MRG-1

Overview
NameMRG-1 (AFD29601.1)
Smed IDSMED30015533
Length (bp)1363
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MRG-1 (SMED30015533) t-SNE clustered cells

Violin plots show distribution of expression levels for MRG-1 (SMED30015533) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MRG-1 (SMED30015533) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MRG-1 (SMED30015533) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015533

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015533h1SMcG0001635 SmedASXL_006373SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015533h1SMcG0001635 SmedASXL_006373SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30015533h1SMcG0001635 dd_Smed_v4_5890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015533h1SMcG0001635 dd_Smed_v4_5890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015533h1SMcG0001635 dd_Smed_v4_5890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015533h1SMcG0001635 dd_Smed_v4_5890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015533h1SMcG0001635 dd_Smed_v4_5890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015533h1SMcG0001635 dd_Smed_v4_5890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015533h1SMcG0001635 dd_Smed_v4_5890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015533h1SMcG0001635 SMED_31964_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30015533h1SMcG0001635 SMED_31964_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MRG-1 vs. Ensembl Human
Match: MORF4L1 (mortality factor 4 like 1 [Source:HGNC Symbol;Acc:HGNC:16989])

HSP 1 Score: 126.716 bits (317), Expect = 3.217e-33
Identity = 71/196 (36.22%), Postives = 109/196 (55.61%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV + +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +VD +L  Y ++ +  R    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS +YG+ +LLRL V I  +++YT  D  S+  L + +  F+++L  N    F   DY  A  +Y R+A+
Sbjct:   52 VDPTVENEETFMNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKS-RGNTDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYAEIL-ADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV 235          
BLAST of MRG-1 vs. Ensembl Human
Match: MORF4L1 (mortality factor 4 like 1 [Source:HGNC Symbol;Acc:HGNC:16989])

HSP 1 Score: 126.716 bits (317), Expect = 3.217e-33
Identity = 71/196 (36.22%), Postives = 109/196 (55.61%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV + +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +VD +L  Y ++ +  R    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS +YG+ +LLRL V I  +++YT  D  S+  L + +  F+++L  N    F   DY  A  +Y R+A+
Sbjct:   52 VDPTVENEETFMNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKS-RGNTDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYAEIL-ADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV 235          
BLAST of MRG-1 vs. Ensembl Human
Match: MORF4L2 (mortality factor 4 like 2 [Source:HGNC Symbol;Acc:HGNC:16849])

HSP 1 Score: 126.331 bits (316), Expect = 4.796e-33
Identity = 66/181 (36.46%), Postives = 103/181 (56.91%), Query Frame = 3
Query:  804 NVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            N   +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS +YG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+A+Y R+A+
Sbjct:   66 NRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL 237          
BLAST of MRG-1 vs. Ensembl Human
Match: MORF4L2 (mortality factor 4 like 2 [Source:HGNC Symbol;Acc:HGNC:16849])

HSP 1 Score: 126.331 bits (316), Expect = 1.677e-32
Identity = 66/181 (36.46%), Postives = 103/181 (56.91%), Query Frame = 3
Query:  804 NVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            N   +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS +YG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+A+Y R+A+
Sbjct:  117 NRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL 288          
BLAST of MRG-1 vs. Ensembl Human
Match: MORF4L2 (mortality factor 4 like 2 [Source:HGNC Symbol;Acc:HGNC:16849])

HSP 1 Score: 126.331 bits (316), Expect = 1.677e-32
Identity = 66/181 (36.46%), Postives = 103/181 (56.91%), Query Frame = 3
Query:  804 NVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            N   +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS +YG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+A+Y R+A+
Sbjct:  117 NRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL 288          
BLAST of MRG-1 vs. Ensembl Celegans
Match: mrg-1 (MRG (Mortality factor-Related Gene) related [Source:UniProtKB/TrEMBL;Acc:A7DTF0])

HSP 1 Score: 58.9214 bits (141), Expect = 2.645e-9
Identity = 54/209 (25.84%), Postives = 93/209 (44.50%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVE---------------GMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDM---------------SSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFK-LEDYITATADYTRRAMC 1349
            +K    + LR  L DD+DL+ R   ++ +P   SVD ++  Y      ++     NE     + D+  E+ E               G+  YFN ++G  LLYKFER QY ++V     +K +               S  YG ++ LR+L  +   +  T+ +   I+ +   +   I FL+ N  ++++   DY  A+ DY RR++ 
Sbjct:  126 MKVELPKPLRKILIDDYDLVCRYF-INIVPHEYSVDQIIEDY------IKTIPVSNEQMRTVD-DLLIEYEEADIKITNLALICTARGLVDYFNVTLGYQLLYKFERPQYNDLVKKRAMEKGIDITNPTALQDSGFRPSQEYGIVHFLRMLAKLPDYLKLTQWNDHVINRIMIGVHDLIVFLNKNHGKYYRGSSDYQGASNDYYRRSLA 326          
BLAST of MRG-1 vs. Ensembl Celegans
Match: mrg-1 (MRG (Mortality factor-Related Gene) related [Source:UniProtKB/TrEMBL;Acc:A7DTF0])

HSP 1 Score: 56.225 bits (134), Expect = 2.012e-8
Identity = 55/211 (26.07%), Postives = 94/211 (44.55%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVE---------------GMRKYFNTSIGS--LLLYKFERQQYFEVVNTNESKKDM---------------SSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFK-LEDYITATADYTRRAMC 1349
            +K    + LR  L DD+DL+ R   ++ +P   SVD ++  Y      ++     NE     + D+  E+ E               G+  YFN ++GS   LLYKFER QY ++V     +K +               S  YG ++ LR+L  +   +  T+ +   I+ +   +   I FL+ N  ++++   DY  A+ DY RR++ 
Sbjct:  126 MKVELPKPLRKILIDDYDLVCRYF-INIVPHEYSVDQIIEDY------IKTIPVSNEQMRTVD-DLLIEYEEADIKITNLALICTARGLVDYFNVTLGSSYQLLYKFERPQYNDLVKKRAMEKGIDITNPTALQDSGFRPSQEYGIVHFLRMLAKLPDYLKLTQWNDHVINRIMIGVHDLIVFLNKNHGKYYRGSSDYQGASNDYYRRSLA 328          
BLAST of MRG-1 vs. Ensembl Fly
Match: MRG15 (gene:FBgn0027378 transcript:FBtr0083125)

HSP 1 Score: 107.457 bits (267), Expect = 4.710e-25
Identity = 56/176 (31.82%), Postives = 96/176 (54.55%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRA 1343
            +K    + L+ +L DDW  + R+ +L  LP +++V  +  +Y +H + ++      E   N       + ++G+ +YFN  +GS LLYKFER QY +V+  +     +S +YGS +LLRL V +  ++SY+  D  S+  L   +Q F++FL  N   FF + ++I    +Y R A
Sbjct:  256 VKIKIPDELKHYLTDDWYAVVREHKLLELPAKVTVQQISEQYLAHKKSVKSTSASKEVAIN-------DVLDGIVEYFNVMLGSQLLYKFERTQYADVMQKHPDT-PLSELYGSFHLLRLFVRLGSMLSYSALDQQSMQNLLTHVQDFLKFLVKNSSIFFSMSNFINVDPEYVRNA 423          

HSP 2 Score: 86.2705 bits (212), Expect = 5.790e-18
Identity = 31/63 (49.21%), Postives = 51/63 (80.95%), Query Frame = 3
Query:  120 GEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKEL 305
            GE++LC+HGPL+YEAK ++ + +++ + Y IHY GW+K WDEWV + R+LK+N+  +K+++EL
Sbjct:   25 GERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNVKRRQEL 87          
BLAST of MRG-1 vs. Ensembl Fly
Match: MRG15 (gene:FBgn0027378 transcript:FBtr0333921)

HSP 1 Score: 107.457 bits (267), Expect = 4.864e-25
Identity = 56/176 (31.82%), Postives = 96/176 (54.55%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRA 1343
            +K    + L+ +L DDW  + R+ +L  LP +++V  +  +Y +H + ++      E   N       + ++G+ +YFN  +GS LLYKFER QY +V+  +     +S +YGS +LLRL V +  ++SY+  D  S+  L   +Q F++FL  N   FF + ++I    +Y R A
Sbjct:  261 VKIKIPDELKHYLTDDWYAVVREHKLLELPAKVTVQQISEQYLAHKKSVKSTSASKEVAIN-------DVLDGIVEYFNVMLGSQLLYKFERTQYADVMQKHPDT-PLSELYGSFHLLRLFVRLGSMLSYSALDQQSMQNLLTHVQDFLKFLVKNSSIFFSMSNFINVDPEYVRNA 428          

HSP 2 Score: 86.2705 bits (212), Expect = 5.964e-18
Identity = 31/63 (49.21%), Postives = 51/63 (80.95%), Query Frame = 3
Query:  120 GEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKEL 305
            GE++LC+HGPL+YEAK ++ + +++ + Y IHY GW+K WDEWV + R+LK+N+  +K+++EL
Sbjct:   25 GERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNVKRRQEL 87          
BLAST of MRG-1 vs. Ensembl Zebrafish
Match: morf4l1 (mortality factor 4 like 1 [Source:ZFIN;Acc:ZDB-GENE-040718-348])

HSP 1 Score: 132.88 bits (333), Expect = 7.372e-35
Identity = 76/196 (38.78%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +VD VL  Y ++ +  R    + E   N       E V G+R+YFN  +G+ LLYKFER QY E++  N     MS IYG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  134 VDPTVESEETFINRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKNVDAVLEDYANYKKS-RGNSDNKEYAVN-------EVVAGIREYFNVMLGTQLLYKFERPQYAEIL-ANHPDTSMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLSYLQDFLKYLVKNSSSLFSASDYEVAPPEYHRKAV 317          

HSP 2 Score: 70.0922 bits (170), Expect = 7.487e-13
Identity = 31/77 (40.26%), Postives = 49/77 (63.64%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D KPK+  G+         +   +C++I  +  +++Y IHY GWNK WDEWV ++R+LK+ ++ ++KQKELQ
Sbjct:    1 MAPKQDPKPKFQEGKMRF------VSSTRCVKINIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDSNLQKQKELQ 71          
BLAST of MRG-1 vs. Ensembl Zebrafish
Match: morf4l1 (mortality factor 4 like 1 [Source:ZFIN;Acc:ZDB-GENE-040718-348])

HSP 1 Score: 132.88 bits (333), Expect = 7.372e-35
Identity = 76/196 (38.78%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +VD VL  Y ++ +  R    + E   N       E V G+R+YFN  +G+ LLYKFER QY E++  N     MS IYG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  134 VDPTVESEETFINRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKNVDAVLEDYANYKKS-RGNSDNKEYAVN-------EVVAGIREYFNVMLGTQLLYKFERPQYAEIL-ANHPDTSMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLSYLQDFLKYLVKNSSSLFSASDYEVAPPEYHRKAV 317          

HSP 2 Score: 70.0922 bits (170), Expect = 7.487e-13
Identity = 31/77 (40.26%), Postives = 49/77 (63.64%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D KPK+  G+         +   +C++I  +  +++Y IHY GWNK WDEWV ++R+LK+ ++ ++KQKELQ
Sbjct:    1 MAPKQDPKPKFQEGKMRF------VSSTRCVKINIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDSNLQKQKELQ 71          
BLAST of MRG-1 vs. Ensembl Zebrafish
Match: morf4l1 (mortality factor 4 like 1 [Source:ZFIN;Acc:ZDB-GENE-040718-348])

HSP 1 Score: 132.88 bits (333), Expect = 1.082e-34
Identity = 76/196 (38.78%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +VD VL  Y ++ +  R    + E   N       E V G+R+YFN  +G+ LLYKFER QY E++  N     MS IYG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  140 VDPTVESEETFINRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKNVDAVLEDYANYKKS-RGNSDNKEYAVN-------EVVAGIREYFNVMLGTQLLYKFERPQYAEIL-ANHPDTSMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLSYLQDFLKYLVKNSSSLFSASDYEVAPPEYHRKAV 323          

HSP 2 Score: 108.227 bits (269), Expect = 7.314e-26
Identity = 43/77 (55.84%), Postives = 61/77 (79.22%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D KPK+  GE++LC+HGPLLYEAKC++I  +  +++Y IHY GWNK WDEWV ++R+LK+ ++ ++KQKELQ
Sbjct:    1 MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKINIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDSNLQKQKELQ 77          
BLAST of MRG-1 vs. Ensembl Xenopus
Match: cog3 (component of oligomeric golgi complex 3 [Source:Xenbase;Acc:XB-GENE-855843])

HSP 1 Score: 125.946 bits (315), Expect = 1.534e-32
Identity = 71/196 (36.22%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +V+ VL  Y ++ +  R    + E   N       E V G+++YFN  +G+ LLYKFER QY +++  +     MS +YG+ +LLRL V I  ++SYT  D  S+  L + +  F+++L  N    F   DY  A  +Y R+A+
Sbjct:   96 IDPTVESEETFMNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFNLPAKKNVETVLEEYATYKKS-RGNTDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYADIL-ADHPDAPMSQVYGAPHLLRLFVRIGAMLSYTPLDEKSLALLLNYLHDFLKYLAKNSSLLFSASDYEVAPPEYHRKAV 279          

HSP 2 Score: 51.9878 bits (123), Expect = 7.303e-7
Identity = 19/33 (57.58%), Postives = 27/33 (81.82%), Query Frame = 3
Query:  210 HYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            H+ GWNK WDEWV ++R+LK+ +  ++KQKELQ
Sbjct:    1 HWLGWNKNWDEWVPESRVLKYVDTNLQKQKELQ 33          
BLAST of MRG-1 vs. Ensembl Xenopus
Match: cog3 (component of oligomeric golgi complex 3 [Source:Xenbase;Acc:XB-GENE-855843])

HSP 1 Score: 125.561 bits (314), Expect = 4.578e-32
Identity = 71/196 (36.22%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +V+ VL  Y ++ +  R    + E   N       E V G+++YFN  +G+ LLYKFER QY +++  +     MS +YG+ +LLRL V I  ++SYT  D  S+  L + +  F+++L  N    F   DY  A  +Y R+A+
Sbjct:  122 IDPTVESEETFMNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFNLPAKKNVETVLEEYATYKKS-RGNTDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYADIL-ADHPDAPMSQVYGAPHLLRLFVRIGAMLSYTPLDEKSLALLLNYLHDFLKYLAKNSSLLFSASDYEVAPPEYHRKAV 305          

HSP 2 Score: 64.3142 bits (155), Expect = 7.707e-11
Identity = 23/51 (45.10%), Postives = 39/51 (76.47%), Query Frame = 3
Query:  159 EAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            ++ C+++  +  +++Y IHY GWNK WDEWV ++R+LK+ +  ++KQKELQ
Sbjct:    9 KSHCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQKELQ 59          
BLAST of MRG-1 vs. Ensembl Xenopus
Match: cog3 (component of oligomeric golgi complex 3 [Source:Xenbase;Acc:XB-GENE-855843])

HSP 1 Score: 125.176 bits (313), Expect = 7.509e-32
Identity = 71/196 (36.22%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +V+ VL  Y ++ +  R    + E   N       E V G+++YFN  +G+ LLYKFER QY +++  +     MS +YG+ +LLRL V I  ++SYT  D  S+  L + +  F+++L  N    F   DY  A  +Y R+A+
Sbjct:  140 IDPTVESEETFMNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFNLPAKKNVETVLEEYATYKKS-RGNTDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYADIL-ADHPDAPMSQVYGAPHLLRLFVRIGAMLSYTPLDEKSLALLLNYLHDFLKYLAKNSSLLFSASDYEVAPPEYHRKAV 323          

HSP 2 Score: 105.916 bits (263), Expect = 6.032e-25
Identity = 41/77 (53.25%), Postives = 60/77 (77.92%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D +PK+  GE++LC+HGPLLYEAKC+++  +  +++Y IHY GWNK WDEWV ++R+LK+ +  ++KQKELQ
Sbjct:    1 MAPKQDPRPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQKELQ 77          
BLAST of MRG-1 vs. Ensembl Xenopus
Match: cog3 (component of oligomeric golgi complex 3 [Source:Xenbase;Acc:XB-GENE-855843])

HSP 1 Score: 124.79 bits (312), Expect = 1.578e-31
Identity = 71/196 (36.22%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +V+ VL  Y ++ +  R    + E   N       E V G+++YFN  +G+ LLYKFER QY +++  +     MS +YG+ +LLRL V I  ++SYT  D  S+  L + +  F+++L  N    F   DY  A  +Y R+A+
Sbjct:  149 IDPTVESEETFMNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFNLPAKKNVETVLEEYATYKKS-RGNTDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYADIL-ADHPDAPMSQVYGAPHLLRLFVRIGAMLSYTPLDEKSLALLLNYLHDFLKYLAKNSSLLFSASDYEVAPPEYHRKAV 332          

HSP 2 Score: 65.4698 bits (158), Expect = 3.813e-11
Identity = 25/54 (46.30%), Postives = 40/54 (74.07%), Query Frame = 3
Query:  150 LLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            +L  A C+++  +  +++Y IHY GWNK WDEWV ++R+LK+ +  ++KQKELQ
Sbjct:   33 ILLIAHCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQKELQ 86          
BLAST of MRG-1 vs. Ensembl Xenopus
Match: cog3 (component of oligomeric golgi complex 3 [Source:Xenbase;Acc:XB-GENE-855843])

HSP 1 Score: 124.79 bits (312), Expect = 1.593e-31
Identity = 71/196 (36.22%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +V+ VL  Y ++ +  R    + E   N       E V G+++YFN  +G+ LLYKFER QY +++  +     MS +YG+ +LLRL V I  ++SYT  D  S+  L + +  F+++L  N    F   DY  A  +Y R+A+
Sbjct:  150 IDPTVESEETFMNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFNLPAKKNVETVLEEYATYKKS-RGNTDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYADIL-ADHPDAPMSQVYGAPHLLRLFVRIGAMLSYTPLDEKSLALLLNYLHDFLKYLAKNSSLLFSASDYEVAPPEYHRKAV 333          

HSP 2 Score: 94.3597 bits (233), Expect = 7.927e-21
Identity = 35/63 (55.56%), Postives = 52/63 (82.54%), Query Frame = 3
Query:  123 EKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            E++LC+HGPLLYEAKC+++  +  +++Y IHY GWNK WDEWV ++R+LK+ +  ++KQKELQ
Sbjct:   25 ERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQKELQ 87          
BLAST of MRG-1 vs. Ensembl Mouse
Match: Morf4l2 (mortality factor 4 like 2 [Source:MGI Symbol;Acc:MGI:1927167])

HSP 1 Score: 128.642 bits (322), Expect = 1.962e-33
Identity = 67/177 (37.85%), Postives = 102/177 (57.63%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS IYG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+ADY R+A+
Sbjct:  121 VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL 288          
BLAST of MRG-1 vs. Ensembl Mouse
Match: Morf4l2 (mortality factor 4 like 2 [Source:MGI Symbol;Acc:MGI:1927167])

HSP 1 Score: 128.642 bits (322), Expect = 1.962e-33
Identity = 67/177 (37.85%), Postives = 102/177 (57.63%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS IYG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+ADY R+A+
Sbjct:  121 VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL 288          
BLAST of MRG-1 vs. Ensembl Mouse
Match: Morf4l2 (mortality factor 4 like 2 [Source:MGI Symbol;Acc:MGI:1927167])

HSP 1 Score: 128.642 bits (322), Expect = 1.962e-33
Identity = 67/177 (37.85%), Postives = 102/177 (57.63%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS IYG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+ADY R+A+
Sbjct:  121 VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL 288          
BLAST of MRG-1 vs. Ensembl Mouse
Match: Morf4l2 (mortality factor 4 like 2 [Source:MGI Symbol;Acc:MGI:1927167])

HSP 1 Score: 128.642 bits (322), Expect = 1.962e-33
Identity = 67/177 (37.85%), Postives = 102/177 (57.63%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS IYG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+ADY R+A+
Sbjct:  121 VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL 288          
BLAST of MRG-1 vs. Ensembl Mouse
Match: Morf4l2 (mortality factor 4 like 2 [Source:MGI Symbol;Acc:MGI:1927167])

HSP 1 Score: 128.642 bits (322), Expect = 1.962e-33
Identity = 67/177 (37.85%), Postives = 102/177 (57.63%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS IYG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+ADY R+A+
Sbjct:  121 VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL 288          
BLAST of MRG-1 vs. UniProt/SwissProt
Match: sp|Q9R0Q4|MO4L2_MOUSE (Mortality factor 4-like protein 2 OS=Mus musculus OX=10090 GN=Morf4l2 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.372e-32
Identity = 67/177 (37.85%), Postives = 102/177 (57.63%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS IYG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+ADY R+A+
Sbjct:  121 VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL 288          
BLAST of MRG-1 vs. UniProt/SwissProt
Match: sp|Q6QI89|MO4L2_RAT (Mortality factor 4-like protein 2 OS=Rattus norvegicus OX=10116 GN=Morf4l2 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.444e-32
Identity = 67/177 (37.85%), Postives = 102/177 (57.63%), Query Frame = 3
Query:  816 LKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS IYG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+ADY R+A+
Sbjct:  121 VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL 288          
BLAST of MRG-1 vs. UniProt/SwissProt
Match: sp|Q4R578|MO4L2_MACFA (Mortality factor 4-like protein 2 OS=Macaca fascicularis OX=9541 GN=MORF4L2 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 7.735e-32
Identity = 66/181 (36.46%), Postives = 103/181 (56.91%), Query Frame = 3
Query:  804 NVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            N   +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS +YG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+A+Y R+A+
Sbjct:  117 NRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL 288          
BLAST of MRG-1 vs. UniProt/SwissProt
Match: sp|Q5R905|MO4L2_PONAB (Mortality factor 4-like protein 2 OS=Pongo abelii OX=9601 GN=MORF4L2 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 8.056e-32
Identity = 66/181 (36.46%), Postives = 103/181 (56.91%), Query Frame = 3
Query:  804 NVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            N   +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS +YG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+A+Y R+A+
Sbjct:  117 NRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL 288          
BLAST of MRG-1 vs. UniProt/SwissProt
Match: sp|A5A6J5|MO4L2_PANTR (Mortality factor 4-like protein 2 OS=Pan troglodytes OX=9598 GN=MORF4L2 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 8.056e-32
Identity = 66/181 (36.46%), Postives = 103/181 (56.91%), Query Frame = 3
Query:  804 NVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            N   +K    E L+ WL +DWDL+TRQ +L +LP + +VD +L  Y ++C+  +    + E   N       E V G+++YFN  +G+ LLYKFER QY E++  +     MS +YG+ +LLRL V I  +++YT  D  S+  L   +  F+++L  N    F   DY  A+A+Y R+A+
Sbjct:  117 NRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEY-ANCKKSQGNVDNKEYAVN-------EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDA-PMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL 288          
BLAST of MRG-1 vs. TrEMBL
Match: H9CXT0 (MRG-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 423/423 (100.00%), Postives = 423/423 (100.00%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYXXXXXXXXXXXXXXXXXRKSSRSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTDAGTSVVSEELLXXXXXXXXXXXXXXXXXXXXXXXXNSEISVDKSLVTEEKSTIEDISLTNNEAXXXXXXXXXXXXXXXRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAMC 1349
            MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYKESRKKKDNRKKMINEKRKSSRSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTDAGTSVVSEELLDDQKSSIKDKSVSSKTRTRKRRLSNSEISVDKSLVTEEKSTIEDISLTNNEATNSNKSTNSSKSKKSRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAMC
Sbjct:    1 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYKESRKKKDNRKKMINEKRKSSRSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTDAGTSVVSEELLDDQKSSIKDKSVSSKTRTRKRRLSNSEISVDKSLVTEEKSTIEDISLTNNEATNSNKSTNSSKSKKSRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAMC 423          
BLAST of MRG-1 vs. TrEMBL
Match: A0A0A1XPQ2 (NuA4 complex subunit EAF3 homolog OS=Zeugodacus cucurbitae OX=28588 GN=MRG15 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.567e-48
Identity = 120/414 (28.99%), Postives = 211/414 (50.97%), Query Frame = 3
Query:  108 KYSIGEKLLCYHGPLLYEAKCIE--IQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYXXXXXXXXXXXXXXXXXRKSSRSSQDKIRFMGSASETS-NRSFGESEDGKASKITTED-ENLENKTDAGTSVVSEELLXXXXXXXXXXXXXXXXXXXXXXXXNSEISVDKSLVTEEKSTIEDISLTNNEAXXXXXXXXXXXXXXXRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTR 1337
            K++ GEK+LC+HGPL+YEAK ++  I +  +I+Y IHY GWNK WDEWV + R+LK+NEA +++QKE+   +  +  K         +   +  +S+D     G+AS +S +R+   S+D   + +         N++   TS    +  D           +       +     +     +    +KS    +  +NN  T ++ ST++  S ++RL   D  V + +T+++ + V   K    + L+  LADDWD ITRQ +L  +P +++V D++ +Y +  +  +      E   N       + + G+ +YFN  IGS LLYKFER QY E++     +  +S +YG  +LLRL V +  ++ ++  D  S+  L   +  F++FL  N   +F + +++  + +Y R
Sbjct:    6 KFAEGEKVLCFHGPLIYEAKALKSTITKDKQIKYYIHYAGWNKNWDEWVPENRVLKYNEANVQRQKEVFKQHSNAAGKNKKSTPKGKKGEGAGATSKD-----GTASGSSESRASTPSKDLNTTPLAAPSTSGRGNRSKPTTSTPVAKDSDGSAKEDTTAPSAGNKDETTKEEPPKKKRGGSTSNASDKSNGSGVGTSNNPITPASTSTSTGNSLQNRL---DTCVENEETFLSKVEV---KIKIPDELKQCLADDWDAITRQHKLLDIPAKITVQDIVDQYIAFKKTSKSTNASKEVAIN-------DVLNGVVEYFNVMIGSQLLYKFERPQYAEILQ-QHPETPLSKLYGGFHLLRLFVKLGSMLGFSALDEKSMQMLLVHLHDFLKFLVKNSATYFSMTNFVNVSPEYHR 400          
BLAST of MRG-1 vs. TrEMBL
Match: A0A087ZV33 (MRG domain-containing protein OS=Apis mellifera OX=7460 GN=LOC413181 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 4.540e-47
Identity = 132/425 (31.06%), Postives = 208/425 (48.94%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIE--IQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYXXXXXXXXXXXXXXXXXRKSSRSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTD--AGTSVVSEELLXXXXXXXXXXXXXXXXXXXXXXXXNSEISVDKSLVTEEKSTIEDISLTNNEAXXXXXXXXXXXXXXXRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKL-EDYITATADYTRR 1340
            MP K     K+  GEK+LC+HGPL+YEAKC++  I +  +I+Y IHY GWNK WDEWV ++R+LK+NEA +++Q+E+Q  +                   S++ S  K +   ++S+T  R    SE G+           E  TD  A T V                                  +VDK +    KST  +++ +++     + ++++ + K+SRL P  ET    + Y+T + V   K    E L+  L D+ ++I +  +L  LP + +VD +L  Y          E  + G  +  R+   E  +G+R+YFN S+G  LLYK+ER Q+ +++N N      S +YG+ +LLRL V +  ++SYT  D  SI  L      F+ +L  N  E F L +DY  +  DY R+
Sbjct:    1 MPPKC----KFQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEANVQRQREVQRAH-------------------SNQQSAQKNKKGSTSSKTQGR---RSEGGR-----------EKDTDSRASTPVA---------------------------------TVDKGVSRFNKSTSSNVTPSSSH----DSTSDAPRKKRSRLEPTGET----EEYLTKVEV---KIKIPEELKYVLIDESEVILKHHKLPALPVKNTVDKILDDY---------VESKSIGKNDSVRESTLEITKGIREYFNISLGLQLLYKWERPQFIQIMNDNPETLP-SQLYGAFHLLRLFVRLGGMLSYTTLDERSIQLLLSHFHDFLLYLQKNNTELFNLQQDYADSPPDYHRK 334          
BLAST of MRG-1 vs. TrEMBL
Match: A0A1I8MAE3 (MRG domain-containing protein OS=Musca domestica OX=7370 GN=101900840 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 7.108e-47
Identity = 122/427 (28.57%), Postives = 208/427 (48.71%), Query Frame = 3
Query:  108 KYSIGEKLLCYHGPLLYEAKCIE--IQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYXXXXXXXXXXXXXXXXXRKSSRSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTDAGTSVVSEELLXXXXXXXXXXXXXXXXXXXXXXXXNSEISVDK-----SLVTEEKSTIEDISLTNNEAXXXXXXXXXXXX---------XXXRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRR 1340
            K++ GEK+LC+HGPL+YEAK ++  + +  +++Y +HY GWNK WDEWV + R+LK+NE  +++QK+LQ  +                 ++ +R +  K +   +    S  S   S  G  S+ +T  + L   T A T+  S      ++ S   +S    +        + +  V K     S  + EKST    +++N  A+    ++ S  +              V LD  V   +T+++ I V   K    + L+  LADDWD ITRQ +L  +P +++V D++ +Y S  +  +      E           + + G+ +YFN  +GS LLYKFER QY +++   +    +S +YGS +LLRL V +  ++ Y+  D  S+  L   +  F+++L  N   FF +  ++  T +Y R 
Sbjct:    6 KFAEGEKVLCFHGPLIYEAKALKSTVTKDKQLKYFVHYAGWNKNWDEWVPEHRVLKYNETNLQRQKDLQKEHDAK--------------KEKNRKNTAKGKKGETVGANSKESGATSSGGSESRASTPSKELN--TSASTNASSGRANRSKQISSATESKKDGSGREDSSKDDKDEPVVKKKRGASTSSSEKSTANTTAVSNASASGPGATSASPATLSNNNISNTTSQTNVRLDPCVESEETFLSKIEV---KIKIPDELKQCLADDWDAITRQHKLLDIPAKITVQDIVDQYISFKKSAKSTNAGKELAIT-------DVLNGVVEYFNVMLGSQLLYKFERPQYADILQQYQDI-PLSKLYGSFHLLRLFVKLGSMLGYSDLDEKSMQLLLVHLHDFLKYLVKNSATFFSMSSFVNVTPEYHRH 405          
BLAST of MRG-1 vs. TrEMBL
Match: A0A0K8VCW1 (NuA4 complex subunit EAF3 OS=Bactrocera latifrons OX=174628 GN=MRG15 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.636e-46
Identity = 123/432 (28.47%), Postives = 213/432 (49.31%), Query Frame = 3
Query:  108 KYSIGEKLLCYHGPLLYEAKCIE--IQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYXXXXXXXXXXXXXXXXXRKSSRSSQDKIRFMGSASETS-NRSFGESED--------------GKASKITT-----EDENLENKTDAGTSVVSEELLXXXXXXXXXXXXXXXXXXXXXXXXNSEISVDKSLVTEEKSTIEDISLTNNEAXXXXXXXXXXXXXXXRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTR 1337
            K++ GEK+LC+HGPL+YEAK ++  I +  +I+Y IHY GWNK WDEWV + R+LK+NEA +++QKE+   +  +  K         +   +  +S+D     G+AS +S +R+   S+D              G  SK TT     +D ++  K D+  +  +++  +  K     K     T     + + S      + +T   +T   I    +               ++RL   D  V + +T+++ + V   K    + L+  LADDWD ITRQ +L  +P +++V D++ +Y +  +  +      E   N       + + G+ +YFN  IGS LLYKFER QY E++     +  +S +YG  +LLRL V +  ++ ++  D  S+  L   +  F++FL  N   +F + +++  + +Y R
Sbjct:    6 KFAEGEKVLCFHGPLIYEAKALKSTITKDKQIKYYIHYAGWNKNWDEWVPENRVLKYNEANVQRQKEVYKQHSNAAGKNKKSTPKGKKSEGAGATSKD-----GTASGSSESRASTPSKDLNTTPLAAPSTSGRGNRSKPTTSTPIAKDSDVSAKDDSTAATSNKD--ETTKDEPPKKKRGGSTSNASDKSNGSGAGTSSNTITTPAATGTSIGSAGSS-------------HQNRL---DTCVENEETFLSKVEV---KIKIPDELKQCLADDWDAITRQHKLLDIPAKITVQDIVDQYIAFKKTSKSTNASKEVAIN-------DVLNGVVEYFNVMIGSQLLYKFERPQYAEILQ-QHPETPLSKLYGGFHLLRLFVKLGSMLGFSALDEKSMQMLLVHLHDFLKFLVKNSATYFSMTNFVNVSPEYHR 403          
BLAST of MRG-1 vs. Ensembl Cavefish
Match: morf4l1 (mortality factor 4 like 1 [Source:NCBI gene;Acc:103024642])

HSP 1 Score: 131.724 bits (330), Expect = 1.108e-34
Identity = 76/196 (38.78%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +VD VL  Y ++ +  R    + E   N       E V G+R+YFN  +G+ LLYKFER QY E++  N     MS IYG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  113 VDPTVESEETFINRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKNVDAVLEDYANYKKS-RGTSDNKEYAVN-------EVVAGIREYFNVMLGTQLLYKFERPQYAEIL-ANHPDTSMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLSYLQDFLKYLVKNSSSLFNASDYEVAPPEYHRKAV 296          

HSP 2 Score: 107.842 bits (268), Expect = 6.183e-26
Identity = 43/77 (55.84%), Postives = 61/77 (79.22%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D KPK+  GE++LC+HGPLLYEAKC++I  +  +++Y IHY GWNK WDEWV ++R+LK+ ++ ++KQKELQ
Sbjct:    1 MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKINIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDSNLQKQKELQ 77          
BLAST of MRG-1 vs. Ensembl Cavefish
Match: morf4l1 (mortality factor 4 like 1 [Source:NCBI gene;Acc:103024642])

HSP 1 Score: 132.494 bits (332), Expect = 1.232e-34
Identity = 76/196 (38.78%), Postives = 108/196 (55.10%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +VD VL  Y ++ +  R    + E   N       E V G+R+YFN  +G+ LLYKFER QY E++  N     MS IYG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  140 VDPTVESEETFINRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKNVDAVLEDYANYKKS-RGTSDNKEYAVN-------EVVAGIREYFNVMLGTQLLYKFERPQYAEIL-ANHPDTSMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLSYLQDFLKYLVKNSSSLFNASDYEVAPPEYHRKAV 323          

HSP 2 Score: 108.227 bits (269), Expect = 7.043e-26
Identity = 43/77 (55.84%), Postives = 61/77 (79.22%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D KPK+  GE++LC+HGPLLYEAKC++I  +  +++Y IHY GWNK WDEWV ++R+LK+ ++ ++KQKELQ
Sbjct:    1 MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKINIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDSNLQKQKELQ 77          
BLAST of MRG-1 vs. Ensembl Cavefish
Match: MSL3 (MSL complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:7370])

HSP 1 Score: 55.4546 bits (132), Expect = 7.810e-8
Identity = 28/81 (34.57%), Postives = 48/81 (59.26%), Query Frame = 3
Query:   99 IKPKYSIGEKLLCYH-----GPLLYEAKCIEI------QESSEI-RYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKEL 305
            +K K+  GEK+LC+        +LY+AK ++I      + S  + +YLIH+ GWN++WD W  +  +L+ +E   K Q++L
Sbjct:    6 MKFKFRKGEKVLCFEPDPSKAKVLYDAKVVDIVVGKDEKGSRRVPKYLIHFNGWNRSWDRWAAEDHVLRDSEENRKLQRKL 86          
BLAST of MRG-1 vs. Ensembl Cavefish
Match: MSL3 (MSL complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:7370])

HSP 1 Score: 55.0694 bits (131), Expect = 9.889e-8
Identity = 28/81 (34.57%), Postives = 48/81 (59.26%), Query Frame = 3
Query:   99 IKPKYSIGEKLLCYH-----GPLLYEAKCIEI------QESSEI-RYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKEL 305
            +K K+  GEK+LC+        +LY+AK ++I      + S  + +YLIH+ GWN++WD W  +  +L+ +E   K Q++L
Sbjct:    6 MKFKFRKGEKVLCFEPDPSKAKVLYDAKVVDIVVGKDEKGSRRVPKYLIHFNGWNRSWDRWAAEDHVLRDSEENRKLQRKL 86          
BLAST of MRG-1 vs. Ensembl Cavefish
Match: MSL3 (MSL complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:7370])

HSP 1 Score: 55.0694 bits (131), Expect = 1.086e-7
Identity = 28/81 (34.57%), Postives = 48/81 (59.26%), Query Frame = 3
Query:   99 IKPKYSIGEKLLCYH-----GPLLYEAKCIEI------QESSEI-RYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKEL 305
            +K K+  GEK+LC+        +LY+AK ++I      + S  + +YLIH+ GWN++WD W  +  +L+ +E   K Q++L
Sbjct:    6 MKFKFRKGEKVLCFEPDPSKAKVLYDAKVVDIVVGKDEKGSRRVPKYLIHFNGWNRSWDRWAAEDHVLRDSEENRKLQRKL 86          
BLAST of MRG-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007775.1 (pep scaffold:Pmarinus_7.0:GL479621:8992:20190:-1 gene:ENSPMAG00000007032.1 transcript:ENSPMAT00000007775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 6.680e-21
Identity = 51/137 (37.23%), Postives = 81/137 (59.12%), Query Frame = 3
Query:  768 TVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLL 1178
            T +  +T+++ + V   K    E L+ WL DDWDLITRQ +L  LP + +VD +L  Y ++    +   G+++   NK   +  + V G+R+YFN  +G+ LLYKFER QY +++  +     MS +YG+ +LLRL 
Sbjct:    2 TCVQEETFMSRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKNVDSILEDYSNY----KKSRGNSD---NKEYAVS-DVVAGIREYFNVMLGTQLLYKFERPQYADIL-ADHPDAPMSHVYGAPHLLRLF 126          
BLAST of MRG-1 vs. Ensembl Sea Lamprey
Match: arid4a (AT rich interactive domain 4A (RBP1-like) [Source:ZFIN;Acc:ZDB-GENE-050809-105])

HSP 1 Score: 50.8322 bits (120), Expect = 5.963e-7
Identity = 26/72 (36.11%), Postives = 41/72 (56.94%), Query Frame = 3
Query:   84 PLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQK 299
            PL + ++ KY  G+ L  Y    + +    E +E S++ YL+HY GWN  +DEWV + RI++  +  I K K
Sbjct:  587 PLGTKVRVKYGRGKSLKIYEA--IIKDVDTEGEEDSDVIYLVHYYGWNVRYDEWVKEDRIIRPVDKNIPKIK 656          
BLAST of MRG-1 vs. Ensembl Yeast
Match: EAF3 (Component of the Rpd3S histone deacetylase complex; Esa1p-associated factor, nonessential component of the NuA4 acetyltransferase complex, homologous to Drosophila dosage compensation protein MSL3; plays a role in regulating Ty1 transposition [Source:SGD;Acc:S000006227])

HSP 1 Score: 85.5001 bits (210), Expect = 1.282e-18
Identity = 56/199 (28.14%), Postives = 103/199 (51.76%), Query Frame = 3
Query:  789 YVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSS-----IYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLED--------YITATADYTRRAM 1346
            ++ G     +       L+  L DDW+ +T+  ++ RLP  ++V+ VL +Y+        +E ++ G    ++    E+  G++ YF+  +G++LLY+ ER QY E++   +S KD        IYG+++LLRL+  + +LIS T  D+ S   L    + F+ +L  +VDE+F  +D        Y+  ++ Y   A+
Sbjct:  211 HIAGYPTPKISLQIPIKLKSVLVDDWEYVTKDKKICRLPADVTVEMVLNKYEHEVS----QELESPG----SQSQLSEYCAGLKLYFDKCLGNMLLYRLERLQYDELLK--KSSKDQKPLVPIRIYGAIHLLRLISVLPELISSTTMDLQSCQLLIKQTEDFLVWLLMHVDEYFNDKDPNRSDDALYVNTSSQYEGVAL 399          

HSP 2 Score: 61.6178 bits (148), Expect = 8.546e-11
Identity = 33/111 (29.73%), Postives = 51/111 (45.95%), Query Frame = 3
Query:   96 DIKPKYSIGEKLLCYHGPLLYEAKCIEI--------------------QESSEIR-------------------YLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQD 311
            D++ ++++G + L +HGPL+YEAK ++I                    Q + EI+                   + IHYQGW  +WDEWV   RI  +NE  I  +K L +
Sbjct:    3 DLEQEFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLAN 113          
BLAST of MRG-1 vs. Ensembl Nematostella
Match: EDO49765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFQ8])

HSP 1 Score: 122.865 bits (307), Expect = 1.101e-31
Identity = 72/195 (36.92%), Postives = 108/195 (55.38%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRA 1343
            L+ T+ + + YV  ++V   K V  ++L+ WL DDW+LITRQ +L  LP + +V D+L  Y  H    +   G   G          E  +G+++YFN  +G+ LLYKFER QY E++  N S   MS +YG+ +LLRL V +   +SY+  D   +  +   IQ  ++++  N D  F   DY TAT +Y RRA
Sbjct:  125 LNNTLDNDENYVPRVDV---KIVIPDDLKQWLVDDWELITRQKQLVPLPRKKTVADILDEYAKHRA--KTSNGVKPGVVR-------EVADGIQEYFNVMLGTQLLYKFERPQYGEILVEN-SNLPMSQVYGAEHLLRLFVRLGSALSYSNLDEKGVKFIVHHIQDLLDYMVKNADNLFST-DYETATPEYHRRA 305          

HSP 2 Score: 101.679 bits (252), Expect = 3.214e-24
Identity = 41/69 (59.42%), Postives = 57/69 (82.61%), Query Frame = 3
Query:  108 KYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQD 311
            K++ GE++LCYHGPL+YEAKCI  Q +    RYLIHY GWNK WDEWV ++R+LK+N+A ++KQ+EL++
Sbjct:    6 KFAEGERVLCYHGPLIYEAKCIRGQLKEKTARYLIHYNGWNKNWDEWVPESRVLKYNDANLQKQRELRE 74          
BLAST of MRG-1 vs. Ensembl Nematostella
Match: EDO38666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCD5])

HSP 1 Score: 53.5286 bits (127), Expect = 3.003e-9
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  105 PKYSIGEKLLCYH-----GPLLYEAKCIEIQESSEIR------YLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQD 311
            PK+  G+ +LCY        +LYEAK +E+  + + +      Y IH+ GWNK+WD WV +  +LK +EA    + +L +
Sbjct:   12 PKHEQGDTVLCYEPDPTKARVLYEAKVLEVDITKDEKGKKVPEYFIHFNGWNKSWDRWVVEESVLKNSEANQALKAKLHE 91          
BLAST of MRG-1 vs. Ensembl Medaka
Match: ENSORLT00000002558.2 (mortality factor 4-like protein 1 [Source:NCBI gene;Acc:101169275])

HSP 1 Score: 125.561 bits (314), Expect = 3.380e-32
Identity = 74/196 (37.76%), Postives = 109/196 (55.61%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   + +   + V   K    E L+ WL DDWDLITRQ +L  LP + SVD VL  Y ++    +  +G+++   NK   +  E V G+R+YFN  +G+ LLYKFER QY E++        MS +YG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  140 VDPTVESEEMFTNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKSVDMVLEDYANY----KKSKGNSD---NKEYAVN-EVVAGIREYFNVMLGTQLLYKFERPQYAEIL-AEHPDTPMSQVYGAPHLLRLFVRIGAMLAYTLLDEKSLALLLTYLQDFLKYLVKNSATLFSATDYEVAPPEYHRKAV 323          

HSP 2 Score: 107.071 bits (266), Expect = 1.565e-25
Identity = 43/77 (55.84%), Postives = 60/77 (77.92%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D KPK+  GE++LC+HGPLLYEAKC++I  +  +I+Y IHY GWNK WDEWV ++R+LK+ ++ + KQ+ELQ
Sbjct:    1 MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKISIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNLAKQRELQ 77          
BLAST of MRG-1 vs. Ensembl Medaka
Match: ENSORLT00000002559.2 (mortality factor 4-like protein 1 [Source:NCBI gene;Acc:101169275])

HSP 1 Score: 124.79 bits (312), Expect = 3.773e-32
Identity = 74/196 (37.76%), Postives = 109/196 (55.61%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   + +   + V   K    E L+ WL DDWDLITRQ +L  LP + SVD VL  Y ++    +  +G+++   NK   +  E V G+R+YFN  +G+ LLYKFER QY E++        MS +YG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  113 VDPTVESEEMFTNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKSVDMVLEDYANY----KKSKGNSD---NKEYAVN-EVVAGIREYFNVMLGTQLLYKFERPQYAEIL-AEHPDTPMSQVYGAPHLLRLFVRIGAMLAYTLLDEKSLALLLTYLQDFLKYLVKNSATLFSATDYEVAPPEYHRKAV 296          

HSP 2 Score: 104.76 bits (260), Expect = 7.436e-25
Identity = 42/76 (55.26%), Postives = 59/76 (77.63%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKEL 305
            M  K D KPK+  GE++LC+HGPLLYEAKC++I  +  +I+Y IHY GWNK WDEWV ++R+LK+ ++ + KQ+EL
Sbjct:    1 MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKISIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNLAKQREL 76          
BLAST of MRG-1 vs. Ensembl Medaka
Match: morf4l1 (mortality factor 4-like protein 1 [Source:NCBI gene;Acc:101170839])

HSP 1 Score: 125.176 bits (313), Expect = 4.529e-32
Identity = 75/196 (38.27%), Postives = 107/196 (54.59%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   +T++  + V   K    E L+ WL DDWDLITRQ +L  LP + +VD VL  Y ++ +  R      E   N       E V G+R+YFN  +G+ LLYKFER QY +++  N     MS IYG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  140 VDPTVESEETFINRVEV---KVKIPEELKPWLVDDWDLITRQKQLVHLPAKKNVDGVLEDYANYKKS-RGNSDSKEFAVN-------EVVAGIREYFNVMLGTQLLYKFERPQYADIL-ANHPDTPMSQIYGASHLLRLFVRIGAMLAYTPLDEKSLSLLLSYLQDFLKYLVKNSASLFNASDYEVAPPEYHRKAV 323          

HSP 2 Score: 106.686 bits (265), Expect = 2.060e-25
Identity = 43/77 (55.84%), Postives = 60/77 (77.92%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D KPK+  GE++LC+HGPLLYEAKC++   +  +I+Y IHY GWNK WDEWV ++R+LK+ ++ ++KQKELQ
Sbjct:    1 MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKTNIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNLQKQKELQ 77          
BLAST of MRG-1 vs. Ensembl Medaka
Match: ENSORLT00000002555.2 (mortality factor 4-like protein 1 [Source:NCBI gene;Acc:101169275])

HSP 1 Score: 125.561 bits (314), Expect = 5.519e-32
Identity = 74/196 (37.76%), Postives = 109/196 (55.61%), Query Frame = 3
Query:  759 LDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAM 1346
            +D TV   + +   + V   K    E L+ WL DDWDLITRQ +L  LP + SVD VL  Y ++    +  +G+++   NK   +  E V G+R+YFN  +G+ LLYKFER QY E++        MS +YG+ +LLRL V I  +++YT  D  S+  L   +Q F+++L  N    F   DY  A  +Y R+A+
Sbjct:  152 VDPTVESEEMFTNRVEV---KVKIPEELKPWLVDDWDLITRQKQLFHLPAKKSVDMVLEDYANY----KKSKGNSD---NKEYAVN-EVVAGIREYFNVMLGTQLLYKFERPQYAEIL-AEHPDTPMSQVYGAPHLLRLFVRIGAMLAYTLLDEKSLALLLTYLQDFLKYLVKNSATLFSATDYEVAPPEYHRKAV 335          

HSP 2 Score: 107.071 bits (266), Expect = 1.964e-25
Identity = 43/77 (55.84%), Postives = 60/77 (77.92%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQ-ESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQ 308
            M  K D KPK+  GE++LC+HGPLLYEAKC++I  +  +I+Y IHY GWNK WDEWV ++R+LK+ ++ + KQ+ELQ
Sbjct:    1 MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKISIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNLAKQRELQ 77          
BLAST of MRG-1 vs. Ensembl Medaka
Match: MSL3 (MSL complex subunit 3 [Source:NCBI gene;Acc:101160633])

HSP 1 Score: 50.447 bits (119), Expect = 2.938e-6
Identity = 24/80 (30.00%), Postives = 44/80 (55.00%), Query Frame = 3
Query:   99 IKPKYSIGEKLLCYH-----GPLLYEAKCIEIQESSE------IRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKEL 305
            IK  +  GE++LC+        +LY+AK +++   ++       +YLIH+ GW+++WD W  +  +L+  E   K Q+ L
Sbjct:    6 IKYHFHKGERVLCFEPDPSKAKVLYDAKVLDVLIGTDEHGRRVPKYLIHFNGWSRSWDRWAAEDHVLRDTEENRKLQRRL 85          
BLAST of MRG-1 vs. Planmine SMEST
Match: SMESG000022376.1 (SMESG000022376.1)

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 423/423 (100.00%), Postives = 423/423 (100.00%), Query Frame = 3
Query:   81 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYXXXXXXXXXXXXXXXXXRKSSRSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTDAGTSVVSEELLXXXXXXXXXXXXXXXXXXXXXXXXNSEISVDKSLVTEEKSTIEDISLTNNEAXXXXXXXXXXXXXXXRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAMC 1349
            MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYKESRKKKDNRKKMINEKRKSSRSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTDAGTSVVSEELLDDQKSSIKDKSVSSKTRTRKRRLSNSEISVDKSLVTEEKSTIEDISLTNNEATNSNKSTNSSKSKKSRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAMC
Sbjct:    1 MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQESSEIRYLIHYQGWNKTWDEWVNDTRILKFNEAGIKKQKELQDLYKESRKKKDNRKKMINEKRKSSRSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTDAGTSVVSEELLDDQKSSIKDKSVSSKTRTRKRRLSNSEISVDKSLVTEEKSTIEDISLTNNEATNSNKSTNSSKSKKSRLVPLDETVLDLDTYVTGINVQSLKFVFTENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGDNEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESKKDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNNVDEFFKLEDYITATADYTRRAMC 423          
The following BLAST results are available for this feature:
BLAST of MRG-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MORF4L13.217e-3336.22mortality factor 4 like 1 [Source:HGNC Symbol;Acc:... [more]
MORF4L13.217e-3336.22mortality factor 4 like 1 [Source:HGNC Symbol;Acc:... [more]
MORF4L24.796e-3336.46mortality factor 4 like 2 [Source:HGNC Symbol;Acc:... [more]
MORF4L21.677e-3236.46mortality factor 4 like 2 [Source:HGNC Symbol;Acc:... [more]
MORF4L21.677e-3236.46mortality factor 4 like 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of MRG-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrg-12.645e-925.84MRG (Mortality factor-Related Gene) related [Sour... [more]
mrg-12.012e-826.07MRG (Mortality factor-Related Gene) related [Sour... [more]
back to top
BLAST of MRG-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MRG154.710e-2531.82gene:FBgn0027378 transcript:FBtr0083125[more]
MRG154.864e-2531.82gene:FBgn0027378 transcript:FBtr0333921[more]
back to top
BLAST of MRG-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
morf4l17.372e-3538.78mortality factor 4 like 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
morf4l17.372e-3538.78mortality factor 4 like 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
morf4l11.082e-3438.78mortality factor 4 like 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of MRG-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cog31.534e-3236.22component of oligomeric golgi complex 3 [Source:Xe... [more]
cog34.578e-3236.22component of oligomeric golgi complex 3 [Source:Xe... [more]
cog37.509e-3236.22component of oligomeric golgi complex 3 [Source:Xe... [more]
cog31.578e-3136.22component of oligomeric golgi complex 3 [Source:Xe... [more]
cog31.593e-3136.22component of oligomeric golgi complex 3 [Source:Xe... [more]
back to top
BLAST of MRG-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Morf4l21.962e-3337.85mortality factor 4 like 2 [Source:MGI Symbol;Acc:M... [more]
Morf4l21.962e-3337.85mortality factor 4 like 2 [Source:MGI Symbol;Acc:M... [more]
Morf4l21.962e-3337.85mortality factor 4 like 2 [Source:MGI Symbol;Acc:M... [more]
Morf4l21.962e-3337.85mortality factor 4 like 2 [Source:MGI Symbol;Acc:M... [more]
Morf4l21.962e-3337.85mortality factor 4 like 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of MRG-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R0Q4|MO4L2_MOUSE1.372e-3237.85Mortality factor 4-like protein 2 OS=Mus musculus ... [more]
sp|Q6QI89|MO4L2_RAT1.444e-3237.85Mortality factor 4-like protein 2 OS=Rattus norveg... [more]
sp|Q4R578|MO4L2_MACFA7.735e-3236.46Mortality factor 4-like protein 2 OS=Macaca fascic... [more]
sp|Q5R905|MO4L2_PONAB8.056e-3236.46Mortality factor 4-like protein 2 OS=Pongo abelii ... [more]
sp|A5A6J5|MO4L2_PANTR8.056e-3236.46Mortality factor 4-like protein 2 OS=Pan troglodyt... [more]
back to top
BLAST of MRG-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXT00.000e+0100.00MRG-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A0A1XPQ23.567e-4828.99NuA4 complex subunit EAF3 homolog OS=Zeugodacus cu... [more]
A0A087ZV334.540e-4731.06MRG domain-containing protein OS=Apis mellifera OX... [more]
A0A1I8MAE37.108e-4728.57MRG domain-containing protein OS=Musca domestica O... [more]
A0A0K8VCW12.636e-4628.47NuA4 complex subunit EAF3 OS=Bactrocera latifrons ... [more]
back to top
BLAST of MRG-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
morf4l11.108e-3438.78mortality factor 4 like 1 [Source:NCBI gene;Acc:10... [more]
morf4l11.232e-3438.78mortality factor 4 like 1 [Source:NCBI gene;Acc:10... [more]
MSL37.810e-834.57MSL complex subunit 3 [Source:HGNC Symbol;Acc:HGNC... [more]
MSL39.889e-834.57MSL complex subunit 3 [Source:HGNC Symbol;Acc:HGNC... [more]
MSL31.086e-734.57MSL complex subunit 3 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of MRG-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007775.16.680e-2137.23pep scaffold:Pmarinus_7.0:GL479621:8992:20190:-1 g... [more]
arid4a5.963e-736.11AT rich interactive domain 4A (RBP1-like) [Source:... [more]
back to top
BLAST of MRG-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
EAF31.282e-1828.14Component of the Rpd3S histone deacetylase complex... [more]
back to top
BLAST of MRG-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO497651.101e-3136.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386663.003e-935.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MRG-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002558.23.380e-3237.76mortality factor 4-like protein 1 [Source:NCBI gen... [more]
ENSORLT00000002559.23.773e-3237.76mortality factor 4-like protein 1 [Source:NCBI gen... [more]
morf4l14.529e-3238.27mortality factor 4-like protein 1 [Source:NCBI gen... [more]
ENSORLT00000002555.25.519e-3237.76mortality factor 4-like protein 1 [Source:NCBI gen... [more]
MSL32.938e-630.00MSL complex subunit 3 [Source:NCBI gene;Acc:101160... [more]
back to top
BLAST of MRG-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022376.10.000e+0100.00SMESG000022376.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30015533
GenBankAFD29601.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015533 ID=SMED30015533|Name=MRG-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1363bp
ATAAAGTAGACATTTTAAAATTATAATTTGATATTAAATTTTAAATTTGA
GACAATTATCTATTTATGCTTATTTTTTAAATGCCTCTGAAATCTGATAT
AAAGCCTAAATATTCAATAGGTGAAAAATTACTCTGCTATCACGGACCCT
TGCTTTATGAAGCAAAGTGTATTGAAATTCAGGAAAGTTCTGAAATTCGA
TATCTTATACACTACCAAGGATGGAATAAAACTTGGGATGAATGGGTTAA
TGATACAAGAATATTGAAATTTAATGAGGCTGGAATCAAAAAGCAAAAAG
AATTGCAAGATCTTTATAAGGAATCTCGAAAGAAAAAAGATAATAGAAAA
AAAATGATAAACGAAAAACGCAAATCTAGTCGTAGTTCTCAAGATAAGAT
TCGTTTCATGGGTTCGGCTTCTGAAACATCAAATCGTAGTTTTGGTGAAT
CAGAAGACGGCAAGGCTTCTAAAATAACTACAGAAGATGAAAATTTAGAA
AATAAAACTGATGCTGGAACATCGGTTGTAAGTGAAGAGCTATTAGATGA
TCAAAAATCATCCATAAAAGATAAATCTGTGTCATCAAAGACAAGAACAA
GAAAGCGCCGCCTGTCTAATAGTGAAATAAGTGTTGATAAATCTCTAGTG
ACAGAAGAAAAATCAACAATCGAAGATATTTCGCTAACTAATAATGAAGC
TACTAATTCTAATAAATCTACAAACAGTTCGAAATCAAAAAAAAGTCGAC
TAGTTCCATTAGATGAAACTGTTTTGGATTTGGACACCTATGTCACCGGA
ATCAACGTTCAATCGCTTAAATTTGTTTTCACTGAAAATCTTCGATTATG
GTTGGCTGATGATTGGGATTTAATAACCCGCCAATCGCGTCTTTCTCGTT
TGCCGACTCGAATGTCGGTCGATGATGTTTTAGCACGATATAAATCCCAT
TGCGAATGTCTTCGAATGGAGGAAGGAGACAACGAAGGATTCTTCAACAA
AAACCGAGACATGCGTTTCGAATTCGTTGAAGGAATGAGAAAGTATTTCA
ATACGTCCATCGGTTCGTTATTGTTGTACAAATTTGAGCGGCAGCAATAT
TTTGAAGTTGTCAACACCAACGAATCGAAAAAGGACATGAGCAGCATTTA
CGGTTCCATGTATTTATTGAGATTATTAGTTAATATAAAGAAACTTATTT
CCTACACTCGTACCGATGTGCCGAGTATTGATTGTTTAGGAGACTTGATA
CAGCATTTCATTGAGTTTTTAGATAATAATGTTGACGAGTTTTTCAAATT
GGAAGATTACATAACGGCAACTGCGGATTACACTCGCAGGGCAATGTGTT
GAATGTTGTAATG
back to top

protein sequence of SMED30015533-orf-1

>SMED30015533-orf-1 ID=SMED30015533-orf-1|Name=SMED30015533-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
MPLKSDIKPKYSIGEKLLCYHGPLLYEAKCIEIQESSEIRYLIHYQGWNK
TWDEWVNDTRILKFNEAGIKKQKELQDLYKESRKKKDNRKKMINEKRKSS
RSSQDKIRFMGSASETSNRSFGESEDGKASKITTEDENLENKTDAGTSVV
SEELLDDQKSSIKDKSVSSKTRTRKRRLSNSEISVDKSLVTEEKSTIEDI
SLTNNEATNSNKSTNSSKSKKSRLVPLDETVLDLDTYVTGINVQSLKFVF
TENLRLWLADDWDLITRQSRLSRLPTRMSVDDVLARYKSHCECLRMEEGD
NEGFFNKNRDMRFEFVEGMRKYFNTSIGSLLLYKFERQQYFEVVNTNESK
KDMSSIYGSMYLLRLLVNIKKLISYTRTDVPSIDCLGDLIQHFIEFLDNN
VDEFFKLEDYITATADYTRRAMC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038217MRG_C_sf
IPR008676MRG
IPR000953Chromo/chromo_shadow_dom
IPR026541MRG_dom
IPR025995Tudor-knot
IPR016197Chromo-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006325chromatin organization
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 75..95
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 2..93
e-value: 1.8E-31
score: 110.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 121..142
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 201..221
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..120
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 201..222
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 81..180
NoneNo IPR availableCDDcd18983CBD_MSL3_likecoord: 15..70
e-value: 9.39261E-19
score: 77.4893
IPR000953Chromo/chromo shadow domainSMARTSM00298chromo_7coord: 10..77
e-value: 6.5E-4
score: 29.0
IPR026541MRG domainPFAMPF05712MRGcoord: 247..411
e-value: 2.0E-39
score: 135.0
IPR026541MRG domainPROSITEPS51640MRGcoord: 242..422
score: 46.412
IPR038217MRG, C-terminal domain superfamilyGENE3DG3DSA:1.10.274.30coord: 241..423
e-value: 2.2E-48
score: 165.9
IPR025995RNA binding activity-knot of a chromodomainPFAMPF11717Tudor-knotcoord: 13..61
e-value: 3.6E-12
score: 46.0
IPR008676MRGPANTHERPTHR10880MORTALITY FACTOR 4-LIKE PROTEINcoord: 7..421
IPR016197Chromo-like domain superfamilySUPERFAMILYSSF54160Chromo domain-likecoord: 5..267