EL+  M  C M                 +  +IK+AA+GL+E+ HLG  L  +   + K +  + ++ CGEGGE+ET+ LDAPFFQ   +E+I   ++  ++ E    +      +K++ +  +L +S             I+G+   +  QNL    ++T     E+++   L Q          T+ NK+ +  L+I   +S   +T     + I         ++  +L      ++ I+ + L + DM+ FG +N IY +F          P+R CV +       H  ++V         ++ N  +  +H+Q  S+WAP +IGPYSQ+  +   +  V  +SGQI + P+ + ++      + +L+L+H   +    G         ++  C  SD  ++   +    F+    N  S    ++       +  V +S LP+ A  E+  V
Sbjct:   41 QELDSFMFQTVGHDLIDYYSKCIG-VPLFRRSILRNTSNNVELNYTAT----QDDEIEELFELLRTVKDKIPDLEAVSVGAILSSYQRTRVENVCSRLGLVVLSYLWQRDQAELMGEM--CLMSKDVNNVENDTNSGNKFDARIIKVAAIGLNEK-HLGMSLPMMQPVLQKLNQLYQVHICGEGGEFETMVLDAPFFQHGYLELID--IVKCSDGEVHNAR------LKVKFQPRNLSKSFLLNQLDQLPVPSIFGNNWQDLTQNLPKQQAKTGEQRFENHMSNALPQ----------TTINKT-NDKLYISNLQSRKSETVEKQSEDI-------FTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLPPSRACVGSKCLPEDCHVQLSVVVDVKNTGKEKINKNKGGLHVQGRSYWAPCNIGPYSQSTWLNDDANQVSFISGQIGLVPQSMEILGTPLTDQIVLALQHFDTLCETIGAQ-----EKLLMTCYISDESVLDSVIKTWAFYCSNMNHRSDLWMDKSDDVEKCLVLVKISELPRGAVAEFGGV 570          

HSP 2 Score: 48.1358 bits (113), Expect = 4.614e-61
Identity = 21/34 (61.76%), Postives = 25/34 (73.53%), Query Frame = 1
Query:    4 ALISGGKDSTFNILECLNQGHELVALINLYPSPT 105
            ALISGGKDS +NI  CL   HEL+AL N+YP  +
Sbjct:    5 ALISGGKDSFYNIFHCLKNNHELIALGNIYPKES 38          
BLAST of Diphthine--ammonia ligase-like Protein vs. UniProt/SwissProt
Match: sp|Q5M9F5|DPH6_RAT (Diphthine--ammonia ligase OS=Rattus norvegicus OX=10116 GN=Dph6 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.260e-58
Identity = 102/213 (47.89%), Postives = 147/213 (69.01%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            ELDSYMYQ+VGH AID  A A+  +PLY+  I G ++ T   Y+   G    DEVEDL+++L LVK+   ++  +S GAILS+YQR RVEN+C+RL L  +A+LWQR+Q +LL+ M+   +E I+IK+AALGLD   HLGK L  +   +L+ S ++G++ CGEGGEYET TLD P F+K+I + +S  +  + D +A V YL++  + L++K
Sbjct:   44 ELDSYMYQTVGHHAIDLYAEAMA-LPLYRRTIRGRSLETGRVYTRCEG----DEVEDLYELLKLVKEK-EEIEGVSVGAILSDYQRVRVENVCKRLNLQPLAYLWQRNQEDLLREMIASNIEAIIIKVAALGLDPDKHLGKTLGEMEPYLLELSKKYGVHVCGEGGEYETFTLDCPLFKKKIVVDTSEAVIHSADAFAPVAYLRLSGLHLEEK 250          

HSP 2 Score: 48.9062 bits (115), Expect = 5.260e-58
Identity = 20/33 (60.61%), Postives = 27/33 (81.82%), Query Frame = 1
Query:    1 AALISGGKDSTFNILECLNQGHELVALINLYPS 99
            AALISGGKDS +N++ C+ +GH++VAL NL P 
Sbjct:    4 AALISGGKDSCYNMMRCIAEGHQIVALANLRPD 36          
BLAST of Diphthine--ammonia ligase-like Protein vs. TrEMBL
Match: A0A1Y1KW51 (Diphthami_syn_2 domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 3.399e-94
Identity = 198/528 (37.50%), Postives = 288/528 (54.55%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNP----------EKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVET--SENATILHCYIN---VDDRYNI-----RSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTR-VAWIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQA 1630
            E+DSYMYQSVGHEAID +A A+  +PLY+  I+G + S  + YS    Y S+DEVEDLF++L  VK D P +  +S GAILS+YQR RVEN+C RL L  +A+LWQR+Q ELL  M++C+++ I+IK+AALGL+   HLG+ LR +   ++   D++GLN CGEGGEYETL LD P F  RI I +S VI  + +  A V +LK+ ++KL+ K P L           F   L     +D +   ++  EE  +  D    S + +   +++  +  ++   EL+   N+             +  E++   L K+KS L   G T + +V   + VSDM++F  +N +Y       N P R CVE    +N  ++   ++    DD         R  MHIQS SHWAPA+IGPYSQA+ V   V  ++GQI + P  + L+ G    +C L++RHV R ++ I  N     +   +CY      +   + L+ +   N         V +V VS LPK A VEW  
Sbjct:   40 EIDSYMYQSVGHEAIDLIAEAM-QLPLYRKEITGDSKSVGINYS----YTSDDEVEDLFELLQNVKDDMP-IEGVSVGAILSDYQRNRVENVCSRLQLTPLAYLWQRNQQELLCEMIKCEVDAIVIKVAALGLEPSRHLGRSLRLLEPHLMAMHDKYGLNVCGEGGEYETLVLDCPLFGSRIVIEASEVILHSANPIAPVGFLKLNKLKLEPKLPQL----------NFYSRLKNVPLSDSDGYITDHGEEATEFVDDNTSSADETVAHTVT--IKTVSCCPELNAVSNDGWLWISGLCGNSASCEEALKMALEKLKSTLSTYGHTLEDVVSVSMLVSDMSKFVELNKLYVDVIKHVNPPTRACVEVPLPKNCPVILEVVSWSLPDDAIERDPPIERHTMHIQSISHWAPANIGPYSQAIRVGEFV-YIAGQIGLVPGSMQLVRGGVKSQCQLAIRHVGRIISGIDSNTNLRDVVQAVCYVTNIQVINNVRKLWEATTNNAI-------VNYVVVSGLPKNALVEWHV 541          
BLAST of Diphthine--ammonia ligase-like Protein vs. TrEMBL
Match: A0A5N4APE3 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_07056 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 4.541e-94
Identity = 198/527 (37.57%), Postives = 288/527 (54.65%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNP----------EKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVET--SENATILHCYIN---VDDRYNI-----RSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTR-VAWIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQ 1627
            E+DSYMYQSVGHEAID +A A+  +PLY+  I+G + S  + YS    Y S+DEVEDLF++L  VK D P +  +S GAILS+YQR RVEN+C RL L  +A+LWQR+Q ELL  M++C+++ I+IK+AALGL+   HLG+ LR +   ++   D++GLN CGEGGEYETL LD P F  RI I +S VI  + +  A V +LK+ ++KL+ K P L           F   L     +D +   ++  EE  +  D    S + +   +++  +  ++   EL+   N+             +  E++   L K+KS L   G T + +V   + VSDM++F  +N +Y       N P R CVE    +N  ++   ++    DD         R  MHIQS SHWAPA+IGPYSQA+ V   V  ++GQI + P  + L+ G    +C L++RHV R ++ I  N     +   +CY      +   + L+ +   N         V +V VS LPK A VEW 
Sbjct:   59 EIDSYMYQSVGHEAIDLIAEAM-QLPLYRKEITGDSKSVGINYS----YTSDDEVEDLFELLQNVKDDMP-IEGVSVGAILSDYQRNRVENVCSRLQLTPLAYLWQRNQQELLCEMIKCEVDAIVIKVAALGLEPSRHLGRSLRLLEPHLMAMHDKYGLNVCGEGGEYETLVLDCPLFGSRIVIEASEVILHSANPIAPVGFLKLNKLKLEPKLPQL----------NFYSRLKNVPLSDSDGYITDHGEEATEFVDDNTSSADETVAHTVT--IKTVSCCPELNAVSNDGWLWISGLCGNSASCEEALKMALEKLKSTLSTYGHTLEDVVSVSMLVSDMSKFVELNKLYVDVIKHVNPPTRACVEVPLPKNCPVILEVVSWSLPDDAIERDPPIERHTMHIQSISHWAPANIGPYSQAIRVGEFV-YIAGQIGLVPGSMQLVRGGVKSQCQLAIRHVGRIISGIDSNTNLRDVVQAVCYVTNIQVINNVRKLWEATTNNAI-------VNYVVVSGLPKNALVEWH 559          
BLAST of Diphthine--ammonia ligase-like Protein vs. TrEMBL
Match: D2A2B0 (Diphthine--ammonia ligase-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC007678 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.353e-92
Identity = 198/533 (37.15%), Postives = 293/533 (54.97%), Query Frame = 2
Query:   98 HRHHELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSP----------------DLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENATILHCYINVDDRYNI-------RSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTR-VAWIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEW 1624
            H   ELDSYMYQSVGHEAI+++A A+ D+PLY+    G  +ST+    +    D  DEVEDLF++L  VK D  ++  +S GAILS+YQR RVEN+C RLGL+ +A+LWQR Q ELL  M++C+++ ++IK+AALGLD   HLG+ L  +   +L  S+++GLN CGEGGEYETLTLD P F+ R+ I  S V+  + D  A V YL++ ++ L+ K P                D Y +   +  S+F  +        +NS+E N    L+ I  +  G    SR+  +  I  I    S+             +++ +  AK+KS+L +   T   +   V+ +SDM+++  +N +Y + F+  N P+R CVE      ++   ++  + +N        R  MH+QS SHWAPA+IGPYSQAV V   + L +GQI M P  L ++ G    +C L+LRHV R +  +  N+    +   ICY      +  ++ L+     N         V +V VS LPK+A VEW
Sbjct:   36 HNKSELDSYMYQSVGHEAIEFIAAAM-DLPLYREATRG--VSTQQGKIYEPSPD--DEVEDLFRVLGQVKGDL-EVEGVSVGAILSDYQRVRVENVCVRLGLVPLAYLWQRDQKELLDEMIKCEVDAVIIKVAALGLDPGKHLGRTLSSMQPHLLAMSEKYGLNVCGEGGEYETLTLDCPLFRSRLVIDESDVVLHSSDPIAPVGYLQLKKISLETKLPLLDLQDRLSGLPLKNSDGYVTDYGVEASDFSDD------ESVNSLE-NATVTLETIEQEPMGV--KSRDGWL-CIAGIQGRSSDFR-----------QAMEEAAAKLKSILGQHDQTVQDVCSLVMFISDMSRYAELNQVYCETFNHVNPPSRACVEVPSCFPVILTALSWKEPHNQAGDFPLERHTMHVQSRSHWAPANIGPYSQAVRVGELIHL-AGQIGMIPGSLEMVKGGIKAQCQLALRHVGRLLKAVDSNVNLRDVVQGICYVTDVSYVEHARKLWEEKTNNAI-------VDYVVVSQLPKSALVEW 533          
BLAST of Diphthine--ammonia ligase-like Protein vs. TrEMBL
Match: A0A210Q526 (Diphthine--ammonia ligase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10188 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 4.502e-92
Identity = 205/544 (37.68%), Postives = 294/544 (54.04%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRS-HKEIYGSEFCQNLHLH------SRTDM-NSIESNLREEL-------DQIYDQFNGSIETS-RNKSISSIL-HILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETS--EN-ATILHCYINVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRV--AWIHGNMIWDHLANMICY--------CVKSDNMMISQTLFHS--------VICNLASGCLCNRVCWVTVSALPKAANVEWQ 1627
            E+DSYMYQ+VGH A+D  A A+G +PL++H+I G A  T   Y         DEVEDLF +L  V+K+  ++ A+S GAILSNYQR RVEN+C+RLGL S+++LW+R Q ELL  M+ C +  +LIK+A+LGLD + HLGK L  +  ++L+   +F LN CGEGGEYET TLD P F+KRI + +  ++  ++D ++ V YL +    L+DK  D+  S H+ + G E  ++  ++         DM   +  ++ E L       D + D+F   I+T+  N  ++ ++    T   E  K   +  KA +  V K     K  LV             L V  M  F  VN+IY  +F R N P R CV+ S  +N A +L CY     +   R  MH+Q  SHWAPA+IGPYSQAV+V   +  ++GQIAM P  L +I G    E  LSLRHV RV  A   G  +  H+  ++CY          + + +   Q+ + S        V+C+ +  C       V +  LP+ A VEWQ
Sbjct:   70 EMDSYMYQTVGHHAVDLYAEAMG-LPLFRHIIQGVAKETGSDYVPT----PQDEVEDLFILLQKVQKEI-EVEAVSVGAILSNYQRVRVENVCQRLGLTSLSYLWRRDQAELLSEMIGCGVTAVLIKVASLGLDPQKHLGKTLAEMQPELLRMHTKFKLNVCGEGGEYETFTLDCPLFKKRIVLDNPEMVIHSDDAFSPVGYLNLRTAHLEDKQTDVEMSQHQRVQGLEMRRSRDVYHDLLRDGEVDMCGDVSGDMDEGLNTHVSNNDILPDEFKMCIKTAGENLWVTGVVARDNTDIQEATKAAMDQVKAAVSGVGKDWDMSKMALV------------CLYVQRMEDFARVNSIYKTYF-RLNPPVRVCVQASLPQNIALLLDCY---GSKAANRDTMHVQGISHWAPANIGPYSQAVTVDSRI-FIAGQIAMVPGSLKMIQGGIAIESRLSLRHVGRVLGAQFPGCDL-RHVVTVVCYITSHRYIDTARREWIRARQSCYESNDTVDCEDVVCSPSVMC-------VVIPYLPRDAKVEWQ 582          
BLAST of Diphthine--ammonia ligase-like Protein vs. TrEMBL
Match: R7V493 (Diphthami_syn_2 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_141560 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 8.293e-91
Identity = 187/527 (35.48%), Postives = 299/527 (56.74%), Query Frame = 2
Query:  107 HELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQI-----YDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENATI---LHCYINVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWI---HGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLC-NRVCWVTVSALPKAANVEWQAVFSSNTV 1651
            +E+DSYM+Q+VGH+AID  A A+G +PL++  I G+++   + Y+        DEVEDL+++LS VK++ P + A+S GAILS+YQR RVEN+C+RLGL S+A+LW+R Q ELL  M+  Q++ I++K+AA+GL+   HLG  L  I   + + ++++GLN CGEGGE+ET TLD P F+ +I +    ++  ++D +A V YL++ EM L++K  D Y S   +      Q++ +   +D+        E++  I      +     +      S S +L++    + ++K     E  + +   K +  MK  + + GF+   IV+  LCV DM+QF  VN +Y  FF  +N P R C+ET   + +   L C +    + + R  MH+Q  SHWAPA+IGPYSQAV +   +  V+GQI + P  + ++    L +  LSLRH  RV        N I   +   +CY    D + +++  +  +I   AS   C  +V +V +++LP+   VEW  V+ + TV
Sbjct:   37 NEIDSYMFQTVGHQAIDLYAEAMG-LPLFRQTIEGSSVELGMYYTETEA----DEVEDLYKLLSRVKEECP-IEAVSVGAILSDYQRVRVENVCQRLGLTSLAYLWRREQDELLDEMIAAQVKSIIVKVAAMGLNPDEHLGLTLSQIQPHMREMNEKYGLNICGEGGEFETFTLDCPLFKMKIIVDDKEILMHSDDPFAPVAYLQLKEMHLEEKE-DEYASMLAM-----VQDIPMMRSSDLLGQIFPDEEDVPTINNPPVVEDVERPVLKKLKISSSGMLYLSGFTAAVNKED---EGDLTKHTEKVMKSMKGAVEKAGFSMRDIVFVHLCVRDMSQFALVNQVYKTFF-SNNPPIRVCIETCLPSNVNLTLSCGVR---QCSERKTMHVQGLSHWAPANIGPYSQAVKLDEFI-FVAGQIPLVPASMQVVSDGVLPQARLSLRHTDRVLQAIAPQSNGIASVIL-AVCYITHKDFVSVAEAEWKKLI---ASKDECFGQVEYVVITSLPRNCLVEWD-VYGALTV 538          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Cavefish
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:103047424])

HSP 1 Score: 276.174 bits (705), Expect = 1.661e-83
Identity = 188/525 (35.81%), Postives = 276/525 (52.57%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEI-YGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNP-EKAIIESVTK-TLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENA-------TILHCYI--NVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHG-NMIWDHLANMICYCVKSDNMMISQTLFHS--------VICNLASGCLCNRVCWVTVSALPKAANVE 1621
            E+DSYMYQ+VGH+AID  A A+G +PLY+  I G+++ T  +YS   G    DEVEDL+ +L LVK+    + A+S GAILS+YQR RVEN+C RL L  +A+LW R Q  LL+ M+   +  +LIK+AA GLD   HLGK L  +   + + S ++G++ CGEGGEYET T D P F+K+I I     +  + D +A V YL+  +M  +DK  D+  +   +  GS  CQ     S  D  + E+   ++   I ++F  +       + SS+         +   G  P E   +   T+  L +++  L E+GF    IV   L V +M  F  VN++Y  FF   N PAR CV+T  +A        +LH +     D  ++ R  +H+QS SHWAPA+IGPYSQAV V   V   +GQIA+ P  + L++     +  +S  HV +V    G N+   H+    CY      +  ++ ++ S        V C  A       +    V +LP+ A VE
Sbjct:   24 EIDSYMYQTVGHQAIDLYAEAMG-LPLYRRTIEGSSLDTGREYSQKEG----DEVEDLYHLLKLVKEK-EGVEAVSVGAILSDYQRVRVENVCSRLQLQPLAYLWWRDQAALLKEMISSGVHALLIKVAAFGLDPGKHLGKTLAEMELCLQQLSQKYGVHICGEGGEYETFTTDCPLFKKKIVIDEMETVIHSADAFAPVGYLRFTQMHTEDK--DIGSTESALPLGSCPCQ-----SAIDKMTEEAVYADKTQDIQEEFTSNACRPWCSARSSV-----GYQWITGIGGLPSEHTDVRGQTQHALTQLQGELKERGFQLKHIVLVHLYVKNMEDFAEVNSVYCTFFSH-NPPARVCVQTCLSAGQLLQMDVLLHDWTLPPQDGCFHQRDTLHVQSLSHWAPANIGPYSQAVRVDEAV-FCAGQIALVPCTMKLLNRGPASQAQMSYSHVEKVLSAMGQNLTLSHVLQAHCYVSHHSYIPSAKEVWSSKLQEKQGQVACFGAEEIQGTPLVVAVVPSLPRGAAVE 528          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Cavefish
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:103047424])

HSP 1 Score: 276.174 bits (705), Expect = 2.006e-83
Identity = 188/525 (35.81%), Postives = 276/525 (52.57%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEI-YGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNP-EKAIIESVTK-TLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENA-------TILHCYI--NVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHG-NMIWDHLANMICYCVKSDNMMISQTLFHS--------VICNLASGCLCNRVCWVTVSALPKAANVE 1621
            E+DSYMYQ+VGH+AID  A A+G +PLY+  I G+++ T  +YS   G    DEVEDL+ +L LVK+    + A+S GAILS+YQR RVEN+C RL L  +A+LW R Q  LL+ M+   +  +LIK+AA GLD   HLGK L  +   + + S ++G++ CGEGGEYET T D P F+K+I I     +  + D +A V YL+  +M  +DK  D+  +   +  GS  CQ     S  D  + E+   ++   I ++F  +       + SS+         +   G  P E   +   T+  L +++  L E+GF    IV   L V +M  F  VN++Y  FF   N PAR CV+T  +A        +LH +     D  ++ R  +H+QS SHWAPA+IGPYSQAV V   V   +GQIA+ P  + L++     +  +S  HV +V    G N+   H+    CY      +  ++ ++ S        V C  A       +    V +LP+ A VE
Sbjct:   35 EIDSYMYQTVGHQAIDLYAEAMG-LPLYRRTIEGSSLDTGREYSQKEG----DEVEDLYHLLKLVKEK-EGVEAVSVGAILSDYQRVRVENVCSRLQLQPLAYLWWRDQAALLKEMISSGVHALLIKVAAFGLDPGKHLGKTLAEMELCLQQLSQKYGVHICGEGGEYETFTTDCPLFKKKIVIDEMETVIHSADAFAPVGYLRFTQMHTEDK--DIGSTESALPLGSCPCQ-----SAIDKMTEEAVYADKTQDIQEEFTSNACRPWCSARSSV-----GYQWITGIGGLPSEHTDVRGQTQHALTQLQGELKERGFQLKHIVLVHLYVKNMEDFAEVNSVYCTFFSH-NPPARVCVQTCLSAGQLLQMDVLLHDWTLPPQDGCFHQRDTLHVQSLSHWAPANIGPYSQAVRVDEAV-FCAGQIALVPCTMKLLNRGPASQAQMSYSHVEKVLSAMGQNLTLSHVLQAHCYVSHHSYIPSAKEVWSSKLQEKQGQVACFGAEEIQGTPLVVAVVPSLPRGAAVE 539          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Cavefish
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:103047424])

HSP 1 Score: 275.789 bits (704), Expect = 3.322e-83
Identity = 188/525 (35.81%), Postives = 276/525 (52.57%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEI-YGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNP-EKAIIESVTK-TLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENA-------TILHCYI--NVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHG-NMIWDHLANMICYCVKSDNMMISQTLFHS--------VICNLASGCLCNRVCWVTVSALPKAANVE 1621
            E+DSYMYQ+VGH+AID  A A+G +PLY+  I G+++ T  +YS   G    DEVEDL+ +L LVK+    + A+S GAILS+YQR RVEN+C RL L  +A+LW R Q  LL+ M+   +  +LIK+AA GLD   HLGK L  +   + + S ++G++ CGEGGEYET T D P F+K+I I     +  + D +A V YL+  +M  +DK  D+  +   +  GS  CQ     S  D  + E+   ++   I ++F  +       + SS+         +   G  P E   +   T+  L +++  L E+GF    IV   L V +M  F  VN++Y  FF   N PAR CV+T  +A        +LH +     D  ++ R  +H+QS SHWAPA+IGPYSQAV V   V   +GQIA+ P  + L++     +  +S  HV +V    G N+   H+    CY      +  ++ ++ S        V C  A       +    V +LP+ A VE
Sbjct:   40 EIDSYMYQTVGHQAIDLYAEAMG-LPLYRRTIEGSSLDTGREYSQKEG----DEVEDLYHLLKLVKEK-EGVEAVSVGAILSDYQRVRVENVCSRLQLQPLAYLWWRDQAALLKEMISSGVHALLIKVAAFGLDPGKHLGKTLAEMELCLQQLSQKYGVHICGEGGEYETFTTDCPLFKKKIVIDEMETVIHSADAFAPVGYLRFTQMHTEDK--DIGSTESALPLGSCPCQ-----SAIDKMTEEAVYADKTQDIQEEFTSNACRPWCSARSSV-----GYQWITGIGGLPSEHTDVRGQTQHALTQLQGELKERGFQLKHIVLVHLYVKNMEDFAEVNSVYCTFFSH-NPPARVCVQTCLSAGQLLQMDVLLHDWTLPPQDGCFHQRDTLHVQSLSHWAPANIGPYSQAVRVDEAV-FCAGQIALVPCTMKLLNRGPASQAQMSYSHVEKVLSAMGQNLTLSHVLQAHCYVSHHSYIPSAKEVWSSKLQEKQGQVACFGAEEIQGTPLVVAVVPSLPRGAAVE 544          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Cavefish
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:103047424])

HSP 1 Score: 265.774 bits (678), Expect = 9.690e-80
Identity = 184/527 (34.91%), Postives = 264/527 (50.09%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEI-YGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENA-------TILHCYI--NVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHG-NMIWDHLANMICYCVKSDNMMISQTLFHS--------VICNLASGCLCNRVCWVTVSALPKAANVEWQAV 1633
            E+DSYMYQ+VGH+AID  A A+G +PLY+  I G+++ T  +YS   G    DEVEDL+ +L LVK+    + A+S GAILS+YQR RVEN+C RL L  +A+LW R Q  LL+ M+   +  +LIK+AA GLD   HLGK L  +   + + S ++G++ CGEGGEYET T D P F+K+I I     +  + D +A V YL+  +M  +DK  D+  +   +  GS  CQ     S  D  + E+   ++   I ++F                   TS  EL                           E+GF    IV   L V +M  F  VN++Y  FF   N PAR CV+T  +A        +LH +     D  ++ R  +H+QS SHWAPA+IGPYSQAV V   V   +GQIA+ P  + L++     +  +S  HV +V    G N+   H+    CY      +  ++ ++ S        V C  A       +    V +LP+ A VE   +
Sbjct:   40 EIDSYMYQTVGHQAIDLYAEAMG-LPLYRRTIEGSSLDTGREYSQKEG----DEVEDLYHLLKLVKEK-EGVEAVSVGAILSDYQRVRVENVCSRLQLQPLAYLWWRDQAALLKEMISSGVHALLIKVAAFGLDPGKHLGKTLAEMELCLQQLSQKYGVHICGEGGEYETFTTDCPLFKKKIVIDEMETVIHSADAFAPVGYLRFTQMHTEDK--DIGSTESALPLGSCPCQ-----SAIDKMTEEAVYADKTQDIQEEF-------------------TSNGELK--------------------------ERGFQLKHIVLVHLYVKNMEDFAEVNSVYCTFFSH-NPPARVCVQTCLSAGQLLQMDVLLHDWTLPPQDGCFHQRDTLHVQSLSHWAPANIGPYSQAVRVDEAV-FCAGQIALVPCTMKLLNRGPASQAQMSYSHVEKVLSAMGQNLTLSHVLQAHCYVSHHSYIPSAKEVWSSKLQEKQGQVACFGAEEIQGTPLVVAVVPSLPRGAAVELHVI 506          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Cavefish
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:103047424])

HSP 1 Score: 256.914 bits (655), Expect = 1.866e-78
Identity = 161/413 (38.98%), Postives = 230/413 (55.69%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNP-EKAIIESVTK-TLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENA-------TILHCYI--NVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSV 1315
            E+DSYMYQ+VGH+AID  A A+G +PLY+  I G+++ T  +YS   G    DEVEDL+ +L LVK+    + A+S GAILS+YQR RVEN+C RL L  +A+LW R Q  LL+ M+   +  +LIK+AA GLD   HLGK L  +   + + S ++G++ CGEGGEYET T D P F+K+I I     +  + D +A V YL+  +M  +DK      S   + GS  CQ     S  D  + E+   ++   I ++F  +       + SS+         +   G  P E   +   T+  L +++  L E+GF    IV   L V +M  F  VN++Y  FF   N PAR CV+T  +A        +LH +     D  ++ R  +H+QS SHWAPA+IGPYSQAV +
Sbjct:   40 EIDSYMYQTVGHQAIDLYAEAMG-LPLYRRTIEGSSLDTGREYSQKEG----DEVEDLYHLLKLVKEK-EGVEAVSVGAILSDYQRVRVENVCSRLQLQPLAYLWWRDQAALLKEMISSGVHALLIKVAAFGLDPGKHLGKTLAEMELCLQQLSQKYGVHICGEGGEYETFTTDCPLFKKKIVIDEMETVIHSADAFAPVGYLRFTQMHTEDKDIGSTESALPL-GSCPCQ-----SAIDKMTEEAVYADKTQDIQEEFTSNACRPWCSARSSV-----GYQWITGIGGLPSEHTDVRGQTQHALTQLQGELKERGFQLKHIVLVHLYVKNMEDFAEVNSVYCTFFSH-NPPARVCVQTCLSAGQLLQMDVLLHDWTLPPQDGCFHQRDTLHVQSLSHWAPANIGPYSQAVRM 434          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006436.1 (pep scaffold:Pmarinus_7.0:GL476470:1048530:1060018:-1 gene:ENSPMAG00000005810.1 transcript:ENSPMAT00000006436.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.764 bits (530), Expect = 4.796e-64
Identity = 110/214 (51.40%), Postives = 143/214 (66.82%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKS 751
            ELDSYMYQ+VGH+A+   A A+  +PLY+  I G  +     Y+ + G    DEVEDL+ +L  VK+    +  +S GAILS+YQR RVEN+CERLGL  +A LW R Q ELLQ M+   +E ILIK+AALGLD R HLGK L  +S  ++  S +FG++ CGEGGEYET TLD P F KRI I  S ++  +ED+ A V YL+ + M L+DKS
Sbjct:    4 ELDSYMYQTVGHQAVGLYAEAMA-LPLYRRSIQGETLEMGRDYTEHAG----DEVEDLYHLLKEVKEK-EAVEGVSVGAILSDYQRLRVENVCERLGLTPLALLWHREQEELLQEMVTAGVEAILIKVAALGLDPRKHLGKSLLEMSPLLVSLSQKFGVHVCGEGGEYETFTLDCPIFHKRIVIDESEMVITSEDDIAPVGYLRFLRMHLEDKS 211          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Yeast
Match: DPH6 (Diphthamide synthetase; catalyzes the last amidation step of diphthamide biosynthesis using ammonium and ATP; evolutionarily conserved in eukaryotes; dph6 mutants exhibit diphthine accumulation and resistance to sordarin, which is indicative of defects in diphthamide formation on EF2; green fluorescent protein (GFP)-tagged protein localizes to the cytoplasm; DPH6/YLR143W is not an essential gene [Source:SGD;Acc:S000004133])

HSP 1 Score: 210.305 bits (534), Expect = 8.374e-63
Identity = 165/569 (29.00%), Postives = 280/569 (49.21%), Query Frame = 2
Query:  107 HELDSYMYQSVGHEAIDYLALAIGDVPLYKH-VISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQM-----------------EPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKR-IEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSH----------KEIYGS---EFCQNL-HLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNL----PARTCVETSENATILHCYINV--------DDRYNI-RSNMHIQSFSHWAPASIGPYSQAVSV---SPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHGNMIWDHLANMICYCVKSDNMMISQTL----FHSVICNLASGCLCNR-------VCWVTVSALPKAANVEWQAV 1633
             ELDS+M+Q+VGH+ IDY +  IG VPL++  ++  T+ + EL Y+       +DE+E+LF++L  VK   PDL A+S GAILS+YQRTRVEN+C RLGL+ +++LWQR Q EL+  M  C M                 +  +IK+AA+GL+E+ HLG  L  +   + K +  + ++ CGEGGE+ET+ LDAPFFQ   +E+I   ++  ++ E    +      +K++ +  +L +S             I+G+   +  QNL    ++T     E+++   L Q          T+ NK+ +  L+I   +S   +T     + I         ++  +L      ++ I+ + L + DM+ FG +N IY +F          P+R CV +       H  ++V         ++ N  +  +H+Q  S+WAP +IGPYSQ+  +   +  V  +SGQI + P+ + ++      + +L+L+H   +    G         ++  C  SD  ++   +    F+    N  S    ++       +  V +S LP+ A  E+  V
Sbjct:   41 QELDSFMFQTVGHDLIDYYSKCIG-VPLFRRSILRNTSNNVELNYTAT----QDDEIEELFELLRTVKDKIPDLEAVSVGAILSSYQRTRVENVCSRLGLVVLSYLWQRDQAELMGEM--CLMSKDVNNVENDTNSGNKFDARIIKVAAIGLNEK-HLGMSLPMMQPVLQKLNQLYQVHICGEGGEFETMVLDAPFFQHGYLELID--IVKCSDGEVHNAR------LKVKFQPRNLSKSFLLNQLDQLPVPSIFGNNWQDLTQNLPKQQAKTGEQRFENHMSNALPQ----------TTINKT-NDKLYISNLQSRKSETVEKQSEDI-------FTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLPPSRACVGSKCLPEDCHVQLSVVVDVKNTGKEKINKNKGGLHVQGRSYWAPCNIGPYSQSTWLNDDANQVSFISGQIGLVPQSMEILGTPLTDQIVLALQHFDTLCETIGAQ-----EKLLMTCYISDESVLDSVIKTWAFYCSNMNHRSDLWMDKSDDVEKCLVLVKISELPRGAVAEFGGV 570          

HSP 2 Score: 48.1358 bits (113), Expect = 8.374e-63
Identity = 21/34 (61.76%), Postives = 25/34 (73.53%), Query Frame = 1
Query:    4 ALISGGKDSTFNILECLNQGHELVALINLYPSPT 105
            ALISGGKDS +NI  CL   HEL+AL N+YP  +
Sbjct:    5 ALISGGKDSFYNIFHCLKNNHELIALGNIYPKES 38          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Nematostella
Match: EDO49488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG89])

HSP 1 Score: 193.741 bits (491), Expect = 5.755e-58
Identity = 97/216 (44.91%), Postives = 145/216 (67.13%), Query Frame = 2
Query:  101 RHHELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDK 748
            +  ELDSYM+QSVGH AI+  A A+ ++PLY+ +ISG+++     Y  N     +DEVEDLF++L  +++   +  AI+ GAILS+YQR RVE++C RLG+ S+++LW+R Q EL   ML   +  I+IK+A +GL  R HLG  +  +   + K ++E G+N CGEGGE+E+ TLD P F+KRI I  S V+  ++D +A V +L++  M L+DK
Sbjct:   37 KKDELDSYMFQSVGHNAINLYAEAM-ELPLYQRIISGSSVELGKNYKINK----DDEVEDLFELLKSIQEKM-EFDAIAVGAILSDYQRVRVEHVCTRLGIASLSYLWRRDQKELYTEMLSSGLVAIIIKVAVMGLSPRKHLGLTMEQLFPTVCKLNNEIGMNICGEGGEFESFTLDCPLFKKRIIIDESEVVIHSDDAFAEVGFLRLKAMHLEDK 246          

HSP 2 Score: 50.0618 bits (118), Expect = 5.755e-58
Identity = 21/36 (58.33%), Postives = 26/36 (72.22%), Query Frame = 1
Query:    1 AALISGGKDSTFNILECLNQGHELVALINLYPSPTS 108
             ALISGGKDS +N++EC+  GHE+VAL NL P    
Sbjct:    4 VALISGGKDSCYNMMECVRNGHEIVALANLKPEKKD 39          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Nematostella
Match: EDO49487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG88])

HSP 1 Score: 108.227 bits (269), Expect = 1.522e-26
Identity = 77/222 (34.68%), Postives = 111/222 (50.00%), Query Frame = 2
Query: 1082 LCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENATIL---HCYI----------NVD-DRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVA---WIHGNMIWDHLANMICYCVKSDNMMISQ------TLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQAVFSSNTVLSIGRYADS 1678
            L + DM  FG VN++Y +FF   N PAR CVE   N  IL    C +          N D D   +R  MH+QS S+WAPA+IGPYSQAV     +  VSG I + P  + L+DG    +  LSLRHV R+      HGN+   +  + +CY   + ++ +++      T     + + +S  +   + ++ V  LPK A VEWQ   S N   +   Y+ S
Sbjct:   23 LFIKDMKHFGKVNSVYKKFFPL-NPPARACVELDLNEDILLKMDCLVYNQPSAKDFDNDDFDCIPVREAMHVQSISYWAPANIGPYSQAVKAG-ALMFVSGNIGLWPASMKLVDGGVSTQAALSLRHVDRIVSAFSAHGNL--RNTLSGVCYLTCAQHIPVARKAWSLATRAKRALDDDSSDDVDGLMAYIVVPNLPKEALVEWQVACSQNAPRTWKHYSSS 240          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Medaka
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:105356906])

HSP 1 Score: 275.404 bits (703), Expect = 5.821e-83
Identity = 188/502 (37.45%), Postives = 270/502 (53.78%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSIS-----SILHILTSRSEL------DKTGNNPEKAIIESVTKTLAKMKSL---LVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENATIL---HCYIN------VDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRV--AWIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVI 1540
            ELDSYMYQ+VGH+AI+  A A+ D+PLY+H I G+++ T   YS   G    DEVEDL+Q+L LVK+    + A+S GAI+S+YQR RVEN+C RL L  +A+LW R+Q  LL  M+   +  ILIK+AALGLD   HLGK L  +   + K S+++G+N CGEGGEYET TLD P F+K+I I ++  +  + D +A V YL+  +M  + K+ DL       +GS  CQ           +I+  + EEL+      +   + + N  +S      IL  ++ RS          +G   E   IE   +TLA  K L   L  +      I+   L V  M  F  +N +Y Q F   N PAR CV+    A  L    C ++       + R+  R  +H+QS SHWAPA+IGPYSQA+ V+  V   +GQIA+ P  L L+ G    +  L   HV +V  A IH ++   H+    CY  +  ++ + +  + S+ 
Sbjct:   41 ELDSYMYQTVGHQAIELYAEAM-DLPLYRHTIQGSSLDTSRNYSETEG----DEVEDLYQLLHLVKEK-ECVEAVSVGAIMSDYQRVRVENVCSRLHLQPLAYLWHRNQESLLHEMISSDLHAILIKVAALGLDPEKHLGKSLADMEPYLKKLSEKYGVNICGEGGEYETFTLDCPLFKKKIVIDAAETVIHSADAFAPVGYLRFTKMHTEKKTGDLVAGALP-HGSCPCQ----------KAID-KMTEELEYADQAEDNPCKFTSNSDLSCQGGHEILPSVSQRSSRGFQWISGISGLQSEDTGIEG--QTLAAFKMLQKELESRCLAVKNIILVHLYVRSMQDFVALNEVYKQHF-TTNPPARVCVQAPLPAGHLLQMDCLLHNRPEHLEESRFCPREALHVQSLSHWAPANIGPYSQALRVNKEV-FCAGQIALVPCTLQLLQGSTHLQTQLVFSHVKKVLEATIH-SLTLAHVIQAHCYITRYQDIWLVRNAWKSLF 519          
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Medaka
Match: dph6 (diphthamine biosynthesis 6 [Source:NCBI gene;Acc:105356906])

HSP 1 Score: 268.47 bits (685), Expect = 1.203e-82
Identity = 178/452 (39.38%), Postives = 248/452 (54.87%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSIS-----SILHILTSRSEL------DKTGNNPEKAIIESVTKTLAKMKSL---LVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENATIL---HCYIN------VDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQ 1396
            ELDSYMYQ+VGH+AI+  A A+ D+PLY+H I G+++ T   YS   G    DEVEDL+Q+L LVK+    + A+S GAI+S+YQR RVEN+C RL L  +A+LW R+Q  LL  M+   +  ILIK+AALGLD   HLGK L  +   + K S+++G+N CGEGGEYET TLD P F+K+I I ++  +  + D +A V YL+  +M  + K+ DL       +GS  CQ           +I+  + EEL+      +   + + N  +S      IL  ++ RS          +G   E   IE   +TLA  K L   L  +      I+   L V  M  F  +N +Y Q F   N PAR CV+    A  L    C ++       + R+  R  +H+QS SHWAPA+IGPYSQA+ V+  V   +GQIA+ P  L L+ G  L 
Sbjct:   41 ELDSYMYQTVGHQAIELYAEAM-DLPLYRHTIQGSSLDTSRNYSETEG----DEVEDLYQLLHLVKEK-ECVEAVSVGAIMSDYQRVRVENVCSRLHLQPLAYLWHRNQESLLHEMISSDLHAILIKVAALGLDPEKHLGKSLADMEPYLKKLSEKYGVNICGEGGEYETFTLDCPLFKKKIVIDAAETVIHSADAFAPVGYLRFTKMHTEKKTGDLVAGALP-HGSCPCQ----------KAID-KMTEELEYADQAEDNPCKFTSNSDLSCQGGHEILPSVSQRSSRGFQWISGISGLQSEDTGIEG--QTLAAFKMLQKELESRCLAVKNIILVHLYVRSMQDFVALNEVYKQHF-TTNPPARVCVQAPLPAGHLLQMDCLLHNRPEHLEESRFCPREALHVQSLSHWAPANIGPYSQALRVNKEV-FCAGQIALVPCTLQLLQGPLLH 470          
BLAST of Diphthine--ammonia ligase-like Protein vs. Planmine SMEST
Match: SMESG000003033.1 (SMESG000003033.1)

HSP 1 Score: 1182.16 bits (3057), Expect = 0.000e+0
Identity = 568/568 (100.00%), Postives = 568/568 (100.00%), Query Frame = 2
Query:  110 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENATILHCYINVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQAVFSSNTVLSIGRYADSDCKNTIIFSTHSDIIPPSHDRAVIQINAYLESNVVMKSGSIQIKF 1813
            ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENATILHCYINVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQAVFSSNTVLSIGRYADSDCKNTIIFSTHSDIIPPSHDRAVIQINAYLESNVVMKSGSIQIKF
Sbjct:   43 ELDSYMYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEVEDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLWQRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSDEFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKIIEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQIYDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAKMKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCVETSENATILHCYINVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPHVCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHGNMIWDHLANMICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEWQAVFSSNTVLSIGRYADSDCKNTIIFSTHSDIIPPSHDRAVIQINAYLESNVVMKSGSIQIKF 610          

HSP 2 Score: 76.6406 bits (187), Expect = 2.235e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 1
Query:    1 AALISGGKDSTFNILECLNQGHELVALINLYPSPTS 108
            AALISGGKDSTFNILECLNQGHELVALINLYPSPTS
Sbjct:    4 AALISGGKDSTFNILECLNQGHELVALINLYPSPTS 39          
The following BLAST results are available for this feature:
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DPH61.040e-6248.25diphthamine biosynthesis 6 [Source:HGNC Symbol;Acc... [more]
DPH69.385e-4949.14diphthamine biosynthesis 6 [Source:HGNC Symbol;Acc... [more]
DPH69.892e-3547.62diphthamine biosynthesis 6 [Source:HGNC Symbol;Acc... [more]
DPH61.684e-1837.74diphthamine biosynthesis 6 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
E01A2.52.686e-5445.07Diphthine--ammonia ligase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG15788.898e-6048.36gene:FBgn0030336 transcript:FBtr0345160[more]
CG15788.898e-6048.36gene:FBgn0030336 transcript:FBtr0339749[more]
CG15788.898e-6048.36gene:FBgn0030336 transcript:FBtr0073607[more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dph61.118e-6935.85diphthamine biosynthesis 6 [Source:NCBI gene;Acc:5... [more]
dph64.588e-5845.79diphthamine biosynthesis 6 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DPH61.120e-8335.82diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
DPH61.576e-8335.82diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dph68.678e-5947.89diphthamine biosynthesis 6 [Source:MGI Symbol;Acc:... [more]
Dph69.584e-5947.89diphthamine biosynthesis 6 [Source:MGI Symbol;Acc:... [more]
Dph61.682e-4151.75diphthamine biosynthesis 6 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9USQ7|DPH6_SCHPO2.643e-7934.52Diphthine--ammonia ligase OS=Schizosaccharomyces p... [more]
sp|Q2HJF5|DPH6_BOVIN1.084e-6449.57Diphthine--ammonia ligase OS=Bos taurus OX=9913 GN... [more]
sp|Q7L8W6|DPH6_HUMAN4.994e-6248.25Diphthine--ammonia ligase OS=Homo sapiens OX=9606 ... [more]
sp|Q12429|DPH6_YEAST4.614e-6129.00Diphthine--ammonia ligase OS=Saccharomyces cerevis... [more]
sp|Q5M9F5|DPH6_RAT5.260e-5847.89Diphthine--ammonia ligase OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Y1KW513.399e-9437.50Diphthami_syn_2 domain-containing protein OS=Photi... [more]
A0A5N4APE34.541e-9437.57Uncharacterized protein OS=Photinus pyralis OX=705... [more]
D2A2B01.353e-9237.15Diphthine--ammonia ligase-like Protein OS=Triboliu... [more]
A0A210Q5264.502e-9237.68Diphthine--ammonia ligase OS=Mizuhopecten yessoens... [more]
R7V4938.293e-9135.48Diphthami_syn_2 domain-containing protein (Fragmen... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dph61.661e-8335.81diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
dph62.006e-8335.81diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
dph63.322e-8335.81diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
dph69.690e-8034.91diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
dph61.866e-7838.98diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006436.14.796e-6451.40pep scaffold:Pmarinus_7.0:GL476470:1048530:1060018... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DPH68.374e-6329.00Diphthamide synthetase; catalyzes the last amidati... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO494885.755e-5844.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494871.522e-2634.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dph65.821e-8337.45diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
dph61.203e-8239.38diphthamine biosynthesis 6 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Diphthine--ammonia ligase-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000003033.12.235e-14100.00SMESG000003033.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015541 ID=SMED30015541|Name=Diphthine--ammonia ligase-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1868bp
GCAGCTTTAATTAGTGGTGGTAAGGATAGTACTTTTAATATTTTGGAATG
CTTAAATCAAGGTCATGAACTAGTAGCTTTAATAAATTTATATCCTTCAC
CGACATCATGAGCTTGATAGTTATATGTACCAATCAGTTGGACATGAAGC
AATAGACTATTTAGCATTAGCTATTGGCGATGTTCCTTTATACAAGCATG
TCATAAGCGGAACAGCCATTTCAACTGAATTAAAATATTCATTCAACAAT
GGGTATGATAGTAATGATGAAGTTGAAGATTTATTTCAAATCCTTTCTTT
GGTTAAGAAAGATTTCCCAGATTTGACAGCAATATCGAGTGGAGCAATTT
TGTCTAACTATCAAAGAACGCGGGTTGAAAATATCTGCGAAAGATTAGGT
TTAATATCAATGGCATTTCTGTGGCAACGTTCACAGGTGGAATTACTGCA
ATCAATGCTCCGATGCCAAATGGAACCAATTCTGATCAAGATCGCAGCTC
TTGGTTTGGATGAACGCGCACATTTAGGCAAACCATTGCGATGTATTTCC
AATGATATATTGAAGAAGTCCGATGAATTCGGATTAAATCCATGCGGTGA
AGGAGGCGAATACGAGACATTAACTCTAGATGCTCCATTTTTCCAGAAGC
GTATTGAAATAATATCCAGTCGAGTTATAACACTGAATGAAGATGAATAT
GCAGCCGTGAAATATTTGAAAATTATCGAAATGAAATTGCAGGACAAATC
TCCTGACCTGTATCGAAGCCATAAAGAAATTTACGGTTCTGAATTTTGCC
AAAATTTACACTTACACTCACGTACTGATATGAATTCCATCGAGAGTAAT
CTACGTGAAGAATTGGATCAAATTTATGATCAATTTAACGGATCAATAGA
AACGTCCAGGAATAAATCAATAAGCTCCATATTGCACATCCTGACATCTA
GATCAGAGCTTGATAAAACTGGGAATAATCCCGAGAAAGCTATAATTGAA
TCTGTCACTAAAACACTAGCCAAAATGAAATCGTTACTAGTCGAGAAAGG
ATTTACAAAAGATCAAATAGTTTATTCTGTGTTGTGTGTTTCGGACATGA
ATCAGTTTGGTACTGTCAACAACATTTATACTCAGTTCTTCCATAGAGAT
AATTTACCTGCTCGCACGTGTGTTGAGACCAGTGAGAACGCCACCATACT
CCATTGTTACATAAATGTCGATGATAGGTATAATATAAGATCAAACATGC
ACATCCAATCATTCTCACATTGGGCCCCAGCAAGCATAGGGCCTTACAGT
CAGGCTGTATCTGTGTCGCCCCATGTATGCTTGGTATCAGGGCAAATTGC
CATGCATCCTGAAGATTTGACTTTGATTGATGGGGATTTCTTACAAGAAT
GCTTGCTGAGTTTGAGACATGTGACAAGAGTGGCTTGGATACACGGAAAC
ATGATTTGGGATCATCTGGCCAACATGATATGCTATTGTGTTAAATCGGA
TAATATGATGATCTCGCAAACTCTTTTCCATTCTGTCATTTGTAATTTGG
CCAGTGGATGTTTGTGCAATCGGGTGTGTTGGGTAACGGTTTCTGCTCTC
CCTAAGGCTGCCAATGTCGAATGGCAAGCTGTTTTCTCCTCGAATACCGT
TCTATCGATCGGTCGCTATGCAGATTCAGATTGTAAGAACACCATAATTT
TCTCCACTCATTCTGACATAATACCACCAAGTCATGATCGCGCGGTTATC
CAGATCAACGCATATCTAGAATCAAATGTTGTCATGAAATCTGGATCCAT
TCAGATCAAATTTTGAGTCACATTTTTTTATTAATAAATTTTGTTTTTTA
TTTTCATTAAGCTTTCAG
back to top

protein sequence of SMED30015541-orf-1

>SMED30015541-orf-1 ID=SMED30015541-orf-1|Name=SMED30015541-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=564bp
MYQSVGHEAIDYLALAIGDVPLYKHVISGTAISTELKYSFNNGYDSNDEV
EDLFQILSLVKKDFPDLTAISSGAILSNYQRTRVENICERLGLISMAFLW
QRSQVELLQSMLRCQMEPILIKIAALGLDERAHLGKPLRCISNDILKKSD
EFGLNPCGEGGEYETLTLDAPFFQKRIEIISSRVITLNEDEYAAVKYLKI
IEMKLQDKSPDLYRSHKEIYGSEFCQNLHLHSRTDMNSIESNLREELDQI
YDQFNGSIETSRNKSISSILHILTSRSELDKTGNNPEKAIIESVTKTLAK
MKSLLVEKGFTKDQIVYSVLCVSDMNQFGTVNNIYTQFFHRDNLPARTCV
ETSENATILHCYINVDDRYNIRSNMHIQSFSHWAPASIGPYSQAVSVSPH
VCLVSGQIAMHPEDLTLIDGDFLQECLLSLRHVTRVAWIHGNMIWDHLAN
MICYCVKSDNMMISQTLFHSVICNLASGCLCNRVCWVTVSALPKAANVEW
QAVFSSNTVLSIGRYADSDCKNTIIFSTHSDIIPPSHDRAVIQINAYLES
NVVMKSGSIQIKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035959RutC-like_sf
IPR030662DPH6/MJ0570
IPR014729Rossmann-like_a/b/a_fold
IPR013813Endoribo_LPSP/chorism_mut-like
IPR002761Diphthami_syn_dom
IPR006175YjgF/YER057c/UK114
Vocabulary: molecular function
TermDefinition
GO:0016874ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.1490.10coord: 119..216
e-value: 4.2E-24
score: 86.3
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 1..201
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 1..117
e-value: 1.5E-27
score: 98.1
IPR035959RutC-like superfamilyGENE3DG3DSA:3.30.1330.40coord: 270..364
e-value: 7.2E-12
score: 46.9
IPR035959RutC-like superfamilyGENE3DG3DSA:3.30.1330.40coord: 365..505
e-value: 2.4E-20
score: 74.8
IPR035959RutC-like superfamilySUPERFAMILYSSF55298YjgF-likecoord: 288..354
IPR035959RutC-like superfamilySUPERFAMILYSSF55298YjgF-likecoord: 374..505
IPR002761Diphthamide synthase domainPFAMPF01902Diphthami_syn_2coord: 32..197
e-value: 1.0E-29
score: 103.6
IPR002761Diphthamide synthase domainTIGRFAMTIGR00290TIGR00290coord: 1..199
e-value: 7.6E-45
score: 151.3
IPR002761Diphthamide synthase domainCDDcd01994Alpha_ANH_like_IVcoord: 1..173
e-value: 1.02781E-57
score: 189.355
IPR006175YjgF/YER057c/UK114 familyPFAMPF01042Ribonuc_L-PSPcoord: 282..353
e-value: 4.3E-9
score: 36.4
IPR030662Diphthine--ammonia ligase/Uncharacterised protein MJ0570PANTHERPTHR12196DOMAIN OF UNKNOWN FUNCTION 71 DUF71 -CONTAINING PROTEINcoord: 1..508