Mannose-binding protein C

Overview
NameMannose-binding protein C
Smed IDSMED30015528
Length (bp)4008
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mannose-binding protein C (SMED30015528) t-SNE clustered cells

Violin plots show distribution of expression levels for Mannose-binding protein C (SMED30015528) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015528

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30015528SMESG000078340.1 SmedASXL_006580SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30015528SMESG000078340.1 dd_Smed_v4_3193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015528SMESG000078340.1 dd_Smed_v6_3193_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30015528SMESG000078340.1 Contig50688newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015528SMESG000078340.1 Contig50688uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015528SMESG000078340.1 Contig36065newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015528SMESG000078340.1 Contig36065uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015528SMESG000078340.1 Contig33177newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015528SMESG000078340.1 Contig33177uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015528SMESG000078340.1 Contig37615newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015528SMESG000078340.1 Contig37615uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mannose-binding protein C vs. Ensembl Human
Match: MRC1 (mannose receptor C-type 1 [Source:HGNC Symbol;Acc:HGNC:7228])

HSP 1 Score: 217.238 bits (552), Expect = 1.875e-56
Identity = 257/1137 (22.60%), Postives = 448/1137 (39.40%), Query Frame = 1
Query:  934 KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIF------------------EEKVVFKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN--NYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK-------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI-----------------------YEYESTAEKEITIEIMEG----KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ--YWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTS-------------KYFVHTGRVTYEEALRFCQIHSCRLVTIEN-SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNED--CLLGNYFANGKWNDFSCSTKNSFIYYYIE-----------------------NIISTKELEIF----KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPN------NYGNEDCV---HGLYYSNGFWNDIACNSKNSFICSKYS------PPIIFIDEHM------SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNY-------WIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK--------PSKTIDTGKEVKKTK--------YYIH-RIGVTFQEALDFCKERRCKLIVVDNIDTNIYL-WELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSC 3885
            K  LT+++A+  C+ Q  +L+ I +    + +         G  WI  N +     ++ SD++  ++  W  G P+    + CV     KNA W +++C      IC K  G+     F I ++  V                    +EK + + A   C+  G +L  I + +E++ +I     + N    WI  NDI+ +  F +SD   +++ KW  GEP+  N   EDCV  +  K+G W D  C++    IC     +    I + +K             Y +   L T+ EA   CN  N  +  I +      +  +        FW   +DI T+G +  +   ++ + +W  + P        +       G W+ + C  K   +                        ++ +++   +  ++       K  + ++ + C++ G DL  I N+E  + ++ + T +      +W+     +    F +SDG  +SY N+A+GEPNN QN E C          WNDI+C  +N+ +C     +    +      D               +Y+    + T + A  FC+ +   LV+I++ SE   L   + R    S Y++ G  I  + ++  +DG+K+ Y++W  GEP N+ NED  C+   Y  +G WND +C   N+FI                            N  S K  +IF    +ER  ++EA+  CI  G +LV I NE+  Q      +K+     W   ND   E  F+ ++   + Y+ + +G P       +Y + DCV    G     G W D  C+SK  +IC   S      PP     +        SY +   K  + EA   C        K+ NS I+ I+   S  +  +         WI    +  D ++T++D  ++ + NW  A  P  K  + C+Y    L G W    C      +C +        P +      E   T         YYI       + +A   C      L+ +++   + +L + +    S   +W+ G  ++ EG W+  +   ++F NW  G  + ++          G W ++ C
Sbjct:  235 KSALTWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKK--GNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGI-AGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFI-GLLISLDKKFAWMDGSKVDYVSWATGEP-NFANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEK-EQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYC--------KLHNSLIASILDPYSNAFAWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNW-AADEP--KLKSACVYLD--LDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWI-GLFRNVEGTWLWINNSPVSFVNWNTGDPSGERNDCVALHASSGFWSNIHC 1347          

HSP 2 Score: 214.927 bits (546), Expect = 1.032e-55
Identity = 273/1151 (23.72%), Postives = 444/1151 (38.58%), Query Frame = 1
Query:  556 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFK------------------ERLTYYKAQDLCKSQGYKLVKIDD-EQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPN--NYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKE-----------IVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKW---YPG-EPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC---------------------SKDILNSNETIKQQQKYYV--HEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR----FWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYEY--------ESTAEKEITIEIME-GKVNYIK--------------ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQN-NEDCVHGLFYTNGLWNDISCNSINSVLCYK-----------PFXXXXXXXXXXG------KIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPN------NYGNEDCLL---GNYFANGKWNDFSCSTKNSFIYYY-----IENIISTKELEIF-----------KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK------YSPPIIFI----DEHMSYKIFINKVTYRE---------AVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDT 3558
            T+  A   C+ +  +L+ I +    + +  L      G  WI  N +     +  SD     Y  + PG P+  +  + CV      NA W ++ C      IC K +    L    + ++  V                     E+     A   C+ +G  L  I   E+ + I+     + N    WI  ND++I+  FE SD   + F+KW  GEP+  N + EDCV  +  K+  W D  CE     IC     S+G    E+                +I      F  A   C N    L  I+     + +  F        +W   +DIQT+ TF ++  +++ +  W    PG +P        + G     GLW+ +KCD K   +C                      +D   S+ T    + Y    HE   T+ E+ +FC      +  I+N E  + I  W      G     FW+          +  S G+ + Y NWA  EPNNY N E C E    P   WNDI+C+  N  I +         E T   +    + E G V Y                A   CK    DL+ I++E   K ++    +N     +     I+++ +F + DG  + Y ++A GEPN  N +E+CV  ++  +G WNDI+C   N+ +C +           P         +EG      K      F+   R  ++EA + C      LV+I+N E +   L    K      W   ND+  E  ++  DG  + Y NW +G P       +Y + DC++   G     GKW D +C +K  +I        + N  +T + + F           +++  + EA+  C      +  I +  +N   + L ++    + WI  N    + ++  ++   ++Y+ +   EP       CV+     +G+W    CN    F+C +        PP +       +H ++  F     Y E         A  +C   G SL+ +E++ + SF+ + +       N+WI G     +G W + +   ++F NW T   PS  E N+C+ +    SG W    C S    IC +P K ID 
Sbjct:  239 TWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSA-EPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNT--TLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGIAG-----GLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEK-KTWFESRDFCRALGGDLASINNKEEQQTI--WRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQN-EKEQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKL--KSACVY--LDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWI-GLFRNVEGTWLWINNSPVSFVNWNTGD-PSG-ERNDCV-ALHASSGFWSNIHCSSYKGYICKRP-KIIDA 1363          

HSP 3 Score: 211.46 bits (537), Expect = 1.399e-54
Identity = 260/1192 (21.81%), Postives = 471/1192 (39.51%), Query Frame = 1
Query:  103 EPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL----------------IILQEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESK------IEVLKKITVLNKE-----LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVH---GLYYKNALWNDIKCEDLNAVICYK-----------------------NIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK----HNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVICS------------------KDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYN-NEDCLEGNFYPN-GEWNDISCKTKNYLIYEYESTAEKEITIE---------------------------IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE------DCV---HGLFYTNGLWNDISCNSINSVLCY---------KPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI--------------FKERVTFEEAQNT---------CIKKGWSLVRIDNE-ETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYRE 3231
            +P  S   ++ SK  +      T+ +A K CQ +   L+ I +    T +  L     +G  WI  N +     +++ +    +Y  +  G P+    + CV     K+  W ++ C      IC K      S VI   +                   I   EK    +A+  C+ +G  L  I   ++L+ ++  L  +      WI  ND++ +  F  SDG  + + K+  GEP++   + E CV  +   +  W D  C      IC  +S+      +EV K      K+      +I     T+ +A   C ++   L  I+D    + + ++        +W   +D++ +GTF+ + + +++F+ W +  P   +   CV    G+     LW+ +KC++    +C                            SR    F++  K      EK  +  ++  C+  G +L  I++ E    I+         H +  +W+          F +SD   +SY+ W  GEPNNY+N E C          WNDI C++ N+ IC                     +      I +  +YY  +   T + A  FC ++   +V I +    K ++++         +  G  I  + K+    G+K+ Y++WA  EPN  N +E+C+    Y N G WNDI+C   N  I +  +++    T+                            + E + N+ +A + C   G +L+ I+NE+  +       K+     W   ND+N E  F+++DG+ + Y N+  G P  + +       DCV    G     G W D +C+S    +C           P     D   + GK   S Y +   +  + EA  +C++H+  + +I +   +     L  +      W+  N    + ++   D  +++Y NW   EP       C+  +   +G W    C+    F+    + I +T+  ++              F     + E+  T         C++ G SLV I++  E++   Y +        +WI    + VEG ++  NN  + +  +  G+P+   N DCV  L+ S+GFW++I C+S   +IC +  P I  ID   ++++   K   R+
Sbjct:  223 DPLTSVSYQINSKSAL------TWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPG--RKPGCVAMRTGI--AGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGK---HEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKL--FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCV--TMYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEK-EQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGK---SSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKL--KSACVYLDL--DGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLF-RNVEGTWLWINNSPVSFVNWNTGDPSGERN-DCV-ALHASSGFWSNIHCSSYKGYICKR--PKI--IDAKPTHELLTTKADTRK 1378          

HSP 4 Score: 166.777 bits (421), Expect = 7.654e-41
Identity = 224/1001 (22.38%), Postives = 386/1001 (38.56%), Query Frame = 1
Query: 1330 VVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD--ILNS----------NETIKQQQKYYVHEVLVTYEE------AINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDC--LEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEG------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVH---GLFYTNGLWNDISCNSINSVLC------------YKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYE-----EALRFCQIHSCRLVTIENSELDILILNL----ARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE-----------------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNED--CVHGLYYSNGFWNDIACNSKNSFICSKYS---------PPIIFID----------EHMSYKIFI----NKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK------ENNNCLY---SSETLSGKWLGTSCVSKNSVICYK--------PSKTIDTGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW--LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDE 3924
            + +  A+  C+    ELL I   EI+   Y   +  ++ +  WI  N +   + + +SD     Y  W PG P+    + CV     KN  W +++C  K   IC K    LNS               Q   Y  H   +  +E      A+  C +    +  I  +E    I            WI  NDI  +  +  S G  + +  W + EP++ NN  EDC  ++G    +G W D  C+     I + +S ++    +E+ +G                     + +A + C ++   L  IE+      +           +W   +DI  +G F ++  + + + ++    P  +    CV    G+    GLW+ + C+     +C                 E K  +       TS  F    +  +E     E+  FC+     L +I N E    I  L       HK+  +WL          +   DG+ + Y NW  GEPNNY N E C          WND +C   N++I    +      E                           KE+ T + A+  C +    LV I +E   + ++    +N     +      +++ KF   +   + Y  +  GEPN + NED  CV  +Y ++GFWNDI C   N+FIC +++         P +  +            +  +KIF      +  ++EA   C   G +L+ ++N  + +F+  T  ++    + W    D  ++  + ++DG+ + + NW     P  +      E+ +C+     +   +GKW+  +C SK   IC          P  TI T   VK  K+ Y + R    + EA  +CK     +  + +  +N + W L  + S E+ W  LN N  DN+  W  +DK ++ + NW   +  ++    C+  + DG W+   C++   F  +  DE
Sbjct:  238 LTWHQARKSCQQQNAELLSIT--EIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGK---DGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRK--PGCVAMRTGI--AGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKL--FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPN-FANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFL--TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKG-YPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTW--TDKWRVRYTNWAADEPKLKSA--CVYLDLDGYWKTAHCNESFYFLCKRSDE 1217          

HSP 5 Score: 115.546 bits (288), Expect = 3.709e-25
Identity = 135/645 (20.93%), Postives = 247/645 (38.29%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICY--KETEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKN-----------TQPKTSHVIK-----LLNRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVI---------FKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNK-------EIVIFEEKVVF---------KHAQLLCKNNGYELLKIDSDEINSMI-YDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD-ILNSNETIKQQQKYYVHEVLVT 1716
            Q  E+C      P   WND +CE  +  IC   K   PK       Q    +                +EK T   A   C+    +L+ I+ +     ++    +  A   +     I ++  F +++G ++ Y  +A GEPN + NED  CV  M+   GFWNDI+C   N+ IC ++           T P      K       N+   I     +E+  ++ A   C   G  L+ I +++  + +    ++      W   ND+ +E  F+ +DG+ + Y  +  G P   +     ++  CV    G       W D +C      IC   S   +      +  +  +          +++  +++A+  CK     +  I D   N+  +   ++ +  R WI  N    +  +  +DK +++++ WAA EP       CV+     +  W    C +    +C ++         ++  +         + F     +           A L C   G  L+ I+S   +S + Y      +   +WI       E T+++ ++  +S+  W  G+P+  E  DCV  L+  +G W++I C      IC +  I+++  T         HE+L T
Sbjct:  748 QNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPN-FANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFL-TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVY--LDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFR-NVEGTWLWINNSPVSFVNWNTGDPSG-ERNDCV-ALHASSGFWSNIHCSSYKGYICKRPKIIDAKPT---------HELLTT 1372          

HSP 6 Score: 60.077 bits (144), Expect = 3.585e-8
Identity = 84/394 (21.32%), Postives = 151/394 (38.32%), Query Frame = 1
Query: 2830 KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ-YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK------------------YSPPIIFIDEHMSYKIFIN-KVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENN--NCLYSSETLSGKWLGTSCVSKNSVICYKPSKT-------IDTG--KEVKKTKYYIHRIG---VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQ-GNPDGKWRDVSCDDKNPF 3903
            K  +T+ +A+ +C ++   L+ I   E ++  Y   + + +    WI  N  +    +  S+    +Y  +  G P+    + CV      N  W ++ C  K  +IC K                  + P   +      YKI  + K   R+A+  C+ EG  L  +    ++ FI+  L         WI   D K    + +SDG  +TF  W     PS + N   +C+   +   G W    C      IC   S++       ++ G  K  KK  +Y + IG    TF EA   C      L  +++     +L         + +W   +D   +G +  + ++++ F +W +     +     ++ G   G W  + CD+K  F
Sbjct:  235 KSALTWHQARKSCQQQNAELLSIT--EIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGE-PSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGIAGGLWDVLKCDEKAKF 623          
BLAST of Mannose-binding protein C vs. Ensembl Human
Match: MRC2 (mannose receptor C type 2 [Source:HGNC Symbol;Acc:HGNC:16875])

HSP 1 Score: 139.813 bits (351), Expect = 1.640e-32
Identity = 230/1170 (19.66%), Postives = 429/1170 (36.67%), Query Frame = 1
Query:  136 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYSNALWNDISCADSNAVICYKESKIE---------VLKKITVLNKELVIFKE-RLTYYKAQDLCKSQGYKLVKIDD--EQ--FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA--LWNDIKCEDLNA-VICYKNIGSRGFTKFEISNKEIVI-------------------------FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK---------HNIGTYWIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHG---LYYKNGLWNDIKCDYKNSVIC----SKDILNSNETIK--------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSK--NMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEY----ESTAEKEITIEIMEG----------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE-------DCVHGLF----YTNGLWNDISCN-SINSVLCYKPFXXXXXXXXXXGKIDTS---KYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYW--LDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTK--------------NSFIYYY--IENIISTKELEIFKER---------VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ---YWIDANDKAVEGKFVDSNNHALKYSKF-PRGEPNNYGNEDCVHGLYYSNGFWNDIACN 3129
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++     WND  C  S   IC K  ++            K  T  +       E ++TY +A+ LC   G +LV I +  EQ   +S++YN+  +     +W    D+   G+F     +++ ++ W   +P  Y    CV  L   +A  LW    C    A  IC +++G+    +    +    +                          ++K  +  AQ  C+  G +LL + S E    + +   K         H    +WI  N  D +   ++ +SD    SY  +      +  ++D + G   L   +  W  ++CD +   IC      D+   +++ +        Q+ +Y   E   T+ +A   C      +  + S  E + + +   K    +   +WI  +   ++G++  + G+ + +++WA  +P     +           +W D  C T    I +     + T   ++    + G                      +V + +A   C+ +   L+ I N  + +     +  N     WI  +    + Q++  + + + Y N+A GEP+  +          C   L     +  G W+D SC    +  +C K                      Y   T R     + + +AL  C+  +  L  + +      +   AR  +    W  L G +  +   WV+ +   L Y+ W  GEP   G   C   +   +G W   SC TK                 I Y+      ++      F+E          +  +EA+  C + G +++ I +E  N  +++  +++  GQ    W+  N     G  V  +N A+ YS + P G   +  + +  + +  ++G W   AC 
Sbjct:  247 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQ-------AEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGE----YFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQP-GYSRGGCV-ALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFD----RSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITN-PLEQAFITASLPNVTFDLWIGLHASQRDFQWV--EQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTP-LWIGLAGEEGSRRYSWVSEE--PLNYVGWQDGEPQQPGG--CTYVD--VDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWE-HLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWRPGACT 1385          

HSP 2 Score: 139.043 bits (349), Expect = 2.404e-32
Identity = 199/1008 (19.74%), Postives = 375/1008 (37.20%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIK------------------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE-----------------IMEGKVNYIKALELCKSKGYDLI----RIENEEINKIVYDVATKNKVGQY-WINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINS-VLCYK--------------PFXXXXXXXXXXGKIDTSKYFVH--------TGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARK---------HKISGYW--LDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI-----------------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEE----TNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFICSK------YSPPIIFIDE----HMSYKIFINK------------VTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQT------ASLPSDKENNNC---LYS-SETLSGKWLGTSCVSK-NSVICYKPS----------KTIDTGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY-WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDK 3894
            F+  + ++ A   C+  G +LL I    +   IN ++  ++      T WI  ND+ T   + +SD+  + Y  W   +P+N   E+C       +G W +  C      +C K    + E                     Q   Y +     +++E+   C +    +V I ++   + I +  K  ++   WI  ND+  +  +  S G+ + + +W   EPNN+ +  EDC+   + P G WND  C      I +      +    E                 + E +V Y +A  LC   G  L+    R E   ++ ++Y     N  G+Y W    D+N  G F +  G  + Y ++   +P                GLW   +C S  +  +C +              P         +    DT   + +          + ++ +A   CQ    +L+++ + E +  + N+  K         H+   +W  L+  D +    W   DG    Y N+++   ++     C + +  A+ +W    C T+  +I                            E + F+   T+ +AQ  C      L  + ++      + N+   + + +   +WI  +    +G+F  ++   + +  +  G+P   G ++ CV+ +  S   W D  C +   +IC +        PP +           +  F+NK            V + EA   C+ +   L+ + N  + +FI  T SL     + WI    S+ D +W   + + L + NW        +  PS  +  +C   L+S S   +G+W   SC  + +  IC K +               G E+      + + +  + + +AL  C+ R   L  V +  T  +L + ++ L    +  L G +     +W+   ++ L +  W +G+   Q+   C   + DG WR  SCD K
Sbjct:  253 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-----STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQ-EVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIY-----NWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAVLD-LASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFS-RAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVY-MTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFI--TASLPNVTFDLWIGLHASQRDFQWV--EQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVS--EEPLNYVGWQDGEP--QQPGGCTYVDVDGAWRTTSCDTK 1237          

HSP 3 Score: 138.658 bits (348), Expect = 3.835e-32
Identity = 230/1170 (19.66%), Postives = 440/1170 (37.61%), Query Frame = 1
Query:  541 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKES---------------KIEVLKKITVLNKELVIFK-ERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYK-----------NIGSR-GFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVH-GLYYKNGLWNDIKC-DYKNSVICSKDI------------------------LNSNETIKQQQKYYVHEVLV---TYEEAINFCNQHNCRIVKISNVE--------TNKIIYEWSKNMKIGR-FWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKT---------KNYLIYEYESTAE--------KEITIEIMEGKVNYIKALELCKSKGYDLIRIENE-EINKIVYDVA--TKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLC-----YKPFXXXXXXXXXXGKIDT------SKYFVHTG-----RVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFAN-------------GKWNDFSCSTK-NSFI------------------YYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSN--GFWNDIACNSK-NSFIC--SKYSPPIIFIDEHMS-----------------YKIFINKVT-YREAVDKCQSEGYSLIKV--ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASL-PSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYKP 3540
             Q   ++  A A C+ +G  L+ I +    + +  L   Y     WI  ND+   G +  SD   + Y  +   +P+N    E+C      S+  W +  C+ +   +C K+                K+E               + E+ ++ +++  C   G  LV I        +    ++  +   WI  ND++++  FE SD + + F+ W   EPNN+++  EDCV  ++     WND  C      IC K           + G R G+T    S     + E++V +  A+ LC ++G +L+ I    +   ++S+IY++  ++    +W    D+ +  +F +    ++ Y  W   +P  Y    CV        GLW    C  ++   IC + +                          S+  ++   K +  E L    ++ +A   C +   +++ +++ E         NKI  E    +     FWI  N     G   W  S G    Y N+ ++  ++ +   C   +   + +W  + C T         +   + E + + +        +E   +  E    + +A  +C     +L  + ++ E++ + +++   ++ +   +WI  +    +G+F ++DG  I++ ++A G+P     ++ CV+ +  +   W D  C +    +C      K  +         G   +      +K F   G     RV + EA   C+    +LVTI N  L+   +  +  +     W+  +  +++ +WV  +   L Y NW  GEP+  G      GN   +             G+W+D SC+ + + FI                      E         + ++ + + +A   C  +  SL  + +  T Q     A +      WI    +    ++   +   L Y  +  GEP   G      G  Y +  G W   +C++K    +C  S   PP   I  H S                 Y   +  +  ++EA  +CQ  G +++ +  E  ++    H  S   +    W+    +   G   + D   + + NW    L PS   +N+C Y  ++ SG W   +C +    V+C  P
Sbjct:  253 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDN-PSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSC--YWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPG-YSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAVLDLA-SLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVY-MTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNP-LEQAFITASLPNVTFDLWIGLHASQRDFQWVEQE--PLMYANWAPGEPS--GPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYT-QAFLTQAARGLRTPLWIGLAGEEGSRRYSWVSEEPLNYVGWQDGEPQQPG------GCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSC-YWIQSNSGLWRPGACTNITMGVVCKLP 1396          

HSP 4 Score: 136.732 bits (343), Expect = 1.467e-31
Identity = 180/866 (20.79%), Postives = 340/866 (39.26%), Query Frame = 1
Query: 1711 VTYEEAINFCNQHNCRIVKISNVE----TNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITI-----------------------EIMEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKI-------DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCST-KNSFIYYYIENIISTKEL--------------------------------EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKI-GQ----------YWIDANDKAVEG--KFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC-------------SKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLS--LRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKY-------YIHRIGVTFQ-------------EALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ-------KTQNC--LQGNPD----GKWRDVSCDDKNPFFF 3909
            +++ EA   C Q    ++ I+ +      N ++  +S  +     WI  ND+ T G W  S  + L YLNW  ++P+N + E+C       +G W +  C      + + +  A  E T                         +   K ++ ++ + C   G DL+ I +  E+  I   +  K +V + WI  ND+ ++  F +SDG  +S+ ++   EPNN  +  EDCV  ++   G WND  CN     +C K  +  +   +E+            S Y++   +VTY EA R C  H  +LVTI N      + +L    +   +W    D+   G +  + G+++ Y +WN+ +P  Y    C+ L    A G W   +C++ +  +I         T EL                                E  +++ ++ +AQ  C + G  L+ + + E    + ++   NKI G+          +WI  N +   G   +  S+     Y  F R   ++     C   L  ++  W  + C+++  +IC             S          +   YK F +  T+ +A   C      L  V + +++ F+ H L    R +  ++WI    S++DG++ ++DG  + F +W         ++  C+Y + +    W    C++    IC + + T +T      T         +I  +   FQ             EA   C+++  +L+ + N     ++      ++ +  W+  +    +  W+  +++ L + NW  G+ +         K  +C  +  +P     G+W D SC ++   F 
Sbjct:  257 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTL-----WIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQI--KQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQP-GYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANML--NKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAV-LDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASRE-DWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFD-LWIGLHASQRDFQWV--EQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFI 1106          

HSP 5 Score: 85.8853 bits (211), Expect = 4.865e-16
Identity = 111/577 (19.24%), Postives = 212/577 (36.74%), Query Frame = 1
Query:  124 IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVIC-----YKNTQPK----------TSHVIKLLNRELII----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ------KNEHCVHGLYYSNA----LWNDISCAD-SNAVICYKESKIEVL-----------KKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCED-LNAVIC--------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLL---------CKNNGYELLKIDSDEINSMIYDFAVKHNIGT--YWIDANDIQTENTFVYSDSKKISYQKWYPG--EPNNYENEDCVHGLYYKNGLWNDIKC-DYKNSVIC 1641
            +  Q      F+  +T+ +A ++C      L  +           N Q ++ A + H   +WI  +  + +G F + +G  I +  +A G+P    +++ CV+    ++  W D  C      IC      K TQP            S  I+ LN+   +     Q +  +  A   C+ +  QL+ I +  L       ++       WI  +  Q +  ++  +   ++Y  +APGEP+         K   C   L+  +A     W+D SC + ++  IC K +   +             +++ LN    + ++ L ++ A  LC+S+   L  + D  +       A +      WI          +    +  + +  W  GEP   Q   C +     +  W    C+  L   +C         + I   G     +++   + F E     H +LL         C+  G  +L I  +  N  +++    +   +   W+  N      T V+ D+  ++Y  W P    P+   +  C + +   +GLW    C +    V+C
Sbjct:  830 LRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQH---WWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASRED-WGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNP-LEQAFITASLPNVTFDLWIGLHASQRDFQWVEQE--PLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDP-YTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVSEEPLNYVGWQDGEPQ--QPGGCTY--VDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSC-YWIQSNSGLWRPGACTNITMGVVC 1393          
BLAST of Mannose-binding protein C vs. Ensembl Human
Match: LY75-CD302 (LY75-CD302 readthrough [Source:HGNC Symbol;Acc:HGNC:38828])

HSP 1 Score: 83.1889 bits (204), Expect = 3.141e-15
Identity = 184/885 (20.79%), Postives = 331/885 (37.40%), Query Frame = 1
Query:  106 PKISAEIELQSKYVIIFQEKT---------TFTEANKLCQAKGYNLI----KIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKF----AKGE---PNNYRNED----CVHGMFYK----DGFWNDISCDDTNSV-ICYKNTQPKT-------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSN-AVICY-----KESKIEVLKKI----TVLNKELVIFK---------ERLTYYKAQDLCKSQGYKL------VKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISN-KE----------------IVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWID-ANDIQTENTFVYSDSKKISYQKWY-PGEPNNYENEDCVHGLYYKNGLWNDIKCD-YKNSVICSKDILN--------------SNETIKQQQKYYVH-----EVLVTYEEAINFCNQHN--CRIVKISNVETNKIIYEWSK--NMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKEITIEIMEG---------KVNYIKALE-LCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINV-------EGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISC--NSINSVLC 2388
            P  +A+++   ++ I FQ K          TF++A+  C + G  L     +IE D   + + ++         WI       E   ++ + + + Y  F      G    P N+  E+    C   +  +     G WN  SC + + V +C K ++ K+       S  +K LN    I+ +  T+ +A   C     QL+ I D    + +   A+ +     WI      +E NF  SDGK++ + ++A  E N   + E CV  +  ++  W  + C D+    ICY      E +++ +  +     VLN   + F+         +       QD   ++  KL      + I DE+ N+ V    +  N    W+         +    DK  + ++ W AG P   +NE  + GL   +  W DI+   +     Y +  S    K E+ + KE                  + ++KV +  A  +C  +G  L  + +      + D  VK +    W+  ++   +E++F +SD     Y  W     P N     CV  L    G W   KC+  K+  IC K   +              + E   +  +Y  H     + L ++ EA   C++H+    IV I + + NK +    +  N    R W+  +    +  W    G+++ ++ W     +       L  +   N  W  + C+     ++ +          I+  +          KV  I+ +   C   G D+I I NEE N  + D   K      W   +DI +       +  F + D  N+++  +   + +    + C   L    G W   +C  +S+   LC
Sbjct:  943 PDSAAKVQCSEQW-IPFQNKCFLKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDME-----ATLWIGLRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVSITDPYQQAFLSVQALLHN-SSLWIGLFSQDDELNFGWSDGKRLHFSRWA--ETNG--QLEDCV--VLDTDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFIITKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYRNKSLMWFDKTPLSYTHWRAGRP-TIKNEKFLAGL-STDGFW-DIQTFKVIEEAVYFHQHSILACKIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLFLEDI-VKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGN-----CV--LLDPKGTWKHEKCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAKKLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVTFVKWENKSKSGVGRCSMLIAS---NETWKKVECEHGFGRVVCKVPLDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQ-----WKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAF-LHIKTGEWKKGNCEVSSVEGTLC 1794          

HSP 2 Score: 83.1889 bits (204), Expect = 3.447e-15
Identity = 163/790 (20.63%), Postives = 302/790 (38.23%), Query Frame = 1
Query:  532 LIILQEKTTYENAIAHCKSKGFQLI----KIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAP----GE---PNNYQKNE---HCVHGLYYSNA----LWNDISCADSNAV-ICYKESKIE-------VLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCED--------------------LNAVICYKNIGSRGFTKFE--------ISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKC---------DYKNSVI-CSKDILNSNE----TIKQQQKYY--VHEVL---VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN-GNDIITEGKWVDSKGNKLVYLNW-AKNEPNNYNNEDCLEGNFYPNGEWNDISC---------------KTKNYLIYEYESTAEKEITIEIMEGKVN----------YIKALELCKSKGYD--LIRIENEEINKIVYDVATKNK--VGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISC-NSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTG-RVTYEEALR-FCQIHSCRLVTIENSELDILILNLARKH 2580
            L I     T+  A   C S G  L     +I+ D + S++ ++     IG  W     +        +D +++ Y  F P    G    P N+ + E   HC   L    +     WN  SC++ + V +C K S+++         + +  LN    I  + LT++ A+  C     +LV I D    + +   A+ +N    WI       E  F  SD  ++ FS+WA     N Q EDCV  +   +  W  + C D                    +++V C   + +  +  F+          N+ +   +++V  K  +L   N    +L I  ++ N+ + +  +  N    W+         + ++ D   +SY  W  G P   +NE  + GL   +G W DI+           +++S++ C  ++++  E    T+ Q   Y   ++ V+   VT+ EA+N C+Q    +  + N +  ++  E          W+   +   +E  +  S G+   Y+ W  +  P N    D       P G W    C               K  + L Y     A KE     ++ K +          + +A +LC    +   ++ I++E+ NK V  +  +N     + W+  +  +V+  + + DG  ++   F   E  +++       L  +N  W  + C +    V+C  P         +    D+   F+    +V   E +R  C  H   +++I N E +  IL+  +K 
Sbjct:  964 LKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYEKINKW-----TDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVSITDPYQQAFLSVQALLHN-SSLWIGLFSQDDELNFGWSDGKRLHFSRWAE---TNGQLEDCV--VLDTDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFIITKNRHMATTQDEVHTKCQKL---NPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYRNKSLMWFDKTPLSYTHWRAGRP-TIKNEKFLAGL-STDGFW-DIQTFKVIEEAVYFHQHSILACKIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHN-QNGQLFLEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGNCVLLD-------PKGTWKHEKCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAKKLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVT---FVKWENKSKSGVGRCSMLIASNETWKKVECEHGFGRVVCKVPLDCPSSTWIQFQ--DSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQ 1723          

HSP 3 Score: 76.6406 bits (187), Expect = 3.430e-13
Identity = 138/682 (20.23%), Postives = 255/682 (37.39%), Query Frame = 1
Query:   49 WNDFSCEDPSAV-ICYKETEPKISAEIELQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICY-------KNTQPKTS--HVIKLLNRELIILQE-------------KTTYENAIAHCK--SKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISC--ADSNAVICYKES----KIEVLKKITVLNKELVIF-----------KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKW-AAGEPNNYQNEDCVHGLYYKNALWNDIKCEDL-NAVICYKNIGSRGFTKFEISNKEIVIFEEKV-----------------VFKHAQLLCKNNGYE--LLKIDSDEINSMIYDFAVKHNIGTY--WIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYK-NSVICSKDILNSNETIKQQQK---YYVHEVLV--TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDII 1857
            WN  SC +   V +C K +E K    ++  S+ V        I  +  T+  A + C      L+ I D  +     ++    H    WI       E  F + +G+R+ + ++A+    N + EDCV  +   DGFW  + C+D     ICY       K  +P  S      +LN   I  Q               TT +     C+  +    ++ I D++ N+ V    + +     W+         + +  D   + Y  +  G P    KNE  + GL  ++  W DI        AV  ++ S    KIE++      N  L  F           ++++T+Y+A ++C   G  L  + ++     + +   ++    +   ++    E +FE SD +   +  W     P N     CV  L      W   KC  + +  ICYK   S+  ++   S++     E                     F  A+ LC  + +   ++ I  ++ N  +     ++N  T   W+  +    + ++ + D  ++++ KW   E  +         L   N  W  ++C++    V+C   +   + T  Q Q     ++ E +   + E+  N C  H   ++ I N E N  I +      + + W   +DI+
Sbjct: 1075 WNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVSITD-PYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAE---TNGQLEDCV--VLDTDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFIITKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYRNKSLMWFDKTPLSYTHWRAGRPT--IKNEKFLAGLS-TDGFW-DIQTFKVIEEAVYFHQHSILACKIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLFLEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGN-----CV--LLDPKGTWKHEKCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAKKLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVTFVKW---ENKSKSGVGRCSMLIASNETWKKVECEHGFGRVVCKVPLDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILD-----TLKKQWKGPDDIL 1731          

HSP 4 Score: 75.8702 bits (185), Expect = 5.058e-13
Identity = 212/1036 (20.46%), Postives = 369/1036 (35.62%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN--NYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR-FWINGNDIITEGKWVDSKGNKLVYLNWAKNEPN-NYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEK--------------------EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIV--YDVATKNKVGQYWINANDINVEGQF----IYSDGQNISYRNFAHGEPNNQNNEDCV-HGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKID-------------TSKYFV-HTGRVT----YEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWL----DGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANG---KWN-----------DFSCSTKNSFI-------------YYYIEN--------IISTKELEIFKE-RVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIG-------QYWIDANDKAVEGKFVDSNNHALKYSKFPRGE-PNNYGNEDCVHGLYYSNGFW-----NDIACNSKNSFICSKY------------------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSET--------------LSGKWLGTSCVSKNSV-ICYKPS--KTIDTGKEVKKTKYYIHRI------GVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNW--TNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDENEQCKE 3942
            +  + +K A + C+N G +LL I+S     + Y    +     +WI  N + +   + +SD K +++  W P  P+        C   +  ++GLW    C+ +   +C K + N+ E                       Y +     ++++A   C   +  ++ I ++   +++     N  I    WI   +I     +  S G ++    W +NEPN  YN            G+W   SC+ K  L Y  +   EK                    E   +I E +V +     L  +      R E E +N ++  YD + +     +W    D++  G++    +    + +++ N+   EP +     CV      + G W    C S  ++   K        ++   K D              S Y V H  R+     +EEA RFCQ     L +  + +     L+         +WL    +      +G W   D   +  +        +Y   DC     F       W+            F+C TK  ++             +Y  +         II   E     +  + +EEA   C      L  I        +   A+KNKI        ++WI  ++  ++  F         YS++P    P  +G E+C   LY S   W         C++K  FIC KY                  S   I        KI    +T+ +A D C S G +L  V +  +  FI   L      +   +  T  +   KWT  D ++LT+ N+    +          +  E+               +G W  TSC  ++ V +C K S  K+  T +   +T  Y++ +       +T+  A   C +   +L+ + +     +L  +   L     W+    +D+E  +  SD K+L F  W  TNG++     ++C+  + DG W+ V C+D  P    +   NE  KE
Sbjct:  235 QTALSWKEAYVSCQNQGADLLSINS--AAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFLNWDPDRPSAPTIGGSSCAR-MDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTRCDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEEVWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK--LKYVCKRKGEKLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGTNCNLTITS-----RFEQEYLNDLMKKYDKSLRK---YFWTGLRDVDSCGEYNWATVGGRRRAVTFSNWNFLEPASPGG--CVAMSTGKSVGKWEVKDCRSFKALSICKKMSGPLGPEEASPKPDDPCPEGWQSFPASLSCYKVFHAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHFLTDQFSGQHWLWIGLNKRSPDLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYDDREFIYLRPFACDTKLEWVCQIPKGRTPKTPDWYNPDRAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYCASNHSFLATI-----TSFVGLKAIKNKIANISGDGQKWWIRISEWPIDDHFT--------YSRYPWHRFPVTFG-EEC---LYMSAKTWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQNKCFLKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYEKINKWT--DNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVSITDPYQQAFL-SVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAETNGQL-----EDCVVLDTDGFWKTVDCNDNQPGAICYYSGNETEKE 1230          

HSP 5 Score: 59.3066 bits (142), Expect = 6.588e-8
Identity = 197/979 (20.12%), Postives = 350/979 (35.75%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPN--NYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIG-------------SRGFTKFEISNKEI-VIFEEKVVFKHAQLLCKNNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENE--DCVHGLYYKNGLWNDIKCDYKNSVICSK--DILNSNETIK-----QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVE---TNKIIYEWSKNMKIGRFWINGNDIITEGK--WVDSKGNK--LVYLNWAKNEPNN---------------YNNEDC-----------LEGNFYPN--GEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYW----INANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL---WN-----------DISCNSINSVLCYKPFXXXXXXXXXXGK-----------IDTSKY-FVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGND-IKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKW-----NDFSCSTKNSFI--YYYIENI----------ISTKE----------LEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVE--GKFVD------SNNHALKYSKFPRGEPNNYGNEDCVHGLYYSN-------GFWNDIACNSKNSF-ICSKYS-----PPIIFIDEHMS-----YKIFINKVTYREAVDKCQSEGYSLIKVENS------DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNW 3417
            L++ +A   C++QG  L+ I+      + Y    +     +WI  N +     +E SD   + F  W    P+        C   +  ++ LW    CE     +C K +              +R    +  +N    ++  E   +  A   CK    +L+ I    D + + + +++  +K  +   WI   +I     F +SD  +++   W   EPN   N+  +CV  L  + G W    C+ K   +C +  + LN   + K     +  K +       YE+ + F    NC +   S  E    N ++ ++ K+++   FW    D+ + G+  W    G +  + + NW   EP +               +  +DC           + G   P       D  C  + +  +    +  K    E +  K N+ +A   C++ G  L    + +  K      T    GQ+W    +N    +++G + +SD   +S     +    + +  DC     +       W+             +C++    +C  P                        I+ S+Y FV    + YEEA+ +C  +   L TI +      +   A K+KI+    DG     +  EW   D        W++  P  +G E+CL   Y +   W         CSTK  FI   Y + ++          +   E          L+I    +TF +A +TC   G +L  + + +  Q+     + +     WI     A E   K+ D      SN H L  S   R   N +  E   H     N       G WN  +C+ ++   +C KYS       +    E +      YKI    +T+  A  +C      L+ + +        +  ++H  SL       WI      ++  + +SDG++L F  W
Sbjct:  238 LSWKEAYVSCQNQGADLLSINSAA--ELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFLNWDPDRPSAPTIGGSSCAR-MDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTRCDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEEV---WIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYL-GELGQWKVQSCEEKLKYVCKRKGEKLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGT--NCNLTITSRFEQEYLNDLMKKYDKSLR-KYFWTGLRDVDSCGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAMSTGKSVGKWEVKDCRSFKALSICKKMSGPLGPEEASPKPDDPCP-EGWQSFPASLSCYKVFHAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHFLTDQFSGQHWLWIGLNKRSPDLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYDDREFIYLRPFACDTKLEWVCQIPKGRTPKTPDWYNPDRAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYCASNHSFLATITS-----FVGLKAIKNKIANISGDGQKWWIRISEWPIDDHFTYSRYPWHRF-PVTFG-EECL---YMSAKTWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQNKCFLKIKPVSLTFSQASDTCHSYGGTLPSVLS-QIEQDFITSLLPDMEATLWIGLRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVSITDPYQQAFLSVQALLHNSSL-------WIGLFSQDDELNFGWSDGKRLHFSRW 1187          
BLAST of Mannose-binding protein C vs. Ensembl Human
Match: MBL2 (mannose binding lectin 2 [Source:HGNC Symbol;Acc:HGNC:6922])

HSP 1 Score: 78.1814 bits (191), Expect = 3.967e-15
Identity = 44/116 (37.93%), Postives = 65/116 (56.03%), Query Frame = 1
Query: 2431 GKIDTSKYFVHTGRV-TYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYG-NEDCLLGNYFANGKWNDFSCSTKN 2772
            GK   +K+F+  G + T+E+    C      + T  N+  +  I NL ++    G      D K EG++V++ GN+L Y NWN+GEPNN G +EDC+L     NG+WND  CST +
Sbjct:  131 GKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGI----TDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVL--LLKNGQWNDVPCSTSH 240          

HSP 2 Score: 64.3142 bits (155), Expect = 2.276e-10
Identity = 37/107 (34.58%), Postives = 58/107 (54.21%), Query Frame = 1
Query: 2833 ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            E +TFE+ +  C+K   S+    N   N  I +L  +    + ++   D+  EG+FVD   + L Y+ +  GEPNN G +EDCV  L   NG WND+ C++ +  +C
Sbjct:  144 EIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE----EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCV--LLLKNGQWNDVPCSTSHLAVC 244          

HSP 3 Score: 62.7734 bits (151), Expect = 7.340e-10
Identity = 34/108 (31.48%), Postives = 56/108 (51.85%), Query Frame = 1
Query: 1708 LVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY-NNEDCLEGNFYPNGEWNDISCKTKNYLIYEY 2028
            ++T+E+    C +    +    N   N  I    +N+     ++   D  TEG++VD  GN+L Y NW + EPNN  ++EDC+      NG+WND+ C T +  + E+
Sbjct:  145 IMTFEKVKALCVKFQASVATPRNAAENGAI----QNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVL--LLKNGQWNDVPCSTSHLAVCEF 246          

HSP 4 Score: 55.0694 bits (131), Expect = 2.447e-7
Identity = 39/119 (32.77%), Postives = 57/119 (47.90%), Query Frame = 1
Query:  907 VLNKELVIFKERLTYYKAQDLC-KSQGYKLVKIDDEQFNSIVYNYAVQNNIGR-YWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNY-QNEDCVHGLYYKNALWNDIKCEDLNAVIC 1254
            V NK  +   E +T+ K + LC K Q       +  +      N A+QN I    ++   D + EG F D   N++ ++ W  GEPNN   +EDCV  L  KN  WND+ C   +  +C
Sbjct:  134 VGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAE------NGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCV--LLLKNGQWNDVPCSTSHLAVC 244          

HSP 5 Score: 55.0694 bits (131), Expect = 2.562e-7
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 1
Query: 2194 QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ-NNEDCVHGLFYTNGLWNDISCNSINSVLCYKP 2397
            + ++   D   EGQF+   G  ++Y N+  GEPNN  ++EDCV  L   NG WND+ C++ +  +C  P
Sbjct:  181 EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCV--LLLKNGQWNDVPCSTSHLAVCEFP 247          

HSP 6 Score: 54.6842 bits (130), Expect = 3.733e-7
Identity = 40/131 (30.53%), Postives = 62/131 (47.33%), Query Frame = 1
Query: 1261 NIGSRGFTKFEISNKEIVIFEEK---VVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY-ENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            ++G +   KF ++N EI+ FE+     V   A +    N  E     +  I ++I + A        ++   D +TE  FV     +++Y  W  GEPNN   +EDCV  L  KNG WND+ C   +  +C
Sbjct:  129 SLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAE-----NGAIQNLIKEEA--------FLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCV--LLLKNGQWNDVPCSTSHLAVC 244          

HSP 7 Score: 53.9138 bits (128), Expect = 5.539e-7
Identity = 35/118 (29.66%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  127 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVIC 477
            ++ +K+ +   E  TF +   LC     ++    +   N  + NL I+  A   ++   D K EG F  + G R+ Y  + +GEPNN   +EDCV  +  K+G WND+ C  ++  +C
Sbjct:  133 QVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNL-IKEEA---FLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCV--LLLKNGQWNDVPCSTSHLAVC 244          

HSP 8 Score: 51.9878 bits (123), Expect = 2.531e-6
Identity = 22/59 (37.29%), Postives = 32/59 (54.24%), Query Frame = 1
Query:  691 DMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVIC 867
            D + EG F+   G ++ Y  +  GEPNN   +E CV  L   N  WND+ C+ S+  +C
Sbjct:  188 DEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCV--LLLKNGQWNDVPCSTSHLAVC 244          
BLAST of Mannose-binding protein C vs. Ensembl Human
Match: PLA2R1 (phospholipase A2 receptor 1 [Source:HGNC Symbol;Acc:HGNC:9042])

HSP 1 Score: 81.2629 bits (199), Expect = 1.268e-14
Identity = 227/1147 (19.79%), Postives = 411/1147 (35.83%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAG---EPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK-------NIGSRGFTKFEISNKEI----------VIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENED--CVHGLYYKNGLWNDIKCDYKNSVICSK--DILNSNETIKQQQ-------KYYVHEVLVTYEEAIN--FCNQHNCRIVKISNVETNKIIYEWSKN---MKIGRFWINGNDIITEGKW----VDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCK--------------------------TKNYLIYEYE---STAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEE----INKIVYDVATKNKVGQYWINANDINV--EGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDT-------SKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISG--YWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFA-NGKWNDFSCSTKNSFI-----YYYIENIISTKE------------------LEIFKERVTFE---EAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWI----DANDKAVEGK-FVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSN------GFWNDIACNSKN-SFICSK--------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNW--QTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYKPSKTIDTGKEVKKTKYYIHRI--------------GVTFQEALDFCKERRCKLIVVDNIDTNIYLWE--LSKKLSIEKYWLNGN-DKDNEG-AWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGN-PDGKWRDVSCDDKNPF 3903
            L++ +A   C+ QG  L+ I DE   + +  +     +   W+  N +     ++ SD   + +  W+     EP  +  + C     +  + W    CE     IC K        I  +   K+  ++ E            + +E+  +  A   C+ +   L+ I S      +       N    WI  +  +   +F +S+   + +  W+  EP+ + N    CV       G W    C+ +   IC K   +L+  E+  Q+         Y +  VL ++++A +  +C      +V I+N      I     +   MK   FWI   D    G++    V  K   + Y +W  ++P        + G  +P G W    C+                             YL +E E   ++  K    E +  K  + +A   C+  G  L    + E    +N++++      +  Q+WI  N  N    G + +SD   +   +F       ++  +C   ++  N     + C S    +C  P ++ K +     + D        ++Y  HT    +      C      L+TI ++     I +  +     G  +W+   + +   E+   DG  + Y NW+ G      N+    G   +  G W    CS     I      + IE    T +                  L I K+  +++    AQ+ C ++G +LV I++ E  Q    + +  +    WI    D  +  + GK  V SN         P            +  L  SN      G W    C  +   F+C K              Y  P      + +YKI    +T+  A+  C      L+ + +    SF+  T+ L      +WI    + N   + +SDG + +F  W  + +SL  D     C+++    +G+W  T+C S     IC+ P +T  +      ++  I  I               ++F+ A +FCK+    L+ + +   N +L E   +   S++  WLN   D +NE   W D      + +       +  K  +C+    P+G W+   C +K  F
Sbjct:  251 LSWSEAHSSCQMQGGTLLSITDETEENFIREHMSSKTV-EVWMGLNQLDEHAGWQWSDGTPLNYLNWSPEVNFEP--FVEDHCGTFSSFMPSAWRSRDCESTLPYICKKYLNHIDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSA-EQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQASSGYYCPP---ALVTITNRFEQAFITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEPVQYTHWNTHQPRYSGGCVAMRGR-HPLGRWEVKHCRHFKAMSLCKQPVENQEKAEYEERWPFHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVNELLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPV-VSSFLDNTYFGEDARNC--AVYKANKTLLPLHCGSKREWICKIP-RDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVCSWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWDTGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPKGWLYFNYKCLLLNIPKDPSSWKNWTHAQHFCAEEGGTLVAIES-EVEQAFITMNLFGQTTSVWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTGKWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIKTCLMHKAQLVSITDQYHQSFL--TVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKDEESSLLGD-----CVFADS--NGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSNCYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFDGNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGF 1375          

HSP 2 Score: 56.225 bits (134), Expect = 4.597e-7
Identity = 151/732 (20.63%), Postives = 269/732 (36.75%), Query Frame = 1
Query:  874 ESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVK---IDDEQF-NSIVYNYAVQNNIGRYWIDANDVRI--EGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYK-NALWNDIKCEDLNAVICYKNIGSRGFTKFEIS-NKEIVIFEEKVVFKHA--------QLLCKNNGYELLKIDSDEINSMIYDF--AVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYK-NGLWNDIKCDYKNSVIC----------SKDILNSNETIKQQQKYYVHEVLVT-----------YEEAINFCNQHNCRIVKI-SNVETNKI---IYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLE--------------GNFYPNGEWNDISCKTKNYL------------------IYEYESTAE-KEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVG-QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNS-INSVLCYKPFXXXXXXXXXXG--------KIDTSKYFVHT--GRVTYEEALRFCQIHSCRLVTIENSELDILILN--LARKHKISGYWL----DGNDIKKEGEWVNIDGNKLKYLNWNQGEPN-NYGNEDCLLGNYFANGKWNDFSCSTKNSFI 2781
            ES+  +     V + E V+ K   T+ +A+  C+  G  L     I++E F N ++++        ++WI  N       G++E SD+  +     ++   N Y  ED  +   YK N     + C      IC      +    F    +   + +++     H         + +C     +LL I S      I+    A+     ++WI   + +  + F + D   + YQ W  G      N+    G      GLW   +C      IC           KD    + T  +   Y+ ++ L+            +  A +FC +    +V I S VE   I   ++  + ++ IG   +  +D  T   W++  G  +VY NW+  +  N  + +  E               NF+  G+W    C  + Y                   +Y   +T E    T +I+   + +  A++ C      L+ I ++     +  V   N++G  +WI     +    F +SDG   S+  +   E +     DCV     +NG W+  +C S +   +C+ P +  + E  E          K  ++ Y   T    +++E A  FC+     L+TI++   +  +L    A    +   WL    DGN+  +  +W   DG      NW   +P+ +Y      +      G W    C  K  FI
Sbjct:  669 ESEPGLASCFKVFHSEKVLMKR--TWREAEAFCEEFGAHLASFAHIEEENFVNELLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVV----SSFLDNTYFGEDARNCAVYKANKTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVCSWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWDTGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPKGWLYFNYKCLLLNIPKDPSSWKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTSVWIG---LQNDDYET---WLN--GKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTGKWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIKTCLMHKAQLVSITDQYHQSFLTVVL--NRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKDEESSLLG--DCVFA--DSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSNCYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFDGNN--ETIKW--FDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGFI 1376          
BLAST of Mannose-binding protein C vs. Ensembl Celegans
Match: clec-187 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9XUA7])

HSP 1 Score: 56.9954 bits (136), Expect = 3.690e-8
Identity = 57/259 (22.01%), Postives = 100/259 (38.61%), Query Frame = 1
Query:  937 ERLTYYKAQDLCKSQGYKLVKI---DDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIG---SRGFTKFEISNKEIVIFEEKVVFKH--------------AQLLCKNNGYELLKIDSDEINSMIYDFAVK---HNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICS 1644
            +RL +  AQ  C + G  LV++    D ++ + +         G +WI      ++G +E  D +   +  WA G P  +   D V G    NA W  ++   +   ICY   G   ++  T     N   +    +++ +H              A+  C++ G  L   D     + +   +V     N G++W+       +NTF ++D    S + W PG P  ++    V      NG W   + D     +CS
Sbjct:   41 QRLLFPDAQTHCATLGGVLVRVRGDQDGRWLAAIAGTEFHATYGNFWIGLQ--LVDGQWEWEDASTSTYKNWAPGYP--FSGYDYV-GAQLSNAKWVTVRSSLMLPFICYYQKGHNRNQLTTPAPSQNPGGICTGAELLLEHRCYSFIPTLLPYAAAKQKCESIGKTLAIFDDQMQINFVTSVSVSKFSMNYGSFWVGLTKNTADNTFHWADGNVNSLKNWTPGYPFQHQT---VVSQQVSNGKWKTSETDTLLPSVCS 291          
BLAST of Mannose-binding protein C vs. Ensembl Celegans
Match: clec-51 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:W6RTE8])

HSP 1 Score: 56.6102 bits (135), Expect = 5.368e-8
Identity = 52/243 (21.40%), Postives = 95/243 (39.09%), Query Frame = 1
Query: 2038 AEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINAN----DINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC-YKPFXXXXXXXXXXGKIDTSKY---------FVHTGRVT-YEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDI-----KKEGEWVNIDGNKLKYLNWNQGEPNNYGNE 2706
            A     + +     ++  A E+C +    L+ I N   N  +   A K   G  W+ A     D+     + ++DG N  Y+N+  G+P+ Q +  C+  L      W   +C +    +C Y                  S Y         + +T R T + +A   CQ     L +I ++  +  +++L++    +      +D+      +  +W   DG+ + +LNW  GEPNN   E
Sbjct:   28 ASGSRCLNVFRTASSFQSAEEICATLSGHLVSIHNTIDNTFISSQAQKYFDGGVWLGAKTTAPDVTNPLNWYWTDGSNFDYQNYKVGQPSPQGDTACMQ-LQTGTAKWQTTNCTAQLPFICSYSSSVTPTCPSVTIPSHCPSGYTWYDETDFCYKNTVRFTSFNDARSSCQADGGDLASIHSANENQFLVDLSKAGITNKDKSHSDDVFIGLVYQNSKWQWTDGSAVNFLNWGDGEPNNMDKE 269          

HSP 2 Score: 52.7582 bits (125), Expect = 7.704e-7
Identity = 58/247 (23.48%), Postives = 97/247 (39.27%), Query Frame = 1
Query: 2809 TKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGK------FVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSP-----PIIFIDEH------------MSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKN--------DGKWTFSDGQQLTFKNWQTASLPSDKENNN 3456
            ++ L +F+   +F+ A+  C      LV I N   N  I   A K   G  W+ A   A +        + D +N    Y  +  G+P+  G+  C+  L      W    C ++  FICS  S      P + I  H              YK  +   ++ +A   CQ++G  L  + +++ +  +  LS +  + N   D + S +        + KW ++DG  + F NW       D E NN
Sbjct:   31 SRCLNVFRTASSFQSAEEICATLSGHLVSIHNTIDNTFISSQAQKYFDGGVWLGAKTTAPDVTNPLNWYWTDGSN--FDYQNYKVGQPSPQGDTACMQ-LQTGTAKWQTTNCTAQLPFICSYSSSVTPTCPSVTIPSHCPSGYTWYDETDFCYKNTVRFTSFNDARSSCQADGGDLASIHSANENQFLVDLS-KAGITNK--DKSHSDDVFIGLVYQNSKWQWTDGSAVNFLNW------GDGEPNN 265          
BLAST of Mannose-binding protein C vs. Ensembl Celegans
Match: clec-4 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9NAK5])

HSP 1 Score: 54.299 bits (129), Expect = 4.343e-7
Identity = 66/266 (24.81%), Postives = 111/266 (41.73%), Query Frame = 1
Query: 2800 IISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNK----IGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPN-NYGNEDCVHGLYYS-----NGFWNDIACNSKNSFIC---SKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLS-----GKWLGTSCVSKNSVICYKPS 3543
            +I+ K L IF +  T   A+ TC   G +LV + N   N+ I D    N     +G Y  D++    +  + D+   A  Y  F  G P+   GN  CV   YYS      G W    CN + SFIC   + ++ P  +      Y       TY +    C+ E  +L  + +++ +  + T   R    +  + G    +D  + + DG    ++N+     P +  ++ C+  S   S     G W    C ++ SV+C +P+
Sbjct:   33 LINGKCLRIFVDVSTHTAAEKTCKGYGATLVTVKNSIDNRAIADFTGNNANLFWMGLYCFDSD--VSKCLWDDATGSAEVYDNFAAGFPHIALGN--CV---YYSVQGALAGMWLSSDCNDRRSFICELPASHADPCPYNYNGFCYTFHNTASTYTKGQKICEQECGNLASIHSANENRYIMTFGGRATKEDLLLGGMWPADD-VYNWVDGSLWEYENFD----PINVRDSVCVIMSNGDSRPIALGMWYSGECKNEYSVVCKRPA 286          
BLAST of Mannose-binding protein C vs. Ensembl Celegans
Match: clec-50 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9XUL7])

HSP 1 Score: 53.5286 bits (127), Expect = 5.266e-7
Identity = 66/295 (22.37%), Postives = 115/295 (38.98%), Query Frame = 1
Query: 2449 KYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILI----LNLARKHKISGYWLDGNDIKKEGEWVNIDGN-KLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI-----------------------------------FKERV----TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAV-----KNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCV-------HGLYYSNGFWNDIACNSK-NSFICSKYS 3162
            +YF  T    +E A   C +    L +++N + + L+     N  ++   S YW+  ND++  G W   D +    Y NW  GEP +    DC + +   +G W+   C++   ++   +  +I T                                        F  RV     +E+A+  C+  G  L  + +E  N  + +LA       N     WI  +   V   +V ++     Y  +   +P+N G E+CV       H  +Y N  WN+ AC+++  ++IC K S
Sbjct:   35 QYF--TAPAQFEFAEEQCNLLGGHLASVQNGQENALLQSNAANSFKRSNYSDYWIGANDLETSGTWKWTDPSVTFDYSNWQLGEPQS--GSDCAIQDK-GDGTWSAIGCTSYRPYV--CVTPVIMTATCPPITTPIPTTCPTPAPCPVKTCVPSCDQGWTYFAPTDFCYRVYHNAKWEDAEAACVLLGAHLTSVHSETENTFVANLASCGIKEGNPKDLAWIGMHK--VGQDWVWTDGTPSNYINWAPKQPDNPGKENCVETAPDLSHDKWYEN--WNNEACSTEMRAYICKKGS 318          

HSP 2 Score: 50.0618 bits (118), Expect = 7.844e-6
Identity = 62/280 (22.14%), Postives = 104/280 (37.14%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAV----KHNIGTYWIDANDIQTENTFVYSD-SKKISYQKWYPGEPNNYENEDCVHGLYYK-NGLWNDIKCDYKNSVICSKDILNSN-------------------------ETIKQQQKYYVHEVL-------VTYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSKNMKIGR----FWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEG-------NFYPNGEWNDISCKTK 2007
            F     F+ A+  C   G  L  + + + N+++   A     + N   YWI AND++T  T+ ++D S    Y  W  GEP +    DC   +  K +G W+ I C      +C   ++ +                           +  Q   Y+              +E+A   C      +  + S  E   +    S  +K G      WI  + +  +  W D  G    Y+NWA  +P+N   E+C+E         +Y N  WN+ +C T+
Sbjct:   37 FTAPAQFEFAEEQCNLLGGHLASVQNGQENALLQSNAANSFKRSNYSDYWIGANDLETSGTWKWTDPSVTFDYSNWQLGEPQS--GSDCA--IQDKGDGTWSAIGCTSYRPYVCVTPVIMTATCPPITTPIPTTCPTPAPCPVKTCVPSCDQGWTYFAPTDFCYRVYHNAKWEDAEAACVLLGAHLTSVHSETENTFVANLASCGIKEGNPKDLAWIGMHKVGQDWVWTD--GTPSNYINWAPKQPDNPGKENCVETAPDLSHDKWYEN--WNNEACSTE 308          
BLAST of Mannose-binding protein C vs. Ensembl Celegans
Match: clec-53 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:P91429])

HSP 1 Score: 53.5286 bits (127), Expect = 5.539e-7
Identity = 58/270 (21.48%), Postives = 99/270 (36.67%), Query Frame = 1
Query: 2056 IEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINAN----DINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXX--XXXXXGKIDTSKYFVHTGRVTYEEALRF---------CQIHSCRLVTIENSELDILILNLARKHKISGYWLDGND------IKKEGEWVNIDGNKLKYLNWNQGEPNNYGNE-------DCLLGNYFANGKWNDFSCSTKNSFI 2781
            + +    VN+  A  +C +    L+ I N   N  V   A K   G  WI A     D+     + ++DG N  Y+N+  G+P    +  C+  L      W   +C +    +C                    +   +  T    Y+  ++F         CQ     L +I +   +  ++ L+ K  I+    D ND      + +  +W   DG+ + Y+NW  GEPNN   E       D   G      +WN+     + +F+
Sbjct:   34 LTLFRAAVNFQTAESICATLSGHLVSIHNAIDNAFVSSQAQKYMDGGAWIGAQASAPDVTNPLNWYWTDGSNFDYQNYKVGQPTPPGSTACMQ-LETGTAKWQTANCTNKLPFICSAAATVVPTCPTITIPSHCPSGYTWFETTDFCYKTTVQFTNFNDARSACQADGGDLASIHSIAENAFLVGLS-KAGITNKDKDWNDDVWIGLVYQNSKWQWTDGSVVNYVNWGDGEPNNMNKEWWTALVADPHEGKNSEGTRWNNVPQDDQRAFL 301          

HSP 2 Score: 52.373 bits (124), Expect = 1.043e-6
Identity = 59/246 (23.98%), Postives = 93/246 (37.80%), Query Frame = 1
Query: 2806 STKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKA------VEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSP-----PIIFIDEH------------MSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDS------KNDGKWTFSDGQQLTFKNWQTASLPSDKENNN 3456
            +++ L +F+  V F+ A++ C      LV I N   N  +   A K   G  WI A   A      +   + D +N    Y  +  G+P   G+  C+  L      W    C +K  FICS  +      P I I  H              YK  +    + +A   CQ++G  L  + +   +  +  LS +  + N   D  D         + KW ++DG  + + NW       D E NN
Sbjct:   30 NSRCLTLFRAAVNFQTAESICATLSGHLVSIHNAIDNAFVSSQAQKYMDGGAWIGAQASAPDVTNPLNWYWTDGSN--FDYQNYKVGQPTPPGSTACMQ-LETGTAKWQTANCTNKLPFICSAAATVVPTCPTITIPSHCPSGYTWFETTDFCYKTTVQFTNFNDARSACQADGGDLASIHSIAENAFLVGLS-KAGITNKDKDWNDDVWIGLVYQNSKWQWTDGSVVNYVNW------GDGEPNN 265          
BLAST of Mannose-binding protein C vs. Ensembl Fly
Match: CG15358 (gene:FBgn0031373 transcript:FBtr0473589)

HSP 1 Score: 57.7658 bits (138), Expect = 1.549e-8
Identity = 34/109 (31.19%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  514 KLLNRELIILQEKT--TYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNF-ISSDGKKIVYRKFAPGEPNNYQKNEHCV---HGLYYSN 819
            +L+      ++++T   + +A + C+  G QL  I   ++L ++   L  +     YW+D  D++ EG+F IS+ GK+  + K+  G+PNN+  N+HCV    GL Y N
Sbjct:  129 ELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERH---YWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDN 234          

HSP 2 Score: 54.6842 bits (130), Expect = 1.849e-7
Identity = 37/107 (34.58%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  940 RLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNK-IKFSKWAAGEPNNYQ-NEDCVHGLYYKNALWNDIKCEDLNAVIC 1254
            R  +  A   C+  G +L  I   +   +    A  N    YW+D  D+  EG F  S   K   F KW AG+PNN+  N+ CV  L   + L  D KCE L+  IC
Sbjct:  143 RRNWTSAGSACRQMGTQLATIRSAE--ELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL---DGLMYDNKCESLSYFIC 244          

HSP 3 Score: 51.6026 bits (122), Expect = 1.952e-6
Identity = 34/112 (30.36%), Postives = 58/112 (51.79%), Query Frame = 1
Query: 2452 YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEW-VNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFI 2781
            Y     R  +  A   C+    +L TI ++E ++  L  A+ +K   YWLD  D++KEG++ ++  G +  +L W  G+PNN+ GN+ C+      +G   D  C + + FI
Sbjct:  137 YIEDETRRNWTSAGSACRQMGTQLATIRSAE-ELAALR-AKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCV---DLLDGLMYDNKCESLSYFI 243          

HSP 4 Score: 51.2174 bits (121), Expect = 2.081e-6
Identity = 38/127 (29.92%), Postives = 62/127 (48.82%), Query Frame = 1
Query: 1285 KFEISNKEIVIFEEKVV--FKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDS-KKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICSKD 1650
            KFE+        E++    +  A   C+  G +L  I S +E+ ++      + +   YW+D  D++ E  F  S S K+ ++ KW  G+PNN+  N+ CV  L   +GL  D KC+  +  IC  D
Sbjct:  127 KFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERH---YWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL---DGLMYDNKCESLSYFICQSD 247          
BLAST of Mannose-binding protein C vs. Ensembl Fly
Match: CG15358 (gene:FBgn0031373 transcript:FBtr0473590)

HSP 1 Score: 57.7658 bits (138), Expect = 1.549e-8
Identity = 34/109 (31.19%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  514 KLLNRELIILQEKT--TYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNF-ISSDGKKIVYRKFAPGEPNNYQKNEHCV---HGLYYSN 819
            +L+      ++++T   + +A + C+  G QL  I   ++L ++   L  +     YW+D  D++ EG+F IS+ GK+  + K+  G+PNN+  N+HCV    GL Y N
Sbjct:  129 ELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERH---YWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDN 234          

HSP 2 Score: 54.6842 bits (130), Expect = 1.849e-7
Identity = 37/107 (34.58%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  940 RLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNK-IKFSKWAAGEPNNYQ-NEDCVHGLYYKNALWNDIKCEDLNAVIC 1254
            R  +  A   C+  G +L  I   +   +    A  N    YW+D  D+  EG F  S   K   F KW AG+PNN+  N+ CV  L   + L  D KCE L+  IC
Sbjct:  143 RRNWTSAGSACRQMGTQLATIRSAE--ELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL---DGLMYDNKCESLSYFIC 244          

HSP 3 Score: 51.6026 bits (122), Expect = 1.952e-6
Identity = 34/112 (30.36%), Postives = 58/112 (51.79%), Query Frame = 1
Query: 2452 YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEW-VNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFI 2781
            Y     R  +  A   C+    +L TI ++E ++  L  A+ +K   YWLD  D++KEG++ ++  G +  +L W  G+PNN+ GN+ C+      +G   D  C + + FI
Sbjct:  137 YIEDETRRNWTSAGSACRQMGTQLATIRSAE-ELAALR-AKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCV---DLLDGLMYDNKCESLSYFI 243          

HSP 4 Score: 51.2174 bits (121), Expect = 2.081e-6
Identity = 38/127 (29.92%), Postives = 62/127 (48.82%), Query Frame = 1
Query: 1285 KFEISNKEIVIFEEKVV--FKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDS-KKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICSKD 1650
            KFE+        E++    +  A   C+  G +L  I S +E+ ++      + +   YW+D  D++ E  F  S S K+ ++ KW  G+PNN+  N+ CV  L   +GL  D KC+  +  IC  D
Sbjct:  127 KFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERH---YWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL---DGLMYDNKCESLSYFICQSD 247          
BLAST of Mannose-binding protein C vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072661)

HSP 1 Score: 53.5286 bits (127), Expect = 1.991e-7
Identity = 37/116 (31.90%), Postives = 58/116 (50.00%), Query Frame = 1
Query: 2470 RVTYEEALRFCQIHSCRLVTI----ENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNI-DGNKLKYLNWNQGEPNNYG-----NEDCL-LGNYFANG-KWNDFSCSTKNSFI 2781
            +  + +A ++C+ H   L +I    EN  L+  I +    H+   +W+ G D+  EG +  +  G  + + NWN GEPNN+       E+CL L N    G KWND  CS +  F+
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFV 182          

HSP 2 Score: 53.1434 bits (126), Expect = 2.127e-7
Identity = 37/124 (29.84%), Postives = 59/124 (47.58%), Query Frame = 1
Query: 1309 IVIFEEKVVFKHAQLLCKNNGYELLKIDS----DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVY-SDSKKISYQKWYPGEPNNY-----ENEDCVHGLYYKNG---LWNDIKCDYKNSVIC 1641
            + IF +   FK  Q  C+ +G  L  I S    D +   I DF + H    +WI   D+  E  F + +  + I++  W  GEPNN+     E E+C+  L+ ++G    WND  C ++   +C
Sbjct:   64 LGIFFKANWFKATQY-CRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVC 183          

HSP 3 Score: 51.9878 bits (123), Expect = 5.512e-7
Identity = 37/130 (28.46%), Postives = 63/130 (48.46%), Query Frame = 1
Query: 1681 QQKYYVHEVL-VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR--FWINGNDIITEGK--WVDSKGNKLVYLNWAKNEPNNYN-----NEDCLE-GNFYPNG-EWNDISCKTKNYLIYEYES 2034
            +++YY+       + +A  +C  H   +  IS+ E N  + +  ++  +G   FWI+G D+  EG   W+ + G  + + NW   EPNN+       E+CLE  N    G +WND  C  + Y + E + 
Sbjct:   59 EKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQP 187          

HSP 4 Score: 48.521 bits (114), Expect = 9.781e-6
Identity = 35/118 (29.66%), Postives = 58/118 (49.15%), Query Frame = 1
Query: 2074 KVNYIKALELCKSKGYDLIRI----ENEEINKIVYDVATKNKVGQYWINANDINVEGQFIY-SDGQNISYRNFAHGEPN-----NQNNEDCVHGLFYTNG---LWNDISCNSINSVLC 2388
            K N+ KA + C+  G  L  I    EN+ + K + D    ++   +WI+  D+  EG F + + G+ I++ N+  GEPN     N   E+C+  L+  +G    WND  C+     +C
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVC 183          
BLAST of Mannose-binding protein C vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072660)

HSP 1 Score: 53.5286 bits (127), Expect = 1.991e-7
Identity = 37/116 (31.90%), Postives = 58/116 (50.00%), Query Frame = 1
Query: 2470 RVTYEEALRFCQIHSCRLVTI----ENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNI-DGNKLKYLNWNQGEPNNYG-----NEDCL-LGNYFANG-KWNDFSCSTKNSFI 2781
            +  + +A ++C+ H   L +I    EN  L+  I +    H+   +W+ G D+  EG +  +  G  + + NWN GEPNN+       E+CL L N    G KWND  CS +  F+
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFV 182          

HSP 2 Score: 53.1434 bits (126), Expect = 2.127e-7
Identity = 37/124 (29.84%), Postives = 59/124 (47.58%), Query Frame = 1
Query: 1309 IVIFEEKVVFKHAQLLCKNNGYELLKIDS----DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVY-SDSKKISYQKWYPGEPNNY-----ENEDCVHGLYYKNG---LWNDIKCDYKNSVIC 1641
            + IF +   FK  Q  C+ +G  L  I S    D +   I DF + H    +WI   D+  E  F + +  + I++  W  GEPNN+     E E+C+  L+ ++G    WND  C ++   +C
Sbjct:   64 LGIFFKANWFKATQY-CRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVC 183          

HSP 3 Score: 51.9878 bits (123), Expect = 5.512e-7
Identity = 37/130 (28.46%), Postives = 63/130 (48.46%), Query Frame = 1
Query: 1681 QQKYYVHEVL-VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR--FWINGNDIITEGK--WVDSKGNKLVYLNWAKNEPNNYN-----NEDCLE-GNFYPNG-EWNDISCKTKNYLIYEYES 2034
            +++YY+       + +A  +C  H   +  IS+ E N  + +  ++  +G   FWI+G D+  EG   W+ + G  + + NW   EPNN+       E+CLE  N    G +WND  C  + Y + E + 
Sbjct:   59 EKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQP 187          

HSP 4 Score: 48.521 bits (114), Expect = 9.781e-6
Identity = 35/118 (29.66%), Postives = 58/118 (49.15%), Query Frame = 1
Query: 2074 KVNYIKALELCKSKGYDLIRI----ENEEINKIVYDVATKNKVGQYWINANDINVEGQFIY-SDGQNISYRNFAHGEPN-----NQNNEDCVHGLFYTNG---LWNDISCNSINSVLC 2388
            K N+ KA + C+  G  L  I    EN+ + K + D    ++   +WI+  D+  EG F + + G+ I++ N+  GEPN     N   E+C+  L+  +G    WND  C+     +C
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVC 183          
BLAST of Mannose-binding protein C vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072659)

HSP 1 Score: 54.6842 bits (130), Expect = 3.778e-7
Identity = 38/112 (33.93%), Postives = 56/112 (50.00%), Query Frame = 1
Query: 2485 EALRFCQIHSCRLVTI----ENSELDILILNLARKHKISGYWLDGNDIKKEGE--WVNIDGNKLKYLNWNQGEPNNYG-----NEDCL-LGNYFANG-KWNDFSCSTKNSFI 2781
            +A ++C+ H   L +I    EN  L+  I +    H+   +W+ G D+  EG   W+   G  + + NWN GEPNN+       E+CL L N    G KWND  CS +  F+
Sbjct:  262 KATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFV 370          

HSP 2 Score: 53.1434 bits (126), Expect = 9.889e-7
Identity = 35/115 (30.43%), Postives = 56/115 (48.70%), Query Frame = 1
Query: 1723 EAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR--FWINGNDIITEGK--WVDSKGNKLVYLNWAKNEPNNYN-----NEDCLEG-NFYPNG-EWNDISCKTKNYLIYEYES 2034
            +A  +C  H   +  IS+ E N  + +  ++  +G   FWI+G D+  EG   W+ + G  + + NW   EPNN+       E+CLE  N    G +WND  C  + Y + E + 
Sbjct:  262 KATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQP 375          

HSP 3 Score: 53.1434 bits (126), Expect = 1.006e-6
Identity = 37/124 (29.84%), Postives = 59/124 (47.58%), Query Frame = 1
Query: 1309 IVIFEEKVVFKHAQLLCKNNGYELLKIDS----DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVY-SDSKKISYQKWYPGEPNNY-----ENEDCVHGLYYKNG---LWNDIKCDYKNSVIC 1641
            + IF +   FK  Q  C+ +G  L  I S    D +   I DF + H    +WI   D+  E  F + +  + I++  W  GEPNN+     E E+C+  L+ ++G    WND  C ++   +C
Sbjct:  252 LGIFFKANWFKATQY-CRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVC 371          
BLAST of Mannose-binding protein C vs. Ensembl Zebrafish
Match: mrc1a (mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-GENE-090915-4])

HSP 1 Score: 231.876 bits (590), Expect = 3.816e-61
Identity = 263/1143 (23.01%), Postives = 463/1143 (40.51%), Query Frame = 1
Query:  157 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK-----NTQPKTSHVIKLLNRELI--------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY-QKNEHCVHGLYYSNALWNDISCADSNAVICYKES--KIEVLKKITVLNKELVIFK----------ERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA-LWNDIKCEDLNAVICYKNI----------------GSRGFTKFEISNKEIVIF----EEKVVFKHAQLLCKNNGYELLKIDSD-EINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENED-CVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNE----TIKQQQ--------------KYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGK---WVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISC---------KTKNY------LIYEYESTAEKEITI------EIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ------------NNEDCVHGLFYT---NGLWNDISCNSINSVLCYKPFXXXXXXXXXXGK------IDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI------FKERVT-----------------FEEAQNTCIKKGWSLVRIDNEETNQNIYD--LAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC--SKYSPP 3168
            Q   T+ +A   CQ +  +L+ I +    + +  L   + +   WI  N +  E  +++ NG   +Y  +A G P+      C      K   W  ++C+     IC K     NT P             +        + + K  + +A+A C  +G  L  I + + +S + + +        WI  ND + +  F  SD   + +  +  GEP+++  + E CV  +   +  W D +C      IC K+S  K E   ++  L  +    +          E  T+ +A+ +C+  G  LV +     N+ + +         +WI  ++     +F  S+ +K+KF+ +  G P  ++   CV  L   +A LW+ + C      IC K                     G+TK +  N  I I+    E+K  +  A+  CK  G +L    S  +IN++ Y         T WI  N +   + FV++D     ++ W  GEPNN+ N++ C    +Y    WND  C+  N  IC   I  + +    T+ Q +              +Y+++E  +  E+A +FC ++N  +V I+     K +++        +++I    I+   K   WVD  G+ +VY +W +NEPN  NN++     +   G WNDI+C         ++ N+      L          E TI      ++ + K+ +  A  LC S G +L+ I   E    +  +   + V   WI  ND+N E +F+++DG+ +SY N+A G P++              N DCV  L       G+W    C      +C +                    +    Y V   +++++EA R C+     L ++ NS      +    K K    W+  N     G++  +D   L Y  W  GEP N  N  C+  +   +G+W   +C+     +     +I  T   ++       K+R T                 +  A   CI+ G SLV I++ + +  I      +++ +  +WI  + ++  G ++  +N  + Y+ +     NN G+  CV  +  S+G WN + CNS   +IC   K  PP
Sbjct:  236 QSILTWHQARTSCQQQEADLLSITELHEQSYISGLTNTFGSA-LWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLTCAALNAGKASKWESMACNKKLGYICRKGNSTDNTPPPGKDQPNFCPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVL-IKGKDGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMPEKHRG--CVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNC-IQIYSRPKEQKKTWFEARDYCKAIGGDLASFHSQKQINNLQYGMGE-----TAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGM--IVNLDKSFNWVD--GSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLML-DSVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSISQAYTILTVSKLK-EPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPKN--NLACVYID--TDGRWKTATCNNTYYSLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSENWAHATVECIRIGGSLVSIEDPKESHFIQRNVELMQDGVRSFWIGMH-RSYMGDWMWIDNAVVDYTNWRTQVTNNAGH--CVE-IQSSSGLWNAVNCNSYKPYICKTEKVVPP 1354          

HSP 2 Score: 204.527 bits (519), Expect = 1.056e-52
Identity = 267/1171 (22.80%), Postives = 438/1171 (37.40%), Query Frame = 1
Query:  541 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKK-------------ITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKE-------------IVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKN-GLWNDIKCDYKNSVICSK-----------------------------DILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNED-CLEGNFYPNGEWNDISCKTKNYLI------------------YEYESTAEKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISC------------NSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNN----------YGNE--DC---LLGNYFANGKWNDFSCSTKNSFI------YYYIENIISTKELEIF----------KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS------PPIIFIDEHMS-------------YKIFINKVTYREAVDKCQSEGYSLIKVENSDIS-FIVHTLSLRYKLV-NYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSE--TLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGV 3606
            +Q   T+  A   C+ +   L+ I +    S +  L   +     WI  N +  E  +  S+G    Y  +APG P+  +    C        + W  ++C      IC K +  +                 +        + + +  +  A   C  +G  L  I + + +S + + +        WI  ND + +  FE SD+  + F+ W  GEP+++ N  EDCV  +  K+  W D  CE     IC K   S+     E+ +               +   E K  F  A+ +C+  G  L+ + S   N+ +           +WI  ++ ++  +F +S+S K+ +  +  G P  +    CV  L   + GLW+ + C+ K   IC K                             + +      K+Q+K        T+ EA ++C      +    S  + N + Y   +   IG   +N N       W D  G    + NW+  EPNN+NN++ C E +FY   +WND  C+  N  I                   EY  T++  I        I E  +    A   CK    DL+ I  +   K V+   ++    QY+I    +N++  F + DG  + Y ++   EPN  NN++    ++ + G WNDI+C            N INS L   P         E      S Y +   ++T+ +A   C  H   LV+I   E    +  L     +   W+  ND+  E  ++  DG  + Y NW +G P++          +G+E  DC   L       G W    C  +  FI         I  + +      F          KE+++++EA+  C      L  + N   +Q    L V       WI  N     G++   +N  L YS++  GEP N  N  CV+    ++G W    CN+    +C + +      PP +  +   S             Y    N   +  A  +C   G SL+ +E+   S FI   + L    V ++WI G      G W + D   + + NW+T      +  NN  +  E  + SG W   +C S    IC        T K V  TK  +  + V
Sbjct:  235 VQSILTWHQARTSCQQQEADLLSITELHEQSYISGLTNTFG-SALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPS-LEPGLTCAALNAGKASKWESMACNKKLGYICRKGNSTDNTPPPGKDQPNFCPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVL-IKGKDGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKT-FNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMPEKHRG--CVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPKEQKK--------TWFEARDYCKAIGGDLASFHSQKQINNLQYGMGETAWIGFNLLNINSGFV---WTD--GTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGM-IVNLDKSFNWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVPLPSICKRSSNFINSTLPL-PTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNS-ISQAYTILTVSKLKEPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPKN--NLACVY--IDTDGRWKTATCNNTYYSLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSENWAHATVECIRIGGSLVSIEDPKESHFIQRNVELMQDGVRSFWI-GMHRSYMGDWMWIDNAVVDYTNWRT------QVTNNAGHCVEIQSSSGLWNAVNCNSYKPYIC-------KTEKVVPPTKKPLVPLAV 1364          

HSP 3 Score: 180.259 bits (456), Expect = 3.365e-45
Identity = 212/981 (21.61%), Postives = 386/981 (39.35%), Query Frame = 1
Query: 1330 VVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK-----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDC--LEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIME----------GKVNYIKALE---------LCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN-GLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGR----------------VTYEEALRFCQIHSCRLVTIENS-ELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNED-CLLGNYFANGKWNDFSCSTKNSFIYYYI------ENIISTKELE-----------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDA---NDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS-----------------PPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQ---TASLPSDK--------ENNNC---LYSSETLSGKWLGTSCVSKNSVICYKPSKT-----IDTGKE-----VKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDD 3891
            + +  A+  C+    +LL I   E++   Y   + +  G+  WI  N +  E+ + +S+     Y  W PG P+      C      K   W  + C+ K   IC K   NS +      K                 YY+      + +A+  C++    +  I N+E +  I   S  +     WI  ND  T+  +  S    + +  W   EP+++ N  EDC  ++G    +G+W D +C+ +   I + +S+++ E   E++           G   Y+ A+E         +C+  G +L+ + +   N  +  +        +WI  ++      F +S+   + + +F  G P  + +  CV  L  T+ GLW+ + CNS    +C K  +     +        S     T +                 T+ EA  +C+     L +  +  +++ L   +         W+  N +     +V  DG    + NW+ GEPNN+ N++ C   +++   KWND  C   N +I              +  ++E                 I +E +  E+A++ C K    LV I  +   + ++    +    QY+I      DK+    +VD +   + Y+ + + EPN   N++    +Y S GFWNDI C      IC + S                  P   I +   YK+F NK+T+ +A + C S G +L+ +   +    + TL L   + + WI   D   + ++ ++DG+ +++ NW     +S+P           EN +C   L S E ++G W    C  +   IC + + T     + T        +    Y + +  +++ EA   CK     L  V N  +  Y      KL  E  W+  N     G +   D   L++  W  G+   +    C+  + DG+W+  +C++
Sbjct:  239 LTWHQARTSCQQQEADLLSIT--ELHEQSYISGLTNTFGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLTCAALNAGKASKWESMACNKKLGYICRKG--NSTDNTPPPGKDQPNFCPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVLIKGK---DGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMP--EKHRGCVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPKEQKKTWFEARDYCKAIGGDLASFHSQKQINNLQYGMGETA-----WIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSF--NWVDGS--PVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSISQAYTILTVSKLK-EPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEP--KNNLACVYIDTDGRWKTATCNN 1197          

HSP 4 Score: 168.703 bits (426), Expect = 1.422e-41
Identity = 202/902 (22.39%), Postives = 348/902 (38.58%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYKETEPKISAEIEL-----QSKYV-------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYKN----------------------TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNK----------------ELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIG----------------SRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY------------ENEDCVHGLYYK---NGLWNDIKCDYKNSVICSK----DILNSNETIKQQQ-------KYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEI-----------------------MEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDV-ATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            W D +CE     IC K++  K     E+     Q+ +V       +   E  TF EA ++C+  G NL+ +     N  + +L        FWI  ++ +   +F + N  ++K+  F  G P  +R   CV  +     G W+ + C+     IC K                       T+    + I++ +R     ++K T+  A  +CK+ G  L       Q+N++      QY +G   WI  N +     F+ +DG    +  ++ GEPNN+   E C    +Y    WND  C   N  IC            T + +                +  I +E L    A+  CK     LV I  +     V+    + +  +Y+I    V ++ +F   D + + ++ W   EPN   N++    +Y     WNDI C      IC ++                  S  +T F+ S  +  +F+ K+ +  A+ LC ++G  L+ I + E  + +    +  ++   WI  ND+  E  F+++D K +SY  W  G P++             EN DCV  L       G+W    C  +   IC +     ++    T   Q         Y V +  ++++EA   C   +  +  + N  +          +K    WI  N  +T G  +WVD+    L Y  WA  EP   NN  C+  +   +G W   +C    Y + +  +        ++                       M    N+  A   C   G  L+ IE+ +E + I  +V   ++ V  +WI  +  +  G +++ D   + Y N+     NN  +  CV  +  ++GLWN ++CNS    +C
Sbjct:  471 WADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMPEKHRG--CVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPK---EQKKTWFEARDYCKAIGGDLASFHSQKQINNL------QYGMGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYI-GMIVNLDKSFNWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYK--LFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSISQAYTILTVSKLK-EPLWIGLNSNLTSGQYRWVDNW--LLSYSRWATGEPK--NNLACVYID--TDGRWKTATCNNTYYSLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSENWAHATVECIRIGGSLVSIEDPKESHFIQRNVELMQDGVRSFWIGMHR-SYMGDWMWIDNAVVDYTNWRTQVTNNAGH--CVE-IQSSSGLWNAVNCNSYKPYIC 1346          

HSP 5 Score: 107.071 bits (266), Expect = 1.039e-22
Identity = 136/626 (21.73%), Postives = 235/626 (37.54%), Query Frame = 1
Query:   10 EHCVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKY--------------VIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK------NTQPKTSHVIKLLNRELII--------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNY-----------QKNEHCVHGLYYS---NALWNDISCADSNAVICYKESKIEVLKKITVL---------NKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNY---AVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKN------------------------IGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFA--VKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            E C    +Y    WND  CE  +  IC     T PK       Q +Y                I +E     +A   C+    +L+ I        V+    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C      IC +      +T P  +      + E  I         Q K T+ +A   C S G  L+ I   +  + +  L +   +   WI  ND+  E  F+ +DGK + Y  +A G P++             +N  CV  L        +W    C D    IC +++  ++++ +T           N    + KE++++ +A+  CK+    L  +     NSI   Y    V       WI  N     G +   D   + +S+WA GEP N  N  CV+     +  W    C +    +C ++                        I  RG     +SN E         + HA + C   G  L+ I+  + +  I      ++  + ++WI  +     + +++ D+  + Y  W     NN  +  CV  +   +GLWN + C+     IC
Sbjct:  743 ELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYI-GMIVNLDKSFNWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVR----NSISQAYTILTVSKLKEPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPKN--NLACVY--IDTDGRWKTATCNNTYYSLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSE--------NWAHATVECIRIGGSLVSIEDPKESHFIQRNVELMQDGVRSFWIGMHRSYMGD-WMWIDNAVVDYTNWRTQVTNNAGH--CVE-IQSSSGLWNAVNCNSYKPYIC 1346          

HSP 6 Score: 72.0182 bits (175), Expect = 4.913e-12
Identity = 95/401 (23.69%), Postives = 153/401 (38.15%), Query Frame = 1
Query: 2839 VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ-YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK----------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENN--NCLYSSETLSGKWLGTSCVSKNSVICYKPSKT--------IDTGKEVKKTKY----YIHRI-GVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW---LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNI-QKTQNC---LQGNPDGKWRDVSCDDKNPFFFEFIDE 3924
            +T+ +A+ +C ++   L+ I   E ++  Y   + N  G   WI  N    E  +  SN +  +Y  +  G P+      C          W  +ACN K  +IC K                + P          Y +   K  + +A+  C  EG +L  + N +    + + S        WI   D K    + +SD   +TF  W     PS   N   +C+   +   GKW   +C  +   IC K S +        +  G +    +Y    Y+  I   TF EA   C++    L+ V +   N +L  L   L  EKY+   L+  +      W +SDK K T FN     V + +K + C   L G   G W  + C+ K  +  + + E
Sbjct:  239 LTWHQARTSCQQQEADLLSI--TELHEQSYISGLTNTFGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLTCAALNAGKASKWESMACNKKLGYICRKGNSTDNTPPPGKDQPNFCPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGE-PSHFINRLEDCVLI-KGKDGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLV-GLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFN-----VGMPEKHRGCVAMLTGTSAGLWDVLDCNSKQKYICKKMAE 629          

HSP 7 Score: 67.0106 bits (162), Expect = 1.611e-10
Identity = 73/333 (21.92%), Postives = 126/333 (37.84%), Query Frame = 1
Query:    4 KNEHCVHGLYYP---NALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVI---------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYN-LAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT----------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIG--RYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITV 909
            +N  CV  L  P     +W    C D    IC ++T+ ++   +   +             + +EK ++ EA + C+A   +L  + +    +Q Y  L +       WI  N     G + +V+   + Y ++A GEP N  N  CV+     DG W   +C++T   +C ++T                  K    I         +     + +A   C   G  L+ I+D + +  +       Q G   +WI  +     G+++  D   + Y  +     NN     HCV  +  S+ LWN ++C      IC  E  +   KK  V
Sbjct: 1039 ENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSI--SQAYTILTVSKLKEPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPKN--NLACVY--IDTDGRWKTATCNNTYYSLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSENWAHATVECIRIGGSLVSIEDPKESHFIQRNVELMQDGVRSFWIGMH-RSYMGDWMWIDNAVVDYTNWRTQVTNNAG---HCVE-IQSSSGLWNAVNCNSYKPYICKTEKVVPPTKKPLV 1360          
BLAST of Mannose-binding protein C vs. Ensembl Zebrafish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 165.236 bits (417), Expect = 1.397e-40
Identity = 235/1128 (20.83%), Postives = 445/1128 (39.45%), Query Frame = 1
Query:  556 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKK-----------ITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIF-------------------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVH---GLYYKNGLWNDIKCDYKNSVICSK--DILNSNETIKQQ-------------------QKYYVHEV-LVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFY---PNGEWNDISCKTKN---YLIYEYESTAEKEIT-----------IEIMEGK--------VNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK---PFXXXXXXXXXXGKIDTSK---------YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNN------------YGNE-DCLL-----GNYFANGKWNDFSCSTKNSFIYYY-----IENI----------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS--PPII------------------FIDEHMSYKIFINKV-TYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKE----NNNCLYSSET 3477
            T+  A   C+ +G +L+ I +    S +  +  + Q G  WI  N +     +  S+G+ + Y K+  G P++ Q   +C       N+ W++ +C++    IC +   +  +             I       ++ + + T+ +A+D+C  +G  L+ I   +  S        +   + WI  ND + +  FE SD++ + F+ W  GEP +     EDCV  +  +   W D  CE     IC +   ++       SN + V+                     E   F+ A+  C+     L+ + S   N+ + +         +WI  ++ +  +TF ++++K++ +  +  G P     + CV    G+    GLW+ + C  K   IC +  D L +                          + + V  + + T+++A+++C +    ++ I + E++     W +       WI          +V S G+   Y +WA +EPNN NN E+C+E        +G WND++CK K      I++ ++  E  IT           IE    +        ++  +A   CK    DL+ I +EE    ++   +K     + I    ++++G F + DG  + ++ +   +P  +N+E+    +  + GLW  ++C    +  C +   P         +  K   +          Y V      + EA  +C+ H   L  I  S+     L+   + K + +W+  +++   G +   DG+K+ +  W +GEP++            + +E +C+      G++F+  KW    C++ N FI        I ++          +     ++ +E +T+ EA   C  +G  L  I  +  +Q   +L V       WI  N +   G F+  N   +   K+   EP    N+ C H     NG W    CN     +C + +  PP +                  +I    S   F+ ++ ++  A   C + G SL  + + ++  FI   L L      +WI G    + G W ++D   + + NW       D E    N +C + S T
Sbjct:  231 TWYQARKSCQQQGAELLSISEPHEQSFIAGMFQKSQ-GSLWIGLNKLDVSSGWQWSNGQPLRYLKWLSGFPSS-QPGYNCGVLKNGYNSEWSNDACSEKRGYICQRGHSVPTVPPEVTTGFCQSPWIPHSGNCYLLHRTKQTWLEARDICLREGGDLLSILSTEEQSFAITQLGYSKTDQLWIGFNDRKTQMLFEWSDQSSVPFASWEVGEPTHSAQHAEDCVL-MRGEEGKWADDVCEKKYGFICKRKTSTKA------SNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFNSGMPG--RKQGCVAMTTGIV--AGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMKTWDQALDYCRELGGDLLSIHH-ESD---IPWKQGGGYPS-WIGYRMYDPSVGYVWSDGSSSSYQSWASDEPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWH-KSKELYNDFLIGLT-VDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGDLTAI-MSKFQQTFLSTMIRDKSTNFWIGFSNLAN-GRFKWTDGSKVSFTEWAEGEPHSLVWSRSYYWTKYFSDEPECVFMGRSSGSHFS--KWVADDCNSTNGFICSRDVDPGIPSVPTEIPKTFVKLGNSSFKVIQENLTWIEANRRCKAEGGHLASI-RDLISQAYIELQVFRLKQPMWIGLNSEQSNGYFLWVNKWPMTMEKWAIAEPRP--NKPCAH--MKINGEWKTSLCNETFYSVCEQTTDIPPTLPAQQPGHCPKQENYSPLRWIPFRDSCYAFVTEMKSWSRAARLCMTWGASLASIRDEAEEKFIESNLLLLESYKEFWI-GLLHNHKGHWLWADNSVVDYTNWALTETDGDYEEFSYNPDCAFISAT 1328          

HSP 2 Score: 145.591 bits (366), Expect = 1.808e-34
Identity = 232/1109 (20.92%), Postives = 432/1109 (38.95%), Query Frame = 1
Query:  934 KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIG--------SRGFTK---FEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSK---------DILNSNETIKQ---QQKYYVHEV---LVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWI---NGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI-----------------------YEYESTAEKEITIEIMEGKVNYIK----ALELCKSKGYDLIRIENEEINKIVYDVATKNKVG-QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVH---GLFYTNGLWNDISCNSINSVLCY-----KP----FXXXXXXXXXXGKID---TSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIE------NIISTKELE----------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNN------------YGNE-DCV-----HGLYYSNGFWNDIACNSKNSFICSK-YSPPIIFIDEHM----------SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK-----PSKTIDTGKEVKKTKYYIHRIGVTFQE--------------ALDFCKERRCKLIVVDN------IDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWT 3807
            +  LT+Y+A+  C+ QG +L+ I +    S +     Q + G  WI  N + +   ++ S+   +++ KW +G P++    +C       N+ W++  C +    IC +           + GF +      S    ++   K  +  A+ +C   G +LL I S E  S              WI  ND +T+  F +SD   + +  W  GEP +     EDCV  +  + G W D  C+ K   IC +         D + +N   K+   +  YY +       T+EEA   C +   R+V +S+   N  +           FWI   N  D+ T  +W ++K     + N     P        +       G W+ +SC  K   I                        E+ S   +++ ++        +K    AL+ C+  G DL+ I +E       D+  K   G   WI     +    +++SDG + SY+++A  EPNN NN E+CV     L+  +G+WND++C       C       P      E      E+G I+   +  Y      ++  EA  FC+ +   LV I + E  + + +  +  ++   +L G  +  +G +  +DG+ + +  W   +P    +E+       + G W   +C  + ++     E       +  T+  +                +  E   + EA+  C + G  L  I ++   Q      +++K   +WI  ++ A  G+F  ++   + ++++  GEP++            + +E +CV      G ++S   W    CNS N FICS+   P I  +   +          S+K+    +T+ EA  +C++EG  L  + +      +     R K    WI     +++G + + +   +T + W  A     + N  C +    ++G+W  + C      +C +     P+          K + Y     + F++              A   C      L  + +      I++N+ L E     S +++W+ G   +++G W+ +D   + + NW 
Sbjct:  227 RSTLTWYQARKSCQQQGAELLSISEPHEQSFIAG-MFQKSQGSLWIGLNKLDVSSGWQWSNGQPLRYLKWLSGFPSSQPGYNCGVLKNGYNSEWSNDACSEKRGYICQRGHSVPTVPPEVTTGFCQSPWIPHSGNCYLLHRTKQTWLEARDICLREGGDLLSILSTEEQSFAITQLGYSKTDQLWIGFNDRKTQMLFEWSDQSSVPFASWEVGEPTHSAQHAEDCVL-MRGEEGKWADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHT-FEWTNTKQVPFTHFN--SGMPGRKQGCVAMTTGIV-AGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMKTWDQALDYCRELGGDLLSIHHES------DIPWKQGGGYPSWIGYRMYDPSVGYVWSDGSSSSYQSWASDEPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWH--KSKELYNDFLIGLTVDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGDLTAIMSK-FQQTFLSTMIRDKSTNFWIGFSNLA-NGRFKWTDGSKVSFTEWAEGEPHSLVWSRSYYWTKYFSDEPECVFMGRSSGSHFSK--WVADDCNSTNGFICSRDVDPGIPSVPTEIPKTFVKLGNSSFKVIQENLTWIEANRRCKAEGGHLASIRDLISQAYIELQVFRLKQ-PMWIGLNSEQSNGYFLWVNKWPMTMEKWAIA---EPRPNKPCAHMK--INGEWKTSLCNETFYSVCEQTTDIPPTLPAQQPGHCPKQENYSPLRWIPFRDSCYAFVTEMKSWSRAARLCMTWGASLASIRDEAEEKFIESNLLLLE-----SYKEFWI-GLLHNHKGHWLWADNSVVDYTNWA 1305          

HSP 3 Score: 145.206 bits (365), Expect = 1.935e-34
Identity = 208/992 (20.97%), Postives = 386/992 (38.91%), Query Frame = 1
Query:  169 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF---WNDISCDDTNSVICYKNTQPKT-----------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-NNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE-------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA-LWNDIKCEDLNAVIC------------------------YKNIGSRGFT--KFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIG-TYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVH---GLYYKNGLWNDIKCDYKNSVIC-------------SKDILNSNE----TIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKEITIEI-------------MEGKV--------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-------------QNNEDCV-----HGLFYTNGLWNDISCNSINSVLCYKPF-----XXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIEN----SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSC 2760
            T+ +A K CQ +G  L+ I +    + +  +  Q   G  WI  N + V   +++ NGQ ++Y K+  G P++    +C  G+  K+G+   W++ +C +    IC +     T           S  I       ++ + K T+  A   C  +G  L+ I   +  S         +  + WI  ND + +  F  SD   + +  +  GEP ++ Q  E CV  +      W D  C      IC +++  +     TV+                 +   E  T+ +A+  C+    +LV +     N+ + N         +WI  ++ +   TFE ++  ++ F+ + +G P   Q   CV       A LW+ + C +    IC                        + +IG+R      F + + ++  +++ + +      C+  G +LL I  +       D   K   G   WI          +V+SD    SYQ W   EPNN  N E+CV     L+  +G+WND+ C  K    C             ++ + N  E      +  Q Y      ++  EA  FC +++  +V I++ E    ++ W K+ ++   ++ G  +  +G  +W+D  G+ +V+  W  N+P   N+E+         G W  ++C  + NY     E+                        EGK          + +A E C+  G DL  I + +  +       ++K   +WI  +++   G+F ++DG  +S+  +A GEP++              +  +CV      G  ++  + +D  CNS N  +C +           +  K   K+  S + V    +T+ EA R C+     L +I +    + +++ +  L +       W+  N  +  G ++ ++   +    W   EP    N+ C   +   NG+W    C
Sbjct:  231 TWYQARKSCQQQGAELLSISEPHEQSFIAGM-FQKSQGSLWIGLNKLDVSSGWQWSNGQPLRYLKWLSGFPSSQPGYNC--GVL-KNGYNSEWSNDACSEKRGYICQRGHSVPTVPPEVTTGFCQSPWIPHSGNCYLLHRTKQTWLEARDICLREGGDLLSILSTEEQSFAITQLGYSKTDQLWIGFNDRKTQMLFEWSDQSSVPFASWEVGEPTHSAQHAEDCVL-MRGEEGKWADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFNSGMPGRKQG--CVAMTTGIVAGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMKTWDQALDY------CRELGGDLLSIHHES------DIPWKQGGGYPSWIGYRMYDPSVGYVWSDGSSSSYQSWASDEPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEER--LFLWHKSKELYNDFLIGLTVDLDGSFQWMD--GSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGDLTAIMS-KFQQTFLSTMIRDKSTNFWIGFSNL-ANGRFKWTDGSKVSFTEWAEGEPHSLVWSRSYYWTKYFSDEPECVFMGRSSGSHFSKWVADD--CNSTNGFICSRDVDPGIPSVPTEIPKTFVKLGNSSFKVIQENLTWIEANRRCKAEGGHLASIRDLISQAYIELQVFRLKQP-----MWIGLNSEQSNGYFLWVNKWPMTMEKWAIAEPRP--NKPC--AHMKINGEWKTSLC 1186          

HSP 4 Score: 113.235 bits (282), Expect = 1.169e-24
Identity = 184/893 (20.60%), Postives = 334/893 (37.40%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYKETEPKIS-------------AEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHVI-------KLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVH---GLYYSNALWNDISCADSNAVIC-YKESKIEVLKKIT-----VLNKELVIFK---------ERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCED-------------LNAVICYKNIGSRG----FTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY-------------ENEDCV-----HGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQ----------QKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRF----WINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE--------------------------IMEGKVNYIKALELCKSKGYDLIRIENEEINKIV-YDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-----QNNEDCV 2319
            W D  CE     IC ++T  K S               I       +   E  TF EA + C+     L+ +     N  + NL        FWI  ++ K   TFE+ N +++ +  F  G P   R + CV    G+    G W+ +SC +    IC +          P T+  +        +  R+L +       LQ K T++ A+ +C+  G  L+ I  +  + + +     Y     WI          ++ SDG    Y+ +A  EPNN    E+CV     L+  + +WND++C D     C   + K  V   IT     V     + F+           ++ ++A+  CK     LV I+DE+    +++ + +  +   ++    V ++G+F+  D + + F  W A +P    +E+    +     LW  + C D             +NA +        G    +T+FE   K   +  E   +  A+  C+ +G +L  I S +         ++     +WI  +++     F ++D  K+S+ +W  GEP++              +  +CV      G ++   + +D  C+  N  ICS+D+     ++  +            + V +  +T+ EA   C      +  I ++ +   I      +++ R     WI  N   + G ++      +    WA  EP    N+ C       NGEW    C    Y + E  +     +  +                          + E K ++ +A  LC + G  L  I +E   K +  ++       ++WI     N +G ++++D   + Y N+A  E +        N DC 
Sbjct:  460 WADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFNSGMPG--RKQGCVAMTTGIV--AGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMK-TWDQALDYCRELGGDLLSIHHE--SDIPWKQGGGYP---SWIGYRMYDPSVGYVWSDGSSSSYQSWASDEPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWHKSKE--LYNDFLIGLTVDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFE--GKCYNVRGEMKKWSEAREYCREHGGDLTAIMS-KFQQTFLSTMIRDKSTNFWIGFSNL-ANGRFKWTDGSKVSFTEWAEGEPHSLVWSRSYYWTKYFSDEPECVFMGRSSGSHFSKWVADD--CNSTNGFICSRDVDPGIPSVPTEIPKTFVKLGNSSFKVIQENLTWIEANRRCKAEGGHLASIRDLISQAYI-----ELQVFRLKQPMWIGLNSEQSNGYFLWVNKWPMTMEKWAIAEPR--PNKPCAHMKI--NGEWKTSLCNETFYSVCEQTTDIPPTLPAQQPGHCPKQENYSPLRWIPFRDSCYAFVTEMK-SWSRAARLCMTWGASLASIRDEAEEKFIESNLLLLESYKEFWIGLLH-NHKGHWLWADNSVVDYTNWALTETDGDYEEFSYNPDCA 1323          

HSP 5 Score: 103.605 bits (257), Expect = 1.157e-21
Identity = 170/800 (21.25%), Postives = 302/800 (37.75%), Query Frame = 1
Query: 1711 VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDC-LEGNFYPNGEWNDISCKTKNYLIYEYE---STAEKEITIEIMEG---------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN--QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXX--------XXXXXGKIDTSKYFVHTGR--VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIK--KEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCSTKNSFIYYYIENII-------STKELEIFKERV--------------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIG-QYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN-EDCVH---GLYYSNGFWNDIACNSKNSFICSKY----------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFI---VHTLSLRYK---LVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK-----------PSKTIDTGKEVKKTK-----YYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGK 3816
            +T+ +A   C Q    ++ IS       I    +  + G  WI  N +     W  S G  L YL W    P++    +C +  N Y N EW++ +C  K   I +      T   E+T    +                K  +++A ++C  +G DL+ I + E           +K  Q WI  ND   +  F +SD  ++ + ++  GEP +  Q+ EDCV  +    G W D  C      +C +                  ++G I    Y    G    T+EEA + C+    RLV + +   +  ++NL        +W+  ++ K     EW N    ++ + ++N G P     + C+ +      G W+  SCS K  +I     + +       +T  L+   E                      T+++A + C + G  L+ I +E       D+  K   G   WI          +V S+  +  Y  +   EPNN  N E+CV     L+  +G WND+ C  K  + C  +          + P+  + E    +   ++    E       E  +  K  + D+  I      L L +K   L N ++ G     DG + + DG  + F+ W+ A+ P+ K +           G W   +C  + +  C +           P++    G   + T+     Y +      + EA ++C+E    L  + +     +L  + +  S   +W+  ++  N G +  +D  K++F  W  G+
Sbjct:  230 LTWYQARKSCQQQGAELLSISEPHEQSFIAGMFQKSQ-GSLWIGLNKLDVSSGWQWSNGQPLRYLKWLSGFPSSQPGYNCGVLKNGY-NSEWSNDACSEKRGYICQRGHSVPTVPPEVTTGFCQSPWIPHSGNCYLLHRTKQTWLEARDICLREGGDLLSILSTEEQSFAITQLGYSKTDQLWIGFNDRKTQMLFEWSDQSSVPFASWEVGEPTHSAQHAEDCVL-MRGEEGKWADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNT--KQVPFTHFNSGMPGR--KQGCVAMTTGIVAGLWDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMKTWDQALDYCRELGGDLLSIHHES------DIPWKQGGGYPSWIGYRMYDPSVGYVWSDGSSSSYQSWASDEPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWHKSKELYNDFLIGLTVDLDGSFQWMDGSPVVFQAWE-ANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGDLTAIMSKFQQTFLSTMIRDKST-NFWIGFSNLAN-GRFKWTDGSKVSFTEWAEGE 1013          

HSP 6 Score: 82.0333 bits (201), Expect = 4.104e-15
Identity = 131/660 (19.85%), Postives = 250/660 (37.88%), Query Frame = 1
Query:   10 EHCVH---GLYYPNALWNDFSCEDPSAVICYKE----------TEPKISAE----IELQ-SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI---------------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN------------YQKNEHCV-----HGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGR----YWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLY---YKNALWNDI---KCE---DLNAVI-------CYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKI-DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN-NYE----NEDCVHGLYYKNGLWNDIKCDY-------KNSVICSKDILNSNETIKQQQKYYVHEVLVT 1716
            E+CV     L+  + +WND +C+D     C             TEP  +      IE + S+Y        +  EA   C+    +L+ I D++    +++ + + +   F I    + ++G+F++++G  + +  +   +P    +E+    M    G W  ++C D  +  C ++  P  +  +               +   +   +  E   +  A  +C+  G  L  I   +      +  ++ +   +WI  +++ N G F  +DG K+ + ++A GEP++            +     CV      G ++S  + +D  C  +N  IC ++    +    T + K  V        + +E LT+ +A   CK++G  L  I D     ++    ++  + R     WI  N  +  G F   +K  +   KWA  EP    N+ C H      +K +L N+     CE   D+   +       C K             +       E   +  A  LC   G  L  I D  E   +  +  +  +   +WI       +  ++++D+  + Y  W   E + +YE    N DC   +   +  W    CDY       K + + S  I + ++ IK  +      V +T
Sbjct:  733 ENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVYNVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWHKSKELY-NDFLIGLT-VDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEYNYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGDLTAI-MSKFQQTFLSTMIRDKSTNFWIGFSNLAN-GRFKWTDGSKVSFTEWAEGEPHSLVWSRSYYWTKYFSDEPECVFMGRSSGSHFSKWVADD--CNSTNGFICSRDVDPGIPSVPTEIPKTFVKLGNSSFKVIQENLTWIEANRRCKAEGGHLASIRD-----LISQAYIELQVFRLKQPMWIGLNSEQSNGYFLWVNKWPMTMEKWAIAEPR--PNKPCAHMKINGEWKTSLCNETFYSVCEQTTDIPPTLPAQQPGHCPKQENYSPLRWIPFRDSCYAFVTEMKSWSRAARLCMTWGASLASIRDEAEEKFIESNLLLLESYKEFWIGLLH-NHKGHWLWADNSVVDYTNWALTETDGDYEEFSYNPDCAF-ISATSKNWKKRHCDYTVLPFICKTAKVMSPTIKSPHQDIKPHRVKTGLAVFLT 1377          

HSP 7 Score: 80.4925 bits (197), Expect = 1.497e-14
Identity = 94/389 (24.16%), Postives = 156/389 (40.10%), Query Frame = 1
Query: 2830 KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK-----YSPPIIFIDEHMS---------YKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSK-------TIDTGKEVKKT----KYYIHRIGV---TFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLN-GNDKD-NEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQ---GNPDGKWRDVSCDDK 3894
            +  +T+ +A+ +C ++G  L+ I        I  +  K++ G  WI  N   V   +  SN   L+Y K+  G P++    +C       N  W++ AC+ K  +IC +       PP +      S         Y +   K T+ EA D C  EG  L+ + ++ + SF +  L    K    WI   D K    + +SD   + F +W+        ++           GKW    C  K   IC + +        T+ T    KK      YY +  G    TF+EA   C++   +L+ V +   N +L  L      + +W+   N KD +   W ++ +   T FN  +G     + Q C+    G   G W  +SC +K
Sbjct:  227 RSTLTWYQARKSCQQQGAELLSISEPHEQSFIAGMFQKSQ-GSLWIGLNKLDVSSGWQWSNGQPLRYLKWLSGFPSSQPGYNCGVLKNGYNSEWSNDACSEKRGYICQRGHSVPTVPPEVTTGFCQSPWIPHSGNCYLLHRTKQTWLEARDICLREGGDLLSILSTEEQSFAITQLGYS-KTDQLWIGFNDRKTQMLFEWSDQSSVPFASWEVGEPTHSAQHAEDCVLMRGEEGKWADDVCEKKYGFICKRKTSTKASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFLVNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFN--SGMPG--RKQGCVAMTTGIVAGLWDVLSCSNK 609          
BLAST of Mannose-binding protein C vs. Ensembl Zebrafish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 160.999 bits (406), Expect = 3.548e-39
Identity = 207/998 (20.74%), Postives = 374/998 (37.47%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKIDSDE----INSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIK----------------------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMK--IGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYN--NEDCLEGNFYPNGEWNDISCK-TKNYLIYEYESTAEKEIT---------------IEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINS-VLCYK------------PFXXXXXXXXXXGKIDTSKYFVHT----------GRVTYEEALRFCQIHSCRLVTIENSELDILILNL-------ARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTK-----------------ELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ---YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS------------------PPIIFIDEHMSYKIFINKVTYREAVDK----CQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSD----KENNNCLY----SSETLSGKWLGTSC-VSKNSVICYK---PS---------KTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDK 3894
            F+  + +  A+  C+  G +LL I   E    +N ++  ++      T W+  ND+     + ++DS  + Y  W    P+  E E+C        G W++  C      IC K     N T+                       Q   Y+++   + +  A   C +    +V I  +   + I   +K+MK  I   WI  +D   +  +  +    +++  W   EPNN+   NEDC+   + P G WND  C  +   +  +    A+  I                 ++ E  + +  A E+C S    L  I N      V  +       Q+W+  N+ N  G F +  G  ++Y N+   +P        V       GLW    C SI S  +C +            P               +S  F H            R+T+ +A +FCQ H  +L +    E +  +  +       A +H+    W+ G   +    W   DG+ + Y N+ +G   NYG+ +C   N  A+  W    C ++  +I    +  +  +                 + ++F+ R T+++AQ  C     SLV + + + NQ +     K    +   +W+  +    +G+F  S++  L Y  +  G+P     E     +  S G W+D  C+    ++C + +                  P       H  YK+F  +++ R   D     C ++  +L+ V N  +   + TL L     + W+ G  S++  ++ + +   L++ NW     P D    K   NC+     S + ++G W    C   K+  IC K   P+          ++D   E    +Y I +  + +  AL  C+     L  V     N YL  L   L    +    N+     +W+   ++++TF +W +G+ N  +   C     +G+W   +C+ K
Sbjct:  258 FQATLSWSEARTSCQQQGADLLSITKVEEQIYVNGLLIGYSA-----TLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENCGVISTDAQGRWHNRDCSVALPYICKK---RPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYI---TKHMKKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCVT-IWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWI-GISRRNSDSWTWSDGSAVTYQNFGRG---NYGSAECGAAN-MADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFLVSTLRKMSRQENDLWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQISASKGDWSDQRCHVDLPYVCKRVNVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTL-LPNSSFHLWV-GLTSESQAQFKWFEPGFLSYTNWAPGE-PVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYLTLLLSTLRKPAWIALHNEGGRSYSWL--GEEEITFSDWRDGEPN--QMYGCGHMITEGQWTVAACNSK 1231          

HSP 2 Score: 134.035 bits (336), Expect = 5.216e-31
Identity = 228/1159 (19.67%), Postives = 429/1159 (37.01%), Query Frame = 1
Query:  541 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNA--LWNDISCADSNAVICYKESKIEVLKKIT-----------------VLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ--NEDCVHGLYYKNALWNDIKCEDLNAVICYKNI----------GSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKC-DYKNSVICSKD-----------------ILNSNETIKQQQKYYVH----------EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEW-------SKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEW--------NDISCKTKNYLIYEYESTAE---------KEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ-----YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP------FXXXXXXXXXXGKIDTSKYFVH----------TGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEP------NNYGNEDCLL--GNYFANGKWNDFSC-STKNSFIYYYIENIISTKELE------------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIY-DLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNN-YGNEDCVHGLYYSNGFWNDIACNSK-NSFICS---------KYSPPIIFID----------EHMSYKIFINKVTYR-EAVDKCQSEGYSLIKV--ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNW--QTASLPSDKENNNCLYSSETLSGKWLGTSCVSK-NSVICYKP 3540
             Q   ++  A   C+ +G  L+ I   +    V  L + Y     W+  ND+   G +  +D   + Y  +    P+ Y + E+C  G+  ++A   W++  C+ +   IC K     +    T                        +  ++L +  A   C+     LV I        +  + ++ +I   WI  +D  ++  FE +D+  + F+ W   EPNN++  NEDCV  ++     WND  C      IC K            G +   K+  S     + EE + FK A+ +C +N   L  I++    + +           +W+  N+  +  TF +    +++Y  W   +P   +    V       GLW    C   ++  IC ++                 +  S  +  +    + H          E  +T+ +A  FC +H  ++   S  E    +++        ++  +    WI G        W  S G+ + Y N+ +    NY + +C   N   +  W         D  CK     + E   + E         +E   ++ E +  + +A  +C      L+ + + + N+ +  V+T  K+ +     +W+  +    +G+F +SD   ++Y ++  G+P   + E     +  + G W+D  C+     +C +                  G       F+H          + R T++ A + C      LVT+ N  +   ++ L         W+ G   + + ++   +   L Y NW  GEP       + GN   LL        G W    C + K+ FI    ++   +  ++                  I ++R+ +  A   C     +L  +   E  QN Y  L +       WI  +++     +       + +S +  GEPN  YG   C H +  + G W   ACNSK N+ IC          ++  P +              +  Y   ++++ ++ EA+  C   G  L+ +  EN +     H  S +++    W+    +  +G   +S G+ + + NW  Q A+L S    N+C +     +G W   SC ++ + VIC +P
Sbjct:  258 FQATLSWSEARTSCQQQGADLLSITKVEEQIYVNGLLIGYS-ATLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPS-YDEEENC--GVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKH-MKKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWH-SPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWI-GISRRNSDSWTWSDGSAVTYQNFGR---GNYGSAECGAANM-ADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFL--VSTLRKMSRQENDLWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQISASKGDWSDQRCHVDLPYVCKRVNVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTLLPNSSFH-LWV-GLTSESQAQFKWFEPGFLSYTNWAPGEPVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAV--REPRQNAYLTLLLSTLRKPAWIALHNEGGR-SYSWLGEEEITFSDWRDGEPNQMYG---CGHMI--TEGQWTVAACNSKLNAAICEMNTETTKEHRWMYPGVCPQPVGNWSWIPFRNHCYSFILHELQFKQEAIRMCSKVGAKLLSILDENENGFVWEHMQSFQHQAHGAWLGMIFNSKEGSLEWSSGEIVDYSNWEQQDANL-SMLSANSCFWVKSN-TGLWRPESCKNRTHGVICKRP 1390          

HSP 3 Score: 111.694 bits (278), Expect = 3.729e-24
Identity = 150/707 (21.22%), Postives = 273/707 (38.61%), Query Frame = 1
Query: 2065 MEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN--GLWNDISCNSINSVLCYK-------PFXXXXXXXXXXGKID-------TSKYFVHTGRVTYEEALRFCQIHSCRLVTIEN-SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYG--NEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENII-----------------------STKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNS-KNSFICSK--------------------YSPPIIFIDE---HMSYKIFI-----NKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVN------YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTI--------DTGKE---VKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEK---YWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNCLQ-GNPDGKWRDVSCDDKNPF 3903
             +  +++ +A   C+ +G DL+ I   E  +I  +          W+  ND+++ G + ++D   + Y N+    P+    E+C  G+  T+  G W++  C+     +C K       PF  D        + D       T  Y++++ ++ +  A R CQ     LV+I    EL+ +  ++  K  I   W+  +D   +  +   D   + +  W+  EPNN+   NEDC+   +   G+WND  C+       Y + +I                        S    ++ +E +TF++A+  CI    +L  I+N      +  L       Q+W+  N++   G F       L Y+ + R +P        V     + G W    C S ++ +IC +                     S P  +         YK+F       ++T+ +A   CQ  G  L       + +F+   L   +           WI G   +N   WT+SDG  +T++N+   +  S +       ++      WL + C S+   IC  P   +        DTG E    ++ +Y +     T+ +A   C      L+ + +   N +L    +K+S ++   +W+  +   N+G +  SD   L + +W  G+   I K   C+Q     G W D  C    P+
Sbjct:  258 FQATLSWSEARTSCQQQGADLLSITKVE-EQIYVNGLLIGYSATLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENC--GVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHM--KKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCVT-IWGPEGRWNDSPCN-------YSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWI-GISRRNSDSWTWSDGSAVTYQNFGRGNYGSAE-----CGAANMADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFLVSTLRKMSRQENDLWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQISASKGDWSDQRCHVDLPY 945          

HSP 4 Score: 98.2117 bits (243), Expect = 4.947e-20
Identity = 189/977 (19.34%), Postives = 347/977 (35.52%), Query Frame = 1
Query:  160 EKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR--NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRE---------LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCAD-SNAVICYKESKIEVLKKITVLNKELVI-------------------------FKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNY-------AVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGS----------RGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNI---GTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETI-------------KQQQKYYVHEVL----------VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN-GNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFY------P---NGEWNDISCKTKNY------------------LIYEYESTAEKE-ITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINK-IVYDVATKNKVGQYWINANDINVEGQFIYS--DGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNS-INSVLCYKPFXXXXXXXXXXGKIDTSK---------------YFVHTGRVTYEEALRFCQIHSCRLVTI--ENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPN 2691
            +K  +  A++ CQ    NL+ I    + ++ T+     I+      WI  +D  ++  FE+ +   + +  +   EPNN+R  NEDCV  ++  +G WND  C+ +   IC K  Q     +     +            + +E  T+++A   C S    L  I++    + V +L       ++W+  N+  + G F    G ++ Y  +   +P    K    V     +  LW    CA   +  IC +      +           +                          ++RLT+ +A   C+  G +L      +  + V+         A ++     WI  +  R   ++  SD + + +  +  G   NY + +C       +  W    CE     IC    G            G    +    +  +FE +  +  AQ +C      L+ + S + N  +     K +      +W+  +  + +  F +SD   ++Y  W PG+P     E     +    G W+D +C      +C +  +N   TI              Q    ++H+             T++ A   C      +V + N      +     N      W+   ++   + KW +     L Y NWA  EP + N +    GN        P    G W    C  + +                  L    +   E + +   I++ ++++  AL++C+S    L  +     N  +   ++T  K    WI  ++   EG   YS    + I++ ++  GEPN      C H    T G W   +CNS +N+ +C    +  K+ +     +                   + +H  +   +EA+R C     +L++I  EN    +     + +H+  G WL      KEG      G  + Y NW Q + N
Sbjct:  405 DKLDWRSADRTCQKMEANLVSIHTLPELEYITKHMKKDIE----ELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQV-KGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGISR-RNSDSWTWSDGSAVTYQNFGRG---NYGSAEC-GAANMADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFLVSTLRKMSRQENDLWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQISASKGDWSDQRCHVDLPYVCKR--VNVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTLLPNSSF-HLWVGLTSESQAQFKWFEP--GFLSYTNWAPGEPVD-NKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYLTLLLSTLRKPA--WIALHN---EGGRSYSWLGEEEITFSDWRDGEPNQMYG--CGH--MITEGQWTVAACNSKLNAAICEMNTETTKEHRWMYPGVCPQPVGNWSWIPFRNHCYSFILHELQFK-QEAIRMCSKVGAKLLSILDENENGFVWEHMQSFQHQAHGAWLGMIFNSKEGSLEWSSGEIVDYSNWEQQDAN 1354          

HSP 5 Score: 85.1149 bits (209), Expect = 5.047e-16
Identity = 114/533 (21.39%), Postives = 202/533 (37.90%), Query Frame = 1
Query: 2437 IDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI------------------------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG--NEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMS---------------YKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYK----------------PSKTIDTGKEVKKTKYYIHRIGV----------TFQEALDFCKERRCKLIVVDNIDTNIYLWEL-----SKKLSIEKYWL-NGNDKDNEGAWIDSDKKKLTFFNWTNG 3813
            +D    F     +++ EA   CQ     L++I   E  I +  L   +  +  W+  ND+   G W   D   LKYLNW    P+    E+C + +  A G+W++  CS    +I     N                           T    +  +++ +  A  TC K   +LV I      + I    +K  I + WI  +D A++  F  ++   + ++ +   EPNN+   NEDCV  ++   G WND  CN     IC K   P    D+ +                +K+    +T+++A + C S   +L  + N      V +L        +W+   +  + G + +  G +LT+ NW     P+  +    +  +    G W    C S ++  IC +                PS T       K +  + H   V          T+ +A  FC++   +L      +   +++++      +    E++WL  G  + N  +W  SD   +T+ N+  G
Sbjct:  250 MDNCYQFNFQATLSWSEARTSCQQQGADLLSITKVEEQIYVNGLLIGYSAT-LWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENCGVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITK-HMKKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKK---PAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQ-PAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGISRRNSDSWTWSDGSAVTYQNFGRG 775          

HSP 6 Score: 77.7962 bits (190), Expect = 9.148e-14
Identity = 137/714 (19.19%), Postives = 273/714 (38.24%), Query Frame = 1
Query:  154 FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAI----QYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICY----KNTQPKTSHV------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-----YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKK---------------ITVLNKELVIFKERL----TYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEP-NNYQNE---DCV---HGLYYK-NALWNDIKCE-DLNAVICYKN---IGSRGFTK--------FEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYK-NSVICSKDILNSNETIKQQQKYY------------------------VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNM--KIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPN----NYNNEDCLEGNFYPNGEWNDISCKTKNYLI 2019
             +++ T+ +A+K CQ  G  L      E++ F  Q+ + A     ++     WI  +  +   ++ + +G  + Y  F +G   NY + +C       D  W    C+     IC     K  +   SH       +     +  + + ++T++ A   C      L+ +   + N  +  ++   ++ R     +W+  +  +N+G F  SD   + Y  + PG+P    K   CV  +  S   W+D  C      +C + +    +                    L+K   +F E L    T+  A   C +Q   LV + + +  + +    + N+    W+       +  F+  +   + ++ WA GEP +N Q +   +CV   HG   +   +W   +C+ + +  IC K+     S G  +         E    +  I ++++ +  A  +C++    L  +     N+ +    +       WI  ++ +   ++ +   ++I++  W  GEPN      C H +    G W    C+ K N+ IC  +     ET K+ +  Y                        +HE L   +EAI  C++   +++ I +   N  ++E  ++   +    W+       EG    S G  + Y NW + + N    + N+   ++ N    G W   SCK + + +
Sbjct:  696 LEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGISR-RNSDSWTWSDGSAVTYQNFGRG---NYGSAECGAANM-ADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFL--VSTLRKMSRQENDLWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQ-ISASKGDWSDQRCHVDLPYVCKRVNVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTL-LPNSSFHLWVGLTS-ESQAQFKWFEPGFLSYTNWAPGEPVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYL-TLLLSTLRKPAWIALHN-EGGRSYSWLGEEEITFSDWRDGEPNQMYG--CGHMI--TEGQWTVAACNSKLNAAICEMN----TETTKEHRWMYPGVCPQPVGNWSWIPFRNHCYSFILHE-LQFKQEAIRMCSKVGAKLLSILDENENGFVWEHMQSFQHQAHGAWLGMIFNSKEGSLEWSSGEIVDYSNWEQQDANLSMLSANSCFWVKSN---TGLWRPESCKNRTHGV 1385          
BLAST of Mannose-binding protein C vs. Ensembl Zebrafish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 160.614 bits (405), Expect = 4.653e-39
Identity = 207/994 (20.82%), Postives = 372/994 (37.42%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIK----------------------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMK--IGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYN--NEDCLEGNFYPNGEWNDISCK-TKNYLIYEYESTAEKEIT---------------IEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINS-VLCYK------------PFXXXXXXXXXXGKIDTSKYFVHT----------GRVTYEEALRFCQIHSCRLVTIENSELDILILNL-------ARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTK-----------------ELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ---YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS------------------PPIIFIDEHMSYKIFINKVTYREAVDK----CQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSD----KENNNCLY----SSETLSGKWLGTSC-VSKNSVICYK---PS---------KTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDK 3894
            F+  + +  A+  C+  G +LL I   ++   IY   +     T W+  ND+     + ++DS  + Y  W    P+  E E+C        G W++  C      IC K     N T+                       Q   Y+++   + +  A   C +    +V I  +   + I   +K+MK  I   WI  +D   +  +  +    +++  W   EPNN+   NEDC+   + P G WND  C  +   +  +    A+  I                 ++ E  + +  A E+C S    L  I N      V  +       Q+W+  N+ N  G F +  G  ++Y N+   +P        V       GLW    C SI S  +C +            P               +S  F H            R+T+ +A +FCQ H  +L +    E +  +  +       A +H+    W+ G   +    W   DG+ + Y N+ +G   NYG+ +C   N  A+  W    C ++  +I    +  +  +                 + ++F+ R T+++AQ  C     SLV + + + NQ +     K    +   +W+  +    +G+F  S++  L Y  +  G+P     E     +  S G W+D  C+    ++C + +                  P       H  YK+F  +++ R   D     C ++  +L+ V N  +   + TL L     + W+ G  S++  ++ + +   L++ NW     P D    K   NC+     S + ++G W    C   K+  IC K   P+          ++D   E    +Y I +  + +  AL  C+     L  V     N YL  L   L    +    N+     +W+   ++++TF +W +G+ N  +   C     +G+W   +C+ K
Sbjct:  258 FQATLSWSEARTSCQQQGADLLSIT--KVEEQIYR-EINMITATLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENCGVISTDAQGRWHNRDCSVALPYICKK---RPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYI---TKHMKKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCVT-IWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWI-GISRRNSDSWTWSDGSAVTYQNFGRG---NYGSAECGAAN-MADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFLVSTLRKMSRQENELWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQISASKGDWSDQRCHVDLPYVCKRVNVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTL-LPNSSFHLWV-GLTSESQAQFKWFEPGFLSYTNWAPGE-PVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYLTLLLSTLRKPAWIALHNEGGRSYSWL--GEEEITFSDWRDGEPN--QMYGCGHMTTEGQWTVAACNTK 1229          

HSP 2 Score: 127.487 bits (319), Expect = 6.408e-29
Identity = 227/1160 (19.57%), Postives = 429/1160 (36.98%), Query Frame = 1
Query:  541 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNA--LWNDISCADSNAVICYKESKIEVLKKITV---------------LNKELVIF---KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ--NEDCVHGLYYKNALWNDIKCEDLNAVICYKNI----------GSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKC-DYKNSVICSKD-----------------ILNSNETIKQQQKYYVH----------EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEW-------SKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEW--------NDISCKTKNYLIYEYESTAE---------KEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ-----YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP------FXXXXXXXXXXGKIDTSKYFVH----------TGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEP------NNYGNEDCLL--GNYFANGKWNDFSC-STKNSFIYYYIENIISTKELE------------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIY-DLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNN-YGNEDCVHGLYYSNGFWNDIACNSK-NSFICS---------KYSPPIIFID----------EHMSYKIFINKVTYR-EAVDKCQSEGYSLIKV--ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNW--QTASLPSDKENNNCLYSSETLSGKWLGTSCVSK-NSVICYKP 3540
             Q   ++  A   C+ +G  L+ I   ++   +Y   +       W+  ND+   G +  +D   + Y  +    P+ Y + E+C  G+  ++A   W++  C+ +   IC K      L   T                 N +   +    ++L +  A   C+     LV I        +  + ++ +I   WI  +D  ++  FE +D+  + F+ W   EPNN++  NEDCV  ++     WND  C      IC K            G +   K+  S     + EE + FK A+ +C +N   L  I++    + +           +W+  N+  +  TF +    +++Y  W   +P   +    V       GLW    C   ++  IC ++                 +  S  +  +    + H          E  +T+ +A  FC +H  ++   S  E    +++        ++  +    WI G        W  S G+ + Y N+ +    NY + +C   N   +  W         D  CK     + E   + E         +E   ++ E +  + +A  +C      L+ + + + N+ +  V+T  K+ +     +W+  +    +G+F +SD   ++Y ++  G+P   + E     +  + G W+D  C+     +C +                  G       F+H          + R T++ A + C      LVT+ N  +   ++ L         W+ G   + + ++   +   L Y NW  GEP       + GN   LL        G W    C + K+ FI    ++   +  ++                  I ++R+ +  A   C     +L  +   E  QN Y  L +       WI  +++     +       + +S +  GEPN  YG   C H    + G W   ACN+K N+ IC          ++  P +              +  Y   ++++ ++ EA+  C   G  L+ +  EN +     H  S + +    W+    +  +G   +S G+ + + NW  Q A+L S    N+C +     +G W   SC ++ + VIC +P
Sbjct:  258 FQATLSWSEARTSCQQQGADLLSIT--KVEEQIYR-EINMITATLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPS-YDEEENC--GVISTDAQGRWHNRDCSVALPYICKKRPNA-TLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKH-MKKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWH-SPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWI-GISRRNSDSWTWSDGSAVTYQNFGR---GNYGSAECGAANM-ADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFL--VSTLRKMSRQENELWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQISASKGDWSDQRCHVDLPYVCKRVNVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTLLPNSSFH-LWV-GLTSESQAQFKWFEPGFLSYTNWAPGEPVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAV--REPRQNAYLTLLLSTLRKPAWIALHNEGGR-SYSWLGEEEITFSDWRDGEPNQMYG---CGH--MTTEGQWTVAACNTKLNAAICEMNTEKTKEHRWMYPGVCPQPVGNWSWIPFRNHCYSFILHELQFKQEAIRMCSKVGAKLLSILDENENGFVWEHMQSFQQQAHGAWLGMIFNSKEGSLEWSSGEIVDYSNWEQQDANL-SMLSANSCFWVKSN-TGLWRPESCKNRTHGVICKRP 1388          

HSP 3 Score: 111.309 bits (277), Expect = 4.724e-24
Identity = 153/713 (21.46%), Postives = 273/713 (38.29%), Query Frame = 1
Query: 2065 MEGKVNYIKALELCKSKGYDLIRIEN------EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN--GLWNDISCNSINSVLCYK-------PFXXXXXXXXXXGKID-------TSKYFVHTGRVTYEEALRFCQIHSCRLVTIEN-SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYG--NEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENII-----------------------STKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNS-KNSFICSK--------------------YSPPIIFIDE---HMSYKIFI-----NKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVN------YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTI--------DTGKE---VKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSI---EKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNCLQ-GNPDGKWRDVSCDDKNPF 3903
             +  +++ +A   C+ +G DL+ I         EIN I   +         W+  ND+++ G + ++D   + Y N+    P+    E+C  G+  T+  G W++  C+     +C K       PF  D        + D       T  Y++++ ++ +  A R CQ     LV+I    EL+ +  ++  K  I   W+  +D   +  +   D   + +  W+  EPNN+   NEDC+   +   G+WND  C+       Y + +I                        S    ++ +E +TF++A+  CI    +L  I+N      +  L       Q+W+  N++   G F       L Y+ + R +P        V     + G W    C S ++ +IC +                     S P  +         YK+F       ++T+ +A   CQ  G  L       + +F+   L   +           WI G   +N   WT+SDG  +T++N+   +  S +       ++      WL + C S+   IC  P   +        DTG E    ++ +Y +     T+ +A   C      L+ + +   N +L    +K+S    E +W+  +   N+G +  SD   L + +W  G+   I K   C+Q     G W D  C    P+
Sbjct:  258 FQATLSWSEARTSCQQQGADLLSITKVEEQIYREINMITATL---------WMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENC--GVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHM--KKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCVT-IWGPEGRWNDSPCN-------YSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWI-GISRRNSDSWTWSDGSAVTYQNFGRGNYGSAE-----CGAANMADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFLVSTLRKMSRQENELWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQISASKGDWSDQRCHVDLPY 943          

HSP 4 Score: 93.9745 bits (232), Expect = 9.975e-19
Identity = 165/859 (19.21%), Postives = 306/859 (35.62%), Query Frame = 1
Query:  160 EKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR--NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRE---------LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCAD-SNAVICYKESKIEVLKKITVLNKELVI-------------------------FKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNY-------AVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGS----------RGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIG---TYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETI-------------KQQQKYYVHEVL----------VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN-GNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFY------P---NGEWNDISCKTKNY------------------LIYEYESTAEKE-ITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINK-IVYDVATKNKVGQYWINANDINVEGQFIYS--DGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNS-INSVLC 2388
            +K  +  A++ CQ    NL+ I    + ++ T+     I+      WI  +D  ++  FE+ +   + +  +   EPNN+R  NEDCV  ++  +G WND  C+ +   IC K  Q     +     +            + +E  T+++A   C S    L  I++    + V +L       ++W+  N+  + G F    G ++ Y  +   +P    K    V     +  LW    CA   +  IC +      +           +                          ++RLT+ +A   C+  G +L      +  + V+         A ++     WI  +  R   ++  SD + + +  +  G   NY + +C       +  W    CE     IC    G            G    +    +  +FE +  +  AQ +C      L+ + S + N  +     K +      +W+  +  + +  F +SD   ++Y  W PG+P     E     +    G W+D +C      +C +  +N   TI              Q    ++H+             T++ A   C      +V + N      +     N      W+   ++   + KW +     L Y NWA  EP + N +    GN        P    G W    C  + +                  L    +   E + +   I++ ++++  AL++C+S    L  +     N  +   ++T  K    WI  ++   EG   YS    + I++ ++  GEPN      C H    T G W   +CN+ +N+ +C
Sbjct:  403 DKLDWRSADRTCQKMEANLVSIHTLPELEYITKHMKKDIE----ELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCV-TIWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQV-KGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGISR-RNSDSWTWSDGSAVTYQNFGRG---NYGSAEC-GAANMADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFLVSTLRKMSRQENELWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQISASKGDWSDQRCHVDLPYVCKR--VNVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTLLPNSSF-HLWVGLTSESQAQFKWFEP--GFLSYTNWAPGEPVD-NKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYLTLLLSTLRKPA--WIALHN---EGGRSYSWLGEEEITFSDWRDGEPNQMYG--CGH--MTTEGQWTVAACNTKLNAAIC 1235          

HSP 5 Score: 76.6406 bits (187), Expect = 2.259e-13
Identity = 134/712 (18.82%), Postives = 272/712 (38.20%), Query Frame = 1
Query:  154 FQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAI----QYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICY----KNTQPKTSHV------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-----YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKK---------------ITVLNKELVIFKERL----TYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEP-NNYQNE---DCV---HGLYYK-NALWNDIKCE-DLNAVICYKN---IGSRGFTK--------FEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYK-NSVICSKDILNSNETIKQQQKY----------------------YVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNM--KIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPN----NYNNEDCLEGNFYPNGEWNDISCKTKNYLI 2019
             +++ T+ +A+K CQ  G  L      E++ F  Q+ + A     ++     WI  +  +   ++ + +G  + Y  F +G   NY + +C       D  W    C+     IC     K  +   SH       +     +  + + ++T++ A   C      L+ +   + N  +  ++   ++ R     +W+  +  +N+G F  SD   + Y  + PG+P    K   CV  +  S   W+D  C      +C + +    +                    L+K   +F E L    T+  A   C +Q   LV + + +  + +    + N+    W+       +  F+  +   + ++ WA GEP +N Q +   +CV   HG   +   +W   +C+ + +  IC K+     S G  +         E    +  I ++++ +  A  +C++    L  +     N+ +    +       WI  ++ +   ++ +   ++I++  W  GEPN      C H      G W    C+ K N+ IC    +N+ +T + +  Y                      ++   L   +EAI  C++   +++ I +   N  ++E  ++   +    W+       EG    S G  + Y NW + + N    + N+   ++ N    G W   SCK + + +
Sbjct:  694 LEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGISR-RNSDSWTWSDGSAVTYQNFGRG---NYGSAECGAANM-ADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFL--VSTLRKMSRQENELWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQ-ISASKGDWSDQRCHVDLPYVCKRVNVTGTIPPTPSLPLTPAGCPQGWTPFLHKCYKVFGEELSSRSTWDAASKTCLTQRATLVTVPNHRVQAFLVTL-LPNSSFHLWVGLTS-ESQAQFKWFEPGFLSYTNWAPGEPVDNKQMKSPGNCVLLLHGSPQRITGMWASRRCDAEKHGFICMKDKDPALSPGVDRLPPSLDGPLEFDGVQYRILQKRLDWHSALQVCESVNGTLAAVREPRQNAYL-TLLLSTLRKPAWIALHN-EGGRSYSWLGEEEITFSDWRDGEPNQMYG--CGH--MTTEGQWTVAACNTKLNAAICE---MNTEKTKEHRWMYPGVCPQPVGNWSWIPFRNHCYSFILHELQFKQEAIRMCSKVGAKLLSILDENENGFVWEHMQSFQQQAHGAWLGMIFNSKEGSLEWSSGEIVDYSNWEQQDANLSMLSANSCFWVKSN---TGLWRPESCKNRTHGV 1383          
BLAST of Mannose-binding protein C vs. Ensembl Zebrafish
Match: si:dkey-11o15.7 (si:dkey-11o15.7 [Source:ZFIN;Acc:ZDB-GENE-091204-328])

HSP 1 Score: 154.451 bits (389), Expect = 1.767e-37
Identity = 229/1067 (21.46%), Postives = 416/1067 (38.99%), Query Frame = 1
Query:  508 VIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNE-------GNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADS-NAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQ-------FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDAND------IQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISN-VETNKIIYEWSKNMKIG----RFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE---IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINA-NDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRV-TYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKF-VDSNNHALKYSKFPRG---EPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFI---NKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRY----KLVNYWIDGTDSKNDGKWTFSDGQQLTFKNW------------QTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK 3537
             + L + + + + +  T+  A  +C+ K   L  I+++Q    + +      I   WI   D  N         +F  +  K   +R +   +P +Y     CV   Y +  +W    C++     +CY   K          +   V   +   + +AQ  C+     L+ I +E        F S  YNYAV       WI     R       SD++   FS W++ +P+  ++  C    +  +  W D  C      ICY   G         S+++  +  + + +  AQ  C+ N  +L  ID+ +E+N +I      ++ G+ WI   D         E+   Y   ++  Y+ +Y    N+   E CV+     NG W D  CDY    +C    +N++      Q+Y       T+ EA  +C  +   +V + N  E  KI+      + IG    R W N  +   E  W       L   +   N+ N +  + C   +F  +G+W D  C +K        +  +   T +   I E K ++ +A   C+    DL  I+N E  K ++        G+ WI   +D+N     + +      ++++   +P N         + Y+ G W++  C+     +CY             G+++ S  +V   +  ++ +A  +C+ H   +V+I N   +  +  L+  + +   W+    + +   W   D +   + NW  G+P+N GN E C   ++  +G W D +C+T   FI Y    I S+++     + +++ +AQ  C +    L  IDN E    + +    +  G  WI   D     ++ ++ N+   +  +  R    EPNNYG ++    +   NG W D +C S        Y PP+ +     + + +I     + +  A   C+     L  V N ++   I++    RY       N WI    ++      +SD    +F  W              AS+P+++   +C   S    G+W    C +     CY 
Sbjct:   13 ALALCDLQYVFVNQSKTWAEAQRYCRDKYTDLATIENEQQTIQLLDTVNDDSIDLAWIGLYDDLNSWKWTLENSDFFKAGEKD--FRNWYNPDPYSYGAQSICV---YMNRGIWYTTDCSNRLYPTVCYDGRK--------NASATYVFLYQYKNWTEAQSYCREHHTDLISIRNETENQKIEYFLSSYYNYAV-------WIGLYKTR-----SWSDQSNSSFSYWSSWQPD--RSGSCAVVSFSDSWKWADEYCNYAFPFICYSVSG---------SSRQYYLVNQSLSWTEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYS-GSAWIGQYDDVNSWRWSLEDNDFYLQGER-DYRNFYHEPDNSGGKELCVYMN--SNGKWYDTSCDYTQQFVCYDGRVNTS------QRYIRIYDSKTWTEARRYCRNYYTDLVNVRNQTENQKILERTGGGVWIGLYRNRVWSNNQNSTYE-NWRPQINGLLAQPDNGVNQGNEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYSCTRQYHFISEFK-SWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRWSLNNTTLQGGFKSWYVQKPVNSGGNSLCAYMSYSQGRWSEAPCSLSLFFICYD------------GRVNASTSYVFVYQYKSWTDAQSYCREHHTDIVSIRNEMENYRVQALSNSYTV---WI---GLYRSRSWS--DQSNSSFSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFICY--SAITSSRQYHFVNQSMSWTDAQRFCRQSYTDLATIDNMEEMNRLINTVNSSYNGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWYHEPNNYGGKELCAYM-DPNGNWYDTSCES--------YYPPVCYDGRENATQKYILVSTGMPWTSAQSYCRQRYTDLASVRNETEWQQILNITRYRYYSYLSGYNVWIGLYRNR-----LWSDQSSSSFTYWLPQIQSDVAQPDNGASVPAEQGAQHCTTVSLKYFGQWTDERCFATLPFFCYS 995          

HSP 2 Score: 147.517 bits (371), Expect = 2.667e-35
Identity = 200/917 (21.81%), Postives = 360/917 (39.26%), Query Frame = 1
Query: 1276 GFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDAND------IQTENTFVYSDSKKISYQKWYPGEPNNYENED-CVHGLYYKNGLWNDIKCDYK-NSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLN-WAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINA-NDIN-----VEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHT-GRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNW---------------NQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYY--YIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALK---YSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSD-----KKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNP 3900
            GF    + + + V   +   +  AQ  C++   +L  I++++    + D     +I   WI   D         EN+  +   +K  ++ WY  +P +Y  +  CV   Y   G+W    C  +    +C     N++ T     +Y        + EA ++C +H+  ++ I N   N+ I  +  +      WI    +     W D   +   Y + W  +   +     C   +F  + +W D  C      I    S + ++  +  +   +++ +A   C+    DL  I+N EE+N+++ +    +  G  WI   +D+N     +E    Y  G+   YRNF H   N+   E CV+    +NG W D SC+     +CY             G+++TS+ ++      T+ EA R+C+ +   LV + N   +  IL    +    G W+    + +   W N       Y NW               NQG  N +G + C   ++  +G+W D  C +K  F  Y         T++     E  ++ EAQ  C +    L  IDN E  + ++        G+ WI   D     ++   NN  L+    S + +   N+ GN  C + + YS G W++  C+    FIC         ++   SY       ++ +A   C+     ++ + N   ++ V  LS  Y +   WI    S+     ++SD    +F NW++    +   +  C   S + SG W   +C +    ICY     I + ++     Y+     +++ +A  FC++    L  +DN++    L            W+   D  N   W   D     + +  + NW +   N    + C   +P+G W D SC+   P
Sbjct:   10 GFFALALCDLQYVFVNQSKTWAEAQRYCRDKYTDLATIENEQQTIQLLDTVNDDSIDLAWIGLYDDLNSWKWTLENSDFFKAGEK-DFRNWYNPDPYSYGAQSICV---YMNRGIWYTTDCSNRLYPTVCYDGRKNASATYVFLYQY------KNWTEAQSYCREHHTDLISIRNETENQKIEYFLSSYYNYAVWIG---LYKTRSWSDQSNSSFSYWSSWQPDRSGS-----CAVVSFSDSWKWADEYCNYAFPFICYSVSGSSRQYYL--VNQSLSWTEAQRFCRQNYTDLATIDNMEEMNRLI-NTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYLQGER-DYRNFYHEPDNSGGKELCVY--MNSNGKWYDTSCDYTQQFVCYD------------GRVNTSQRYIRIYDSKTWTEARRYCRNYYTDLVNVRNQTENQKIL----ERTGGGVWIG---LYRNRVWSN--NQNSTYENWRPQINGLLAQPDNGVNQG--NEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYSCTRQYHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRW-SLNNTTLQGGFKSWYVQKPVNSGGNSLCAY-MSYSQGRWSEAPCSLSLFFICYDGR-----VNASTSYVFVYQYKSWTDAQSYCREHHTDIVSIRNEMENYRVQALSNSYTV---WIGLYRSR-----SWSDQSNSSFSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFICY---SAITSSRQ-----YHFVNQSMSWTDAQRFCRQSYTDLATIDNMEEMNRLINTVNSSYNGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWYHEPNNYGGKELCAYMDPNGNWYDTSCESYYP 856          

HSP 3 Score: 140.198 bits (352), Expect = 5.286e-33
Identity = 221/967 (22.85%), Postives = 388/967 (40.12%), Query Frame = 1
Query:  901 ITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDV--RIEGTFEDSDKNKI---KFSKWAAGEPNNYQNED-CVHGLYYKNALWNDIKCED-LNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNED-------CLEGNFYPNGEWNDISCK-TKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAH------GEPNN---QNNE----DCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLK--YLNWNQGEP-NNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN-EDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQ-----QLTFKNWQTASLPSDKENNN------CLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDN 3669
            + + + + V   +  T+ +AQ  C+ +   L  I++EQ    + +    ++I   WI   D     + T E+SD  K     F  W   +P +Y  +  CV   Y    +W    C + L   +CY         +   S   + +++ K  +  AQ  C+ +  +L+ I ++  N  I     ++ + +Y+  A  I    T  +SD    S+  W   +P+   +  C    +  +  W D  C+Y    IC              ++YY+    +++ EA  FC Q+   +  I N+E    +         G  WI   D +   +W  S  +   YL   ++  N Y+  D       C+  N   NG+W D SC  T+ ++ Y+      +   I I + K  + +A   C++   DL+ + N+  N+ +     +   G  WI      +    ++S+ QN +Y N+         +P+N   Q NE     C    F  +G W D  C S     CY                 T +Y   +   ++ EA RFC+ +   L TI+N E    +    R       W+   D      W +++   L+  + +W   +P N+ GN  C   +Y + G+W++  CS    FI Y      ST  + +++ + ++ +AQ+ C +    +V I NE  N  +  L+    +   WI          + D +N +  +S +  G+P+N GN E C    +  +G W D  CN+   FIC  YS     I     Y      +++ +A   C+     L  ++N  +++ +++T++  Y   + WI   D  N  +W+  D       +  ++NW         E NN      C Y     +G W  TSC S    +CY        G+E    KY +   G+ +  A  +C++R   L  V N
Sbjct:   14 LALCDLQYVFVNQSKTWAEAQRYCRDKYTDLATIENEQQTIQLLDTVNDDSIDLAWIGLYDDLNSWKWTLENSDFFKAGEKDFRNWYNPDPYSYGAQSICV---YMNRGIWYTTDCSNRLYPTVCYDG-------RKNASATYVFLYQYKN-WTEAQSYCREHHTDLISIRNETENQKI-----EYFLSSYYNYAVWIGLYKTRSWSDQSNSSFSYWSSWQPD--RSGSCAVVSFSDSWKWADEYCNYAFPFICYS-------VSGSSRQYYLVNQSLSWTEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRW--SLEDNDFYLQGERDYRNFYHEPDNSGGKELCVYMN--SNGKWYDTSCDYTQQFVCYDGRVNTSQRY-IRIYDSKT-WTEARRYCRNYYTDLVNVRNQTENQKI----LERTGGGVWIG-----LYRNRVWSNNQNSTYENWRPQINGLLAQPDNGVNQGNEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYSC--------TRQYHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRW-SLNNTTLQGGFKSWYVQKPVNSGGNSLCAYMSY-SQGRWSEAPCSLSLFFICYDGRVNASTSYVFVYQYK-SWTDAQSYCREHHTDIVSIRNEMENYRVQALSNSYTV---WIGLYRSR---SWSDQSNSS--FSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFIC--YSA----ITSSRQYHFVNQSMSWTDAQRFCRQSYTDLATIDNMEEMNRLINTVNSSYN-GSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWY-------HEPNNYGGKELCAYMDP--NGNWYDTSCESYYPPVCYD-------GRENATQKYILVSTGMPWTSAQSYCRQRYTDLASVRN 898          

HSP 4 Score: 135.961 bits (341), Expect = 9.105e-32
Identity = 206/978 (21.06%), Postives = 379/978 (38.75%), Query Frame = 1
Query:  139 KYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWI----DANDIK--VEGTFEYVNGQRIKYHKFAKGEPNNYRNED-CVHGMFYKDGFWNDISCDDT-NSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQ-----FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSD---KNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYP------GEPNNYENED-------CVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKW-VDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ-NNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYW-------------LDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYY-YIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLA 2937
            +YV + Q KT + EA + C+ K  +L  IE++Q   Q+ +          WI    D N  K  +E +  +  G++  +  +   +P +Y  +  CV   +   G W    C +     +CY   +  ++          + L +   +  A ++C+     LI I ++  N  +      Y     WI     ++      SD     +  ++  +P+   ++  C    +  +  W D  C  +   ICY          ++  +++  +  + L++ +AQ  C+     L  ID+ +      N++  +Y+    IG+Y  D N  R   + ED+D   + +  +  +     N+   E CV+     N  W D  C+     +CY         +   S + I I++ K  +  A+  C+N   +L+ + +   N  I    ++   G  WI     +     V+S+++  +Y+ W P       +P+N  N+        C    +  +G W D  C  K    C           +Q   Y+      ++ EA  FC Q+   +  I N+E  K +++  +    G+ WI   D +   +W +++   +  + +W   +P N           Y  G W++  C    + I  Y+       +   +    ++  A   C+    D++ I NE  N  V  ++    V         I +     +SD  N S+ N+  G+P+N  N+E C    F  +G W D +CN+    +CY                 + +Y      +++ +A RFC+     L TI+N E    ++N          W             L+ ND  +EGE          Y NW   EPNNYG ++ L      NG W D SC +    + Y   EN  +T++  +    + +  AQ+ C ++   L  + NE   Q I ++ 
Sbjct:   20 QYVFVNQSKT-WAEAQRYCRDKYTDLATIENEQQTIQLLDTVNDDSIDLAWIGLYDDLNSWKWTLENSDFFKAGEK-DFRNWYNPDPYSYGAQSICV---YMNRGIWYTTDCSNRLYPTVCYDGRKNASA--------TYVFLYQYKNWTEAQSYCREHHTDLISIRNETENQKIEYFLSSYYNYAVWIGLYKTRSW-----SDQSNSSFSYWSSWQPD---RSGSCAVVSFSDSWKWADEYCNYAFPFICYS---------VSGSSRQYYLVNQSLSWTEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQY-DDVNSWRW--SLEDNDFYLQGERDYRNFYHEPDNSGGKELCVYMN--SNGKWYDTSCDYTQQFVCYDG-------RVNTSQRYIRIYDSKT-WTEARRYCRNYYTDLVNVRNQTENQKI----LERTGGGVWIGLYRNR-----VWSNNQNSTYENWRPQINGLLAQPDNGVNQGNEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYSCTRQ---YHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRWSLNNTTLQGGFKSWYVQKPVNSGGNSLCAYMSYSQGRWSEAPCSLSLFFIC-YDGRVNASTSYVFVYQYKSWTDAQSYCREHHTDIVSIRNEMENYRVQALSNSYTVW--------IGLYRSRSWSDQSNSSFSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFICYSAI------------TSSRQYHFVNQSMSWTDAQRFCRQSYTDLATIDNMEEMNRLINTVNSSYNGSAWIGQYDDVNSWRWSLEDNDFYQEGE--------RDYRNWYH-EPNNYGGKE-LCAYMDPNGNWYDTSCESYYPPVCYDGREN--ATQKYILVSTGMPWTSAQSYCRQRYTDLASVRNETEWQQILNIT 909          

HSP 5 Score: 113.235 bits (282), Expect = 1.140e-24
Identity = 150/708 (21.19%), Postives = 270/708 (38.14%), Query Frame = 1
Query:  106 PKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWI----DANDIK--VEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAP------GEPNNY--QKNE----HCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWI----DANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDS-----KGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENE 2145
            P I   +   S+   +  +  ++TEA + C+    +L  I++ +   ++ N     ++G  WI    D N  +  +E    Y+ G+R  Y  F     N+   E CV+     +G W D SCD T   +CY      +   I++ + +        T+  A  +C++    L+ + +   N  +    ++   G  WI         N + S+ +   Y  + P       +P+N   Q NE    HC    +  +  W D  C       CY  +  +         ++     E  ++ +AQ  C+     L  ID+ +    ++        G+ WI    D N  R      ++   +  F  W   +P N         + Y    W++  C      ICY         +   S   + +++ K  +  AQ  C+ +  +++ I ++  N   Y      N  T WI     ++     +SD    S+  W  G+P+N  N E C    +  +G W D  C+     IC   I +S      +Q ++V++ + ++ +A  FC Q    +  I N+E    +     +   G  WI   D +   +W        +  +  Y NW  +EPNNY  ++ L     PNG W D SC++  Y    Y+          ++   + +  A   C+ +  DL  + NE
Sbjct:  246 PFICYSVSGSSRQYYLVNQSLSWTEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYLQGER-DYRNFYHEPDNSGGKELCVY--MNSNGKWYDTSCDYTQQFVCYDGRVNTSQRYIRIYDSK--------TWTEARRYCRNYYTDLVNVRNQTENQKI----LERTGGGVWIGL-----YRNRVWSNNQNSTYENWRPQINGLLAQPDNGVNQGNEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQY-----SCTRQYHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRWS---LNNTTLQGGFKSWYVQKPVNSGGNSLCAYMSYSQGRWSEAPCSLSLFFICYDG-------RVNASTSYVFVYQYK-SWTDAQSYCREHHTDIVSIRNEMEN---YRVQALSNSYTVWIGLYRSRS-----WSDQSNSSFSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFICYSAITSS------RQYHFVNQSM-SWTDAQRFCRQSYTDLATIDNMEEMNRLINTVNSSYNGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNW-YHEPNNYGGKE-LCAYMDPNGNWYDTSCESY-YPPVCYDGRENATQKYILVSTGMPWTSAQSYCRQRYTDLASVRNE 899          

HSP 6 Score: 107.457 bits (267), Expect = 6.110e-23
Identity = 135/614 (21.99%), Postives = 240/614 (39.09%), Query Frame = 1
Query:   40 NALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVY-----NLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNF-ISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRY--WIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDAND------IQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRF 1833
            N  W D SC+     +CY          +    +Y+ I+  K T+TEA + C+    +L+ + +   N ++       + I  +  R W +  +   E     +NG  +        + N +  + C    F   G W D  C       CY  T  + S       R+   + E  ++  A   C+     L  ID+ +    ++        G+ WI   D  N   + +++   +  ++ +   +P N   N  C + + YS   W++  C+ S   ICY         ++      + +++ + ++  AQ  C+     +V I +E     + NY VQ     Y  WI     R       SD++   FS W +G+P+N  N E C    +  +  W D  C      ICY  I          S+++     + + +  AQ  C+ +  +L  ID+ +E+N +I      +N G+ WI   D         E+   Y + ++  Y+ WY  EPNNY  ++    +   NG W D  C+     +C     N+       QKY +    + +  A ++C Q    +  + N ET     EW + + I R+
Sbjct:  356 NGKWYDTSCDYTQQFVCYD-------GRVNTSQRYIRIYDSK-TWTEARRYCRNYYTDLVNVRNQTENQKILERTGGGVWIGLYRNRVWSNNQNSTYENWRPQING-LLAQPDNGVNQGNEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYS-----CTRQYHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRWSLNNTTLQGGFKSWYVQKPVNSGGNSLCAY-MSYSQGRWSEAPCSLSLFFICYD-------GRVNASTSYVFVYQYK-SWTDAQSYCREHHTDIVSIRNE-----MENYRVQALSNSYTVWIGLYRSR-----SWSDQSNSSFSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFICYSAI---------TSSRQYHFVNQSMSWTDAQRFCRQSYTDLATIDNMEEMNRLINTVNSSYN-GSAWIGQYDDVNSWRWSLEDNDFYQEGER-DYRNWYH-EPNNYGGKELCAYM-DPNGNWYDTSCESYYPPVCYDGRENAT------QKYILVSTGMPWTSAQSYCRQRYTDLASVRN-ET-----EWQQILNITRY 911          

HSP 7 Score: 75.0998 bits (183), Expect = 4.774e-13
Identity = 98/480 (20.42%), Postives = 185/480 (38.54%), Query Frame = 1
Query:   10 EHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWI-----------DANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDD-EQFNSIVYNYAVQNNIGRYWI----DANDVRIEGTFEDSD---KNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKI 1389
            +HC    +  +  W D  C       CY  T  + S   +          E  ++ EA + C+    +L  I++ +   +++      + G+ WI             N+  ++G F+           + +   N+  N  C + M Y  G W++  C  +   ICY       TS+V         + Q K ++ +A ++C+     ++ I ++  N  V  L+  Y +   WI     ++      SD     +  +  G+P+N   +E+C    +  +  W D +C  +   ICY  S I   ++   +N+        +++  AQ  C+     L  ID+ E+ N ++ N    +  G  WI    D N  R   + ED+D   + +  +  W   EPNNY  ++    +   N  W D  CE     +CY           E + ++ ++    + +  AQ  C+    +L  +
Sbjct:  471 QHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYSCTRQYH-----FISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRWSLNNTTLQGGFK---------SWYVQKPVNSGGNSLCAY-MSYSQGRWSEAPCSLSLFFICYDGRVNASTSYV--------FVYQYK-SWTDAQSYCREHHTDIVSIRNEMENYRVQALSNSYTV---WIGLYRSRSW-----SDQSNSSFSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFICY--SAITSSRQYHFVNQS-------MSWTDAQRFCRQSYTDLATIDNMEEMNRLI-NTVNSSYNGSAWIGQYDDVNSWRW--SLEDNDFYQEGERDYRNWYH-EPNNYGGKELCAYM-DPNGNWYDTSCESYYPPVCYDGR--------ENATQKYILVSTGMPWTSAQSYCRQRYTDLASV 896          
BLAST of Mannose-binding protein C vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 187.963 bits (476), Expect = 2.132e-47
Identity = 233/1142 (20.40%), Postives = 440/1142 (38.53%), Query Frame = 1
Query:  130 LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYY------------KAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDC-VHGLYYKNALWNDIKCEDLNAVIC------------------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVIC---------------SKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYEST---AEKEITIEIMEG-----------------------KVNYIKALELCKSKGYDLIRIENEEINK-IVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ------NNEDCV---HGLFYTNGLWNDISCNSINSVLCYK----PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE--------------------IFKERVTFE----EAQNTCIKKGWSLVRIDNEETNQNIYDL--AVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            L + + I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV      +  W+D  C      IC ++       ++ +++K      +R  YY            +A   C   G  LV ++D    + + +        ++W    D    G ++ ++  ++ F+ W +  P   +   C V     K  LW+ I CE+    +C                        +K     G      S  E    EEK  +  ++  CK  G +L+ I+S E  +++           +WI       E  F + D   +SY+ W  GEPNN++  +    L+    L WND  C+     IC               S ++ +      +  +Y++   +V  ++A  FC ++   +V I++    K ++ +    +I  +           +W+D  G+ + Y+ WA  EPN  NN++     +   G WNDI+C   N  I E +++   A    T    +G                         ++  A   C     +L  +ENE +   + Y++   N     WI  ND N E +F+++D + + Y N+A G P         ++ DCV    G     G W +  C+     +C      P            K     + +   +++++EA R C+     LV+I +   +  +     K++   +W+  N  K   ++   D  KL+Y  W   EP       C+  +   +G+W   SC+     I    + I  T   +                     +  +V++     +A   C++ G SL   D+   +  ++     +++++  +WI    + VE K++  +N  + +  +  GEP+++ +E CV  +Y S+G WN++ C+S   +IC
Sbjct:  206 LTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE----EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQ---IFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLY------FFLFFRWMD--GSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNI--DVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMY-QNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1319          

HSP 2 Score: 180.644 bits (457), Expect = 3.975e-45
Identity = 214/913 (23.44%), Postives = 357/913 (39.10%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL-WNDISCADSNAVICYKESKIEVLKKITVLNKELV-------------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKN-ALWNDIKCEDLNAVICYKNIGS--RGFTKFEISNK-----EIVIF------------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY------ENEDCV---HGLYYKNGLWNDIKCDYKNSVICSKD-ILNSNETIKQQQKYY--------VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWI--NGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATK--NKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            K E CV      +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C   L+ S  L WND  C  S   IC  +    +  + T  + EL              I  E +   KA++ CK     LV I+D+     ++ Y +   I  Y+           F   D + + +  WA+ EPN   N E+CV  + YKN   WNDI C   N  IC +   S    F     S +     + + F             E   +  A+  C      L  ++++ + + +       NI   WI  ND   E+ F+++D + + Y  W  G P         ++ DCV    G     G W + +C      IC  D  L ++ TI    +++        +    ++++EA   C   +  +V I++  TN  +  ++   +   FWI  N N    + KW D+   KL Y  WA  EP       C+  +   +G+W   SC T+NY     +S A          GK                          N+ +A   C   G  L   ++   +  V+    +  ++V  +WI     NVE ++++ D   + + N+  GEP++ N+E CV  ++ ++G WN++ C+S    +C
Sbjct:  438 KQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGE-LHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNW--KLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSC-TENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1319          

HSP 3 Score: 177.178 bits (448), Expect = 4.030e-44
Identity = 242/1123 (21.55%), Postives = 440/1123 (39.18%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIG-RYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK-NIGSRGFTKFEISNKEI--------------VIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNS--------NETIKQQQK------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLE-GNFYPNGEWNDISCKTKNYLI-----------------YEYESTAEKEITIEIM----------EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCY----KPFXXXXXXXXXXGKIDT------SKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCS--------TKNSFIYYYIENIISTKELEIFKERVTF------------------EEAQNTCIKKGWSLVRIDNEETNQ----NIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY------GNEDCV---HGLYYSNGFWNDIACNSKNSFICS-----KYSPPI-----IFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKY----------------YIHRIGVT---FQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLS--IEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG-NPDGKWRDVSC 3885
            LT+++A+  C  Q  +L+ I   + +   +   + N +    W   N +     ++ S  +  ++  W  G P++    +CV     KN  W + +C      IC K +I S  F     S+  I               + +E  ++K A   C+    +L    + E  S I            WI  ND ++   F +SD   +SY  W  GEP++ +N  EDCV     K+G W+D  C+ K   IC +  L          ++  K+  K      Y + +   ++ EA   C  H   +V + +      +          +FW    D    G +  + G ++++ +W    P        +  GN    G W+ I+C+ K   +                  E +   + + + EI           E K  + ++   CK+ G DL+ I ++E   I+  +   N++  +WI     + E  F + DG  +SY N+A+GEPNN    +    L  +  L WND  C S    +C      P + +  +   E   D       ++YF+ T  V  ++A  FC+ +   LV I +      +      ++I  Y+           W  +DG+ + Y+ W   EPN   N++  +  Y   G WND +C          KNS I        ++ +     + +TF                  + A+  C++   +L  ++NE        N+ DL +       WI  NDK  E +F+ ++   + Y+ + +G P          + DCV    G     G W +  C+    +IC        SP I      F   + ++KI  +K+++ EA  KC+SE   L+ + +   +  +   + +Y+   +WI    +K   ++ ++D  +L +  W  A  P  K+   C+Y    + G+W  +SC      IC +      T    K  K                 Y+ ++  T   +Q +L+ C      L   D+   + ++W   ++L   ++ +W+ G  ++ E  W+  D   + F NW  G+ +    ++C++  +  G W ++ C
Sbjct:  218 LTWFQARKSCLQQESELLSI--TEIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGN--KGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYY-NQI--FWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRW--MDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNI-----DVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKW-AAEEP--KKTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGTWNNLYC 1311          

HSP 4 Score: 150.214 bits (378), Expect = 9.353e-36
Identity = 268/1204 (22.26%), Postives = 440/1204 (36.54%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE------------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIV-----------------IFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV-HGLYYKNGLWNDIKCDYKNSVICSK---------------------DILNSNETIKQQQKYYVH--EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN--GNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYE---------------YESTAEKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFYTN-GLWNDISCNSINSVLCYK---------------PFXXXXXXXXXXGKIDTSKYFVHTGRVT-YEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY------GNEDCL---LGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL-----------EIFK---ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC------SKYSPP---------------IIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLS-LRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC--LYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGK----EVKKTKYYIHRIGVTFQEALDF-CKERRCKLIVVDNIDTNIYL 3690
            Q   T+  A   C  +  +L+ I +    + +  L+        W   N +     +  S G    Y  + PG P++ +   +CV      N  W +  C      IC K S   +     V+  E                    + KE   + +A   C+ +   L    + +  S + +        + WI  ND +    FE SD   + ++ W  GEP++  N  EDCV     K+  W+D  CE     IC      R    FE    +I+                 I +    F  A   C  +G  L+ ++     + +           +W    D      + +++ +++ +  W    P       CV      K GLW+ I C+ K   +C +                     D   S E I    K++    E   T+ E+ +FC      +V I++ E   I+ +   N     FWI    +D     +WVD  G+ L Y NWA  EPNN+   E C E +      WND  C++    I E               YE T++  I  +     I    V   KA E CK    DL+ I ++   K ++      ++  Y+           F + DG  ++Y  +A  EPN  NN E+CV  + Y N G WNDI+C   N  +C +               P      +    GK     +    G  T ++ A   C   +  L T+EN EL    L    K      W+  ND  +E  ++  D   + Y NW +G P          + DC+    G+    G W +  CS    +I    + + ++  +           E FK    +++++EA   C  +   LV I +E TN  +     K +   +WI  N      ++  ++N  L+Y+K+   EP       CV+     +G W   +C      IC      +   PP               I F       ++   K  Y+ +++ C   G SL   ++S + +F+ H +  L  ++ ++WI G     + KW + D   + F NW     PSD  + +C  +YSS    G W    C S    IC      I T      ++     ++  +G     A+ + CK ++ K    ++ D N+Y 
Sbjct:  215 QAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSS-EPGINCVTLNTGKNGKWENKECNQKLGYICKKGS---ITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYIC-----KRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPE-IGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI---FWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVEN-ELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGE-PSDHNDEHCVEMYSSH---GTWNNLYCSSYRGYICKIQKNKIKTDAPSQGKIGGIIIFVLLVGAGSTYAVYYVCKRQKNKPPEDNSFDNNLYF 1377          

HSP 5 Score: 147.902 bits (372), Expect = 4.631e-35
Identity = 214/979 (21.86%), Postives = 382/979 (39.02%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK-----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYP-NGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN---GLWNDISCNSINSVLCYK------------PFXXXXXXXXXXGKIDTSKYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFI-------YYYIENIISTKELE-------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPI--IFIDEHMS----------------YKIFIN----KVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK-----ENNNCL---YSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQ---------EALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW--LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDD 3891
            +  + +  A+  C     ELL I   EI+   +   + + + T  W   N +     + +S      Y  W PG P++    +CV     KNG W + +C+ K   IC K  + S+  +   +                  Y V +    ++EA++ C +    +    NVE    I    +  +  + WI  ND  +   +  S G  + Y  W + EP++ +N  EDC+   F P +G W+D  C+ K   I + +    +   ++I++                      ++ +A + C   G  L+ +E+      +  +       Q+W    D +  G + +++G+ + + ++    P  +    CV  +  T    GLW+ I+C      +C +               E K     +   +    + H  R      T+ E+  FC+     LV+I NS+ +  IL+    ++I    L  +D ++  EWV  DG+ L Y NW  GEPNN+ G E C   +      WND  C +   +I           E   S+ EL              I  E V  ++A+  C K    LV I+++   + ++   +  +I  Y+       +  +++D +   + Y  +   EPN   N++    +Y + GFWNDI C   N +IC + +  I   F     S                YKIF N       +  A   C     +L  VEN  +   + T +L+   ++ WI   D   + ++ ++D + + + NW        +     ++ +C+     S   +G W    C      IC +  KT+     +  +  +      TF+         EA   CK    +L+ + +  TN +L   + K   E +W  LN N   N+  W  +D  KL +  W   +   +KT  C+  + DG+W+  SC +
Sbjct:  215 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVA--FDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRG--CV--VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSI-NSKEEETILSQLYYNQIFWIGLQTSDPEEGFEWV--DGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDGS--VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFL-TYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYIC-QTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKW--TDNWKLRYTKWAAEEP--KKTTACVYMDIDGQWKTSSCTE 1167          

HSP 6 Score: 95.9005 bits (237), Expect = 3.280e-19
Identity = 148/702 (21.08%), Postives = 253/702 (36.04%), Query Frame = 1
Query: 2068 EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVG-QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK----------------PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN--EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERV-------------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDC-VHGLYYSNGFWNDIACNSKNSFICSKY------------------------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC--LYSSETLSGKWLGTSCVSKNSVIC---------YKPSK-----TIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY------WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKT-QNCLQGNPD-GKWRDVSCDDKNPFFFE 3912
            +  + + +A + C  +  +L+ I   EI++  +     N +    W   N +N    + +S G    Y N+  G P+++   +CV      NG W +  CN     +C K                P           G      Y V      ++EAL  C+     L +  N E    I +     + +  W+  ND K    +   DG  + Y  W +GEP++  N  EDC+  +   +G W+D  C  K  +I           +++I  +                     +F EA  TCI  G  LV +++      +  L       Q+W    D    G +  +N   + ++ +    P       C V       G W+ I C  K  F+C ++                        SP I    +H S +    K T+ E+   C++ G  L+ + + +   I   LS  Y    +WI    S  +  + + DG  L+++NW      + +    C  L+ S  LS  W    C S    IC          +P+K     T D     K  +Y+I    V   +A +FCK+    L+V+++     +LW       I  Y      W++G+               + +  W + + N     +NC+    + G W D++C   NP+  E
Sbjct:  215 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNC----YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDP-KSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGR--RRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFS-RGEEEKRTWFESRSFCKAIGGDLVSINSKEEETI---LSQLYYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLS--WNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE 887          
BLAST of Mannose-binding protein C vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 184.882 bits (468), Expect = 1.905e-46
Identity = 236/1143 (20.65%), Postives = 440/1143 (38.50%), Query Frame = 1
Query:  142 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYY------------KAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDC-VHGLYYKNALWNDIKCEDLNAVIC------------------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVICSK------------------DILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPN-GEWNDISCKTKNYLIYEYEST---AEKEITIEIMEG-----------------------KVNYIKALELCKSKGYDLIRIENEEINK-IVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ------NNEDCV---HGLFYTNGLWNDISCNSINSVLCYK----PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE--------------------IFKERVTFE----EAQNTCIKKGWSLVRIDNEETNQNIYDL--AVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            Y I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV      +  W+D  C      IC ++       ++ +++K      +R  YY            +A   C   G  LV ++D    + + +        ++W    D    G ++ ++  ++ F+ W +  P   +   C V     K  LW+ I CE+    +C                        +K     G      S  E    EEK  +  ++  CK  G +L+ I+S E  +++           +WI       E  F + D   +SY+ W  GEPNN++  +    L+    L WND  C+     IC                    ++ +      +  +Y++   +V  ++A  FC ++   +V I++    K ++ +    +I  +           +W+D  G+ + Y+ WA  EPN  NN E+C+    Y N G WNDI+C   N  I E +++   A    T    +G                         ++  A   C     +L  +ENE +   + Y++   N     WI  ND N E +F+++D + + Y N+A G P         ++ DCV    G     G W +  C+     +C      P            K     + +   +++++EA R C+     LV+I +   +  +     K++   +W+  N  K   ++   D  KL+Y  W   EP       C+  +   +G+W   SC+     I    + I  T   +                     +  +V++     +A   C++ G SL   D+   +  ++     +++++  +WI    + VE K++  +N  + +  +  GEP+++ +E CV  +Y S+G WN++ C+S   +IC
Sbjct:  227 YQINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE----EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQ---IFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLY------FFLFFRWMD--GSVMNYVAWASYEPNFANNDENCVV--MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNI--DVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMY-QNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1339          

HSP 2 Score: 178.333 bits (451), Expect = 2.063e-44
Identity = 214/916 (23.36%), Postives = 358/916 (39.08%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL-WNDISCADSNAVICYKESKIEVLKKIT--------------VLNK--ELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKN-ALWNDIKCEDLNAVICYKNIGS--RGFTKFEISNK-----EIVIF------------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY------ENEDCV---HGLYYKNGLWNDIKCDYKNSVICSKD-ILNSNETIKQQQKYY--------VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWI--NGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATK--NKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            K E CV      +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C   L+ S  L WND  C  S   IC  +    +  + T              + NK  +  I  E +   KA++ CK     LV I+D+     ++ Y +   I  Y+           F   D + + +  WA+ EPN   N E+CV  + YKN   WNDI C   N  IC +   S    F     S +     + + F             E   +  A+  C      L  ++++ + + +       NI   WI  ND   E+ F+++D + + Y  W  G P         ++ DCV    G     G W + +C      IC  D  L ++ TI    +++        +    ++++EA   C   +  +V I++  TN  +  ++   +   FWI  N N    + KW D+   KL Y  WA  EP       C+  +   +G+W   SC T+NY     +S A          GK                          N+ +A   C   G  L   ++   +  V+    +  ++V  +WI     NVE ++++ D   + + N+  GEP++ N+E CV  ++ ++G WN++ C+S    +C
Sbjct:  455 KQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGE-LHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNW--KLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSC-TENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1339          

HSP 3 Score: 176.407 bits (446), Expect = 8.023e-44
Identity = 241/1125 (21.42%), Postives = 437/1125 (38.84%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK-NIGSRGFTKFEISNKEI--------------VIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNS--------NETIKQQQK------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLE-GNFYPNGEWNDISCKTKNYLI-----------------YEYESTAEKEITIEIM----------EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCY----KPFXXXXXXXXXXGKIDTS---------KYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCS--------TKNSFIYYYIENIISTKELEIFKERVTF------------------EEAQNTCIKKGWSLVRIDNEETNQ----NIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY------GNEDCV---HGLYYSNGFWNDIACNSKNSFICS-----KYSPPI-----IFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKY----------------YIHRIGVT---FQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLS--IEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG-NPDGKWRDVSC 3885
            LT+++A+  C  Q  +L+ I +    + +   +        W   N +     ++ S  +  ++  W  G P++    +CV     KN  W + +C      IC K +I S  F     S+  I               + +E  ++K A   C+    +L    + E  S I            WI  ND ++   F +SD   +SY  W  GEP++ +N  EDCV     K+G W+D  C+ K   IC +  L          ++  K+  K      Y + +   ++ EA   C  H   +V + +      +          +FW    D    G +  + G ++++ +W    P        +  GN    G W+ I+C+ K   +                  E +   + + + EI           E K  + ++   CK+ G DL+ I ++E   I+  +   N++  +WI     + E  F + DG  +SY N+A+GEPNN    +    L  +  L WND  C S    +C      P + +  +        TS         +YF+ T  V  ++A  FC+ +   LV I +      +      ++I  Y+           W  +DG+ + Y+ W   EPN   N++  +  Y   G WND +C          KNS I        ++ +     + +TF                  + A+  C++   +L  ++NE        N+ DL +       WI  NDK  E +F+ ++   + Y+ + +G P          + DCV    G     G W +  C+    +IC        SP I      F   + ++KI  +K+++ EA  KC+SE   L+ + +   +  +   + +Y+   +WI    +K   ++ ++D  +L +  W  A  P  K+   C+Y    + G+W  +SC      IC +      T    K  K                 Y+ ++  T   +Q +L+ C      L   D+   + ++W   ++L   ++ +W+ G  ++ E  W+  D   + F NW  G+ +    ++C++  +  G W ++ C
Sbjct:  235 LTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGN--KGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYY-NQI--FWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRW--MDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNI-----DVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKW-AAEEP--KKTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGTWNNLYC 1331          

HSP 4 Score: 150.214 bits (378), Expect = 9.747e-36
Identity = 269/1216 (22.12%), Postives = 444/1216 (36.51%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE------------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIV-----------------IFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV-HGLYYKNGLWNDIKCDYKNSVICSK---------------------DILNSNETIKQQQKYYVH--EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN--GNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYEYE------------STAEKEITIE-----------IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFYTN-GLWNDISCNSINSVLCYK---------------PFXXXXXXXXXXGKIDTSKYFVHTGRVT-YEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY------GNEDCL---LGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL-----------EIFK---ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC------SKYSPP---------------IIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLS-LRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC--LYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKY-------------YIHRIGVTFQEALDF-CKERRCKLIVVDNIDTNIYL 3690
            Q   T+  A   C  +  +L+ I +    + +  L+        W   N +     +  S G    Y  + PG P++ +   +CV      N  W +  C      IC K S   +     V+  E                    + KE   + +A   C+ +   L    + +  S + +        + WI  ND +    FE SD   + ++ W  GEP++  N  EDCV     K+  W+D  CE     IC      R    FE    +I+                 I +    F  A   C  +G  L+ ++     + +           +W    D      + +++ +++ +  W    P       CV      K GLW+ I C+ K   +C +                     D   S E I    K++    E   T+ E+ +FC      +V I++ E   I+ +   N     FWI    +D     +WVD  G+ L Y NWA  EPNN+   E C E +      WND  C++    I E +            S  E E+T +           I    V   KA E CK    DL+ I ++   K ++      ++  Y+           F + DG  ++Y  +A  EPN  NN E+CV  + Y N G WNDI+C   N  +C +               P      +    GK     +    G  T ++ A   C   +  L T+EN EL    L    K      W+  ND  +E  ++  D   + Y NW +G P          + DC+    G+    G W +  CS    +I    + + ++  +           E FK    +++++EA   C  +   LV I +E TN  +     K +   +WI  N      ++  ++N  L+Y+K+   EP       CV+     +G W   +C      IC      +   PP               I F       ++   K  Y+ +++ C   G SL   ++S + +F+ H +  L  ++ ++WI G     + KW + D   + F NW     PSD  + +C  +YSS    G W    C S    IC    K   + K+ ++ +Y             ++  +G     A+ + CK ++ K    ++ D N+Y 
Sbjct:  232 QAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSS-EPGINCVTLNTGKNGKWENKECNQKLGYICKKGS---ITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYIC-----KRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPE-IGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI---FWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVEN-ELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGE-PSDHNDEHCVEMYSSH---GTWNNLYCSSYRGYIC----KIQKSKKDPREPRYNAPSQGKIGGIIIFVLLVGAGSTYAVYYVCKRQKNKPPEDNSFDNNLYF 1402          

HSP 5 Score: 147.902 bits (372), Expect = 4.824e-35
Identity = 215/982 (21.89%), Postives = 386/982 (39.31%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK-----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYP-NGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN---GLWNDISCNSINSVLCYK------------PFXXXXXXXXXXGKIDTSKYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSC-------------------STKNSFIYYYI--ENIISTKELEIF--KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPI--IFIDEHMS----------------YKIFIN----KVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK-----ENNNCL---YSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQ---------EALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW--LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDD 3891
            +  + +  A+  C     ELL I   EI+   +   + + + T  W   N +     + +S      Y  W PG P++    +CV     KNG W + +C+ K   IC K  + S+  +   +                  Y V +    ++EA++ C +    +    NVE    I    +  +  + WI  ND  +   +  S G  + Y  W + EP++ +N  EDC+   F P +G W+D  C+ K   I + +    +   ++I++                      ++ +A + C   G  L+ +E+      +  +       Q+W    D +  G + +++G+ + + ++    P  +    CV  +  T    GLW+ I+C      +C +               E K     +   +    + H  R      T+ E+  FC+     LV+I NS+ +  IL+    ++I    L  +D ++  EWV  DG+ L Y NW  GEPNN+ G E C   +      WND  C                    TK+S   Y +  +  I+ K+ + F   E V  ++A+  C K    LV I+++   + ++   +  +I  Y+       +  +++D +   + Y  +   EPN   N++    +Y + GFWNDI C   N +IC + +  I   F     S                YKIF N       +  A   C     +L  VEN  +   + T +L+   ++ WI   D   + ++ ++D + + + NW        +     ++ +C+     S   +G W    C      IC +  KT+     +  +  +      TF+         EA   CK    +L+ + +  TN +L   + K   E +W  LN N   N+  W  +D  KL +  W   +   +KT  C+  + DG+W+  SC +
Sbjct:  232 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVA--FDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRG--CV--VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSI-NSKEEETILSQLYYNQIFWIGLQTSDPEEGFEWV--DGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDGS--VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFL-TYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYIC-QTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKW--TDNWKLRYTKWAAEEP--KKTTACVYMDIDGQWKTSSCTE 1187          

HSP 6 Score: 95.5153 bits (236), Expect = 4.332e-19
Identity = 147/705 (20.85%), Postives = 253/705 (35.89%), Query Frame = 1
Query: 2068 EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVG-QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK----------------PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN--EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERV-------------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDC-VHGLYYSNGFWNDIACNSKNSFICSKY------------------------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC--LYSSETLSGKWLGTSCVSKNSVIC-------YKPSKTIDTGKEVKKT----------KYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY------WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKT-QNCLQGNPD-GKWRDVSCDDKNPFFFE 3912
            +  + + +A + C  +  +L+ I   EI++  +     N +    W   N +N    + +S G    Y N+  G P+++   +CV      NG W +  CN     +C K                P           G      Y V      ++EAL  C+     L +  N E    I +     + +  W+  ND K    +   DG  + Y  W +GEP++  N  EDC+  +   +G W+D  C  K  +I           +++I  +                     +F EA  TCI  G  LV +++      +  L       Q+W    D    G +  +N   + ++ +    P       C V       G W+ I C  K  F+C ++                        SP I    +H S +    K T+ E+   C++ G  L+ + + +   I   LS  Y    +WI    S  +  + + DG  L+++NW      + +    C  L+ S  LS  W    C S    IC        +P  T  +  E + T          +Y+I    V   +A +FCK+    L+V+++     +LW       I  Y      W++G+               + +  W + + N     +NC+    + G W D++C   NP+  E
Sbjct:  232 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNC----YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDP-KSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGR--RRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFS-RGEEEKRTWFESRSFCKAIGGDLVSINSKEEETI---LSQLYYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLS--WNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE 907          
BLAST of Mannose-binding protein C vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 176.792 bits (447), Expect = 5.276e-44
Identity = 235/1093 (21.50%), Postives = 426/1093 (38.98%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK-NIGSRGFTKFEISNKEI--------------VIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNS--------NETIKQQQK------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLE-GNFYPNGEWNDISCKTKNYLI-----------------YEYESTAEKEITIEIM----------EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCS--------TKNSFIYYYIENIISTKELEIFKERVTF------------------EEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY------GNEDCV---HGLYYSNGFWNDIACNSKNSFICS-----KYSPPI-----IFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKY----------------YIHRIGVT---FQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLS--IEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNC 3843
            LT+++A+  C  Q  +L+ I +    + +   +        W   N +     ++ S  +  ++  W  G P++    +CV     KN  W + +C      IC K +I S  F     S+  I               + +E  ++K A   C+    +L    + E  S I            WI  ND ++   F +SD   +SY  W  GEP++ +N  EDCV     K+G W+D  C+ K   IC +  L          ++  K+  K      Y + +   ++ EA   C  H   +V + +      +          +FW    D    G +  + G ++++ +W    P        +  GN    G W+ I+C+ K   +                  E +   + + + EI           E K  + ++   CK+ G DL+ I ++E   I+  +   N++  +WI     + E  F + DG  +SY N+A+GEPNN    +    L  +  L WND  C S    +C    + +          D ++YF+ T  V  ++A  FC+ +   LV I +      +      ++I  Y+           W  +DG+ + Y+ W   EPN   N++  +  Y   G WND +C          KNS I        ++ +     + +TF                  + A+  C++   +L  ++NE   Q      +K+     WI  NDK  E +F+ ++   + Y+ + +G P          + DCV    G     G W +  C+    +IC        SP I      F   + ++KI  +K+++ EA  KC+SE   L+ + +   +  +   + +Y+   +WI    +K   ++ ++D  +L +  W  A  P  K+   C+Y    + G+W  +SC      IC +      T    K  K                 Y+ ++  T   +Q +L+ C      L   D+   + ++W   ++L   ++ +W+ G  ++ E  W+  D   + F NW  G+ +    ++C
Sbjct:  218 LTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGN--KGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYY-NQI--FWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKD-NQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRW--MDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELV-QAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKW-AAEEP--KKTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC 1285          

HSP 2 Score: 173.711 bits (439), Expect = 5.351e-43
Identity = 224/1112 (20.14%), Postives = 425/1112 (38.22%), Query Frame = 1
Query:  130 LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYY------------KAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDC-VHGLYYKNALWNDIKCEDLNAVIC------------------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVICSK----DILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYEST---AEKEITIEIMEG-----------------------KVNYIKALELCKSKGYDLIRIENEEINK-IVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ------NNEDCV---HGLFYTNGLWNDISCNSINSVLCYK----PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE--------------------IFKERVTFE----EAQNTCIKKGWSLVRIDNEETNQNIYDL--AVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLY 3093
            L + + I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV      +  W+D  C      IC ++       ++ +++K      +R  YY            +A   C   G  LV ++D    + + +        ++W    D    G ++ ++  ++ F+ W +  P   +   C V     K  LW+ I CE+    +C                        +K     G      S  E    EEK  +  ++  CK  G +L+ I+S E  +++           +WI       E  F + D   +SY+ W  GEPNN++  +    L+    L WND  C+     IC      ++ +      +  +Y++   +V  ++A  FC ++   +V I++    K ++ +    +I  +           +W+D  G+ + Y+ WA  EPN  NN++     +   G WNDI+C   N  I E +++   A    T    +G                         ++  A   C     +L  +ENE +   + Y++   N     WI  ND N E +F+++D + + Y N+A G P         ++ DCV    G     G W +  C+     +C      P            K     + +   +++++EA R C+     LV+I +   +  +     K++   +W+  N  K   ++   D  KL+Y  W   EP       C+  +   +G+W   SC+     I    + I  T   +                     +  +V++     +A   C++ G SL   D+   +  ++     +++++  +WI    + VE K++  +N  + +  +  GEP+++ +E C H  Y
Sbjct:  206 LTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE----EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQ---IFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLY------FFLFFRWMD--GSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNI--DVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMY-QNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC-HTFY 1289          

HSP 3 Score: 172.555 bits (436), Expect = 1.257e-42
Identity = 207/878 (23.58%), Postives = 343/878 (39.07%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL-WNDISCADSNAVICYKESKIEVLKKITVLNK--ELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKN-ALWNDIKCEDLNAVICYKNIGS--RGFTKFEISNK-----EIVIF------------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY------ENEDCV---HGLYYKNGLWNDIKCDYKNSVICSKD-ILNSNETIKQQQKYY--------VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWI--NGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATK--NKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDC 2316
            K E CV      +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C   L+ S  L WND  C  S   IC  + + E+     + NK  +  I  E +   KA++ CK     LV I+D+     ++ Y +   I  Y+           F   D + + +  WA+ EPN   N E+CV  + YKN   WNDI C   N  IC +   S    F     S +     + + F             E   +  A+  C      L  ++++ + + +       NI   WI  ND   E+ F+++D + + Y  W  G P         ++ DCV    G     G W + +C      IC  D  L ++ TI    +++        +    ++++EA   C   +  +V I++  TN  +  ++   +   FWI  N N    + KW D+   KL Y  WA  EP       C+  +   +G+W   SC T+NY     +S A          GK                          N+ +A   C   G  L   ++   +  V+    +  ++V  +WI     NVE ++++ D   + + N+  GEP++ N+E C
Sbjct:  438 KQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGE-LHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNW--KLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSC-TENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC 1285          

HSP 4 Score: 151.754 bits (382), Expect = 3.194e-36
Identity = 212/968 (21.90%), Postives = 383/968 (39.57%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK-----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYP-NGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN---GLWNDISCNSINSVLCYK------------PFXXXXXXXXXXGKIDTSKYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFI-------YYYIENIISTKELEIF--KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPI--IFIDEHMS----------------YKIFIN----KVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK-----ENNNCL---YSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQ---------EALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW--LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDD 3891
            +  + +  A+  C     ELL I   EI+   +   + + + T  W   N +     + +S      Y  W PG P++    +CV     KNG W + +C+ K   IC K  + S+  +   +                  Y V +    ++EA++ C +    +    NVE    I    +  +  + WI  ND  +   +  S G  + Y  W + EP++ +N  EDC+   F P +G W+D  C+ K   I + +    +   ++I++                      ++ +A + C   G  L+ +E+      +  +       Q+W    D +  G + +++G+ + + ++    P  +    CV  +  T    GLW+ I+C      +C +               E K     +   +    + H  R      T+ E+  FC+     LV+I NS+ +  IL+    ++I    L  +D ++  EWV  DG+ L Y NW  GEPNN+ G E C   +      WND  C +   +I           +  I+ K+ + F   E V  ++A+  C K    LV I+++   + ++   +  +I  Y+       +  +++D +   + Y  +   EPN   N++    +Y + GFWNDI C   N +IC + +  I   F     S                YKIF N       +  A   C     +L  VEN  +   + T +L+   ++ WI   D   + ++ ++D + + + NW        +     ++ +C+     S   +G W    C      IC +  KT+     +  +  +      TF+         EA   CK    +L+ + +  TN +L   + K   E +W  LN N   N+  W  +D  KL +  W   +   +KT  C+  + DG+W+  SC +
Sbjct:  215 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVA--FDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRG--CV--VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSI-NSKEEETILSQLYYNQIFWIGLQTSDPEEGFEWV--DGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDGS--VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFL-TYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYIC-QTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKW--TDNWKLRYTKWAAEEP--KKTTACVYMDIDGQWKTSSCTE 1156          

HSP 5 Score: 147.902 bits (372), Expect = 3.937e-35
Identity = 249/1109 (22.45%), Postives = 408/1109 (36.79%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE------------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIV-----------------IFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV-HGLYYKNGLWNDIKCDYKNSVICSK---------------------DILNSNETIKQQQKYYVH--EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN--GNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLI----YEYESTAEKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFYTN-GLWNDISCNSINSVLCYK---------------PFXXXXXXXXXXGKIDTSKYFVHTGRVT-YEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY------GNEDCL---LGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL-----------EIFK---ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC------SKYSPP---------------IIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTL-SLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC 3459
            Q   T+  A   C  +  +L+ I +    + +  L+        W   N +     +  S G    Y  + PG P++ +   +CV      N  W +  C      IC K S   +     V+  E                    + KE   + +A   C+ +   L    + +  S + +        + WI  ND +    FE SD   + ++ W  GEP++  N  EDCV     K+  W+D  CE     IC      R    FE    +I+                 I +    F  A   C  +G  L+ ++     + +           +W    D      + +++ +++ +  W    P       CV      K GLW+ I C+ K   +C +                     D   S E I    K++    E   T+ E+ +FC      +V I++ E   I+ +   N     FWI    +D     +WVD  G+ L Y NWA  EPNN+   E C E +      WND  C++    I     EYE T++  I  +     I    V   KA E CK    DL+ I ++   K ++      ++  Y+           F + DG  ++Y  +A  EPN  NN E+CV  + Y N G WNDI+C   N  +C +               P      +    GK     +    G  T ++ A   C   +  L T+EN EL    L    K      W+  ND  +E  ++  D   + Y NW +G P          + DC+    G+    G W +  CS    +I    + + ++  +           E FK    +++++EA   C  +   LV I +E TN  +     K +   +WI  N      ++  ++N  L+Y+K+   EP       CV+     +G W   +C      IC      +   PP               I F       ++   K  Y+ +++ C   G SL   ++S + +F+ H +  L  ++ ++WI G     + KW + D   + F NW     PSD  + +C
Sbjct:  215 QAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSS-EPGINCVTLNTGKNGKWENKECNQKLGYICKKGS---ITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYIC-----KRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPE-IGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI---FWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVEN-ELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGE-PSDHNDEHC 1285          

HSP 6 Score: 97.8265 bits (242), Expect = 9.250e-20
Identity = 146/691 (21.13%), Postives = 250/691 (36.18%), Query Frame = 1
Query: 2068 EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVG-QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK----------------PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN--EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERV-------------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDC-VHGLYYSNGFWNDIACNSKNSFICSKY------------------------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC--LYSSETLSGKWLGTSCVSKNSVICYKPSK---TIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY------WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKT-QNCLQGNPD-GKWRDVSCDDKNPFFFE 3912
            +  + + +A + C  +  +L+ I   EI++  +     N +    W   N +N    + +S G    Y N+  G P+++   +CV      NG W +  CN     +C K                P           G      Y V      ++EAL  C+     L +  N E    I +     + +  W+  ND K    +   DG  + Y  W +GEP++  N  EDC+  +   +G W+D  C  K  +I           +++I  +                     +F EA  TCI  G  LV +++      +  L       Q+W    D    G +  +N   + ++ +    P       C V       G W+ I C  K  F+C ++                        SP I    +H S +    K T+ E+   C++ G  L+ + + +   I   LS  Y    +WI    S  +  + + DG  L+++NW      + +    C  L+ S  LS  W    C S    IC    +   T D     K  +Y+I    V   +A +FCK+    L+V+++     +LW       I  Y      W++G+               + +  W + + N     +NC+    + G W D++C   NP+  E
Sbjct:  215 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNC----YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDP-KSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGR--RRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFS-RGEEEKRTWFESRSFCKAIGGDLVSINSKEEETI---LSQLYYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLS--WNDRHCESSADWICELKKEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE 876          
BLAST of Mannose-binding protein C vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 175.252 bits (443), Expect = 1.566e-43
Identity = 237/1103 (21.49%), Postives = 429/1103 (38.89%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK-NIGSRGFTKFEISNKEI--------------VIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNS--------NETIKQQQK------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLE-GNFYPNGEWNDISCKTKNYLI-----------------YEYESTAEKEITIEIM----------EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCY----KPFXXXXXXXXXXGKIDT------SKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCS--------TKNSFIYYYIENIISTKELEIFKERVTF------------------EEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY------GNEDCV---HGLYYSNGFWNDIACNSKNSFICS-----KYSPPI-----IFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKY----------------YIHRIGVT---FQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLS--IEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNC 3843
            LT+++A+  C  Q  +L+ I +    + +   +        W   N +     ++ S  +  ++  W  G P++    +CV     KN  W + +C      IC K +I S  F     S+  I               + +E  ++K A   C+    +L    + E  S I            WI  ND ++   F +SD   +SY  W  GEP++ +N  EDCV     K+G W+D  C+ K   IC +  L          ++  K+  K      Y + +   ++ EA   C  H   +V + +      +          +FW    D    G +  + G ++++ +W    P        +  GN    G W+ I+C+ K   +                  E +   + + + EI           E K  + ++   CK+ G DL+ I ++E   I+  +   N++  +WI     + E  F + DG  +SY N+A+GEPNN    +    L  +  L WND  C S    +C      P + +  +   E   D       ++YF+ T  V  ++A  FC+ +   LV I +      +      ++I  Y+           W  +DG+ + Y+ W   EPN   N++  +  Y   G WND +C          KNS I        ++ +     + +TF                  + A+  C++   +L  ++NE   Q      +K+     WI  NDK  E +F+ ++   + Y+ + +G P          + DCV    G     G W +  C+    +IC        SP I      F   + ++KI  +K+++ EA  KC+SE   L+ + +   +  +   + +Y+   +WI    +K   ++ ++D  +L +  W  A  P  K+   C+Y    + G+W  +SC      IC +      T    K  K                 Y+ ++  T   +Q +L+ C      L   D+   + ++W   ++L   ++ +W+ G  ++ E  W+  D   + F NW  G+ +    ++C
Sbjct:  218 LTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGN--KGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYY-NQI--FWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRW--MDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELV-QAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKW-AAEEP--KKTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC 1296          

HSP 2 Score: 171.014 bits (432), Expect = 3.115e-42
Identity = 225/1123 (20.04%), Postives = 426/1123 (37.93%), Query Frame = 1
Query:  130 LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYY------------KAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDC-VHGLYYKNALWNDIKCEDLNAVIC------------------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVIC---------------SKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYEST---AEKEITIEIMEG-----------------------KVNYIKALELCKSKGYDLIRIENEEINK-IVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ------NNEDCV---HGLFYTNGLWNDISCNSINSVLCYK----PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE--------------------IFKERVTFE----EAQNTCIKKGWSLVRIDNEETNQNIYDL--AVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLY 3093
            L + + I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ V+   +   I               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV      +  W+D  C      IC ++       ++ +++K      +R  YY            +A   C   G  LV ++D    + + +        ++W    D    G ++ ++  ++ F+ W +  P   +   C V     K  LW+ I CE+    +C                        +K     G      S  E    EEK  +  ++  CK  G +L+ I+S E  +++           +WI       E  F + D   +SY+ W  GEPNN++  +    L+    L WND  C+     IC               S ++ +      +  +Y++   +V  ++A  FC ++   +V I++    K ++ +    +I  +           +W+D  G+ + Y+ WA  EPN  NN++     +   G WNDI+C   N  I E +++   A    T    +G                         ++  A   C     +L  +ENE +   + Y++   N     WI  ND N E +F+++D + + Y N+A G P         ++ DCV    G     G W +  C+     +C      P            K     + +   +++++EA R C+     LV+I +   +  +     K++   +W+  N  K   ++   D  KL+Y  W   EP       C+  +   +G+W   SC+     I    + I  T   +                     +  +V++     +A   C++ G SL   D+   +  ++     +++++  +WI    + VE K++  +N  + +  +  GEP+++ +E C H  Y
Sbjct:  206 LTTLFFINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE----EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQ---IFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLY------FFLFFRWMD--GSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNI--DVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMY-QNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC-HTFY 1300          

HSP 3 Score: 166.777 bits (421), Expect = 6.452e-41
Identity = 207/889 (23.28%), Postives = 342/889 (38.47%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDC-VHGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL-WNDISCADSNAVICYKESKIEVLKKITVLNKELV-------------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKN-ALWNDIKCEDLNAVICYKNIGS--RGFTKFEISNK-----EIVIF------------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY------ENEDCV---HGLYYKNGLWNDIKCDYKNSVICSKD-ILNSNETIKQQQKYY--------VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWI--NGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATK--NKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDC 2316
            K E CV      +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   C V     K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L   Y    +WI       E  F   DG  + Y  +A GEPNN+Q  E C   L+ S  L WND  C  S   IC  +    +  + T  + EL              I  E +   KA++ CK     LV I+D+     ++ Y +   I  Y+           F   D + + +  WA+ EPN   N E+CV  + YKN   WNDI C   N  IC +   S    F     S +     + + F             E   +  A+  C      L  ++++ + + +       NI   WI  ND   E+ F+++D + + Y  W  G P         ++ DCV    G     G W + +C      IC  D  L ++ TI    +++        +    ++++EA   C   +  +V I++  TN  +  ++   +   FWI  N N    + KW D+   KL Y  WA  EP       C+  +   +G+W   SC T+NY     +S A          GK                          N+ +A   C   G  L   ++   +  V+    +  ++V  +WI     NVE ++++ D   + + N+  GEP++ N+E C
Sbjct:  438 KQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRG---EEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL---YYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGE-LHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNW--KLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSC-TENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC 1296          

HSP 4 Score: 149.058 bits (375), Expect = 2.167e-35
Identity = 214/979 (21.86%), Postives = 382/979 (39.02%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK-----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYP-NGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN---GLWNDISCNSINSVLCYK------------PFXXXXXXXXXXGKIDTSKYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFI-------YYYIENIISTKELE-------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPI--IFIDEHMS----------------YKIFIN----KVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK-----ENNNCL---YSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQ---------EALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW--LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDD 3891
            +  + +  A+  C     ELL I   EI+   +   + + + T  W   N +     + +S      Y  W PG P++    +CV     KNG W + +C+ K   IC K  + S+  +   +                  Y V +    ++EA++ C +    +    NVE    I    +  +  + WI  ND  +   +  S G  + Y  W + EP++ +N  EDC+   F P +G W+D  C+ K   I + +    +   ++I++                      ++ +A + C   G  L+ +E+      +  +       Q+W    D +  G + +++G+ + + ++    P  +    CV  +  T    GLW+ I+C      +C +               E K     +   +    + H  R      T+ E+  FC+     LV+I NS+ +  IL+    ++I    L  +D ++  EWV  DG+ L Y NW  GEPNN+ G E C   +      WND  C +   +I           E   S+ EL              I  E V  ++A+  C K    LV I+++   + ++   +  +I  Y+       +  +++D +   + Y  +   EPN   N++    +Y + GFWNDI C   N +IC + +  I   F     S                YKIF N       +  A   C     +L  VEN  +   + T +L+   ++ WI   D   + ++ ++D + + + NW        +     ++ +C+     S   +G W    C      IC +  KT+     +  +  +      TF+         EA   CK    +L+ + +  TN +L   + K   E +W  LN N   N+  W  +D  KL +  W   +   +KT  C+  + DG+W+  SC +
Sbjct:  215 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVA--FDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRG--CV--VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSI-NSKEEETILSQLYYNQIFWIGLQTSDPEEGFEWV--DGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDGS--VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFL-TYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYIC-QTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKW--TDNWKLRYTKWAAEEP--KKTTACVYMDIDGQWKTSSCTE 1167          

HSP 5 Score: 144.05 bits (362), Expect = 7.099e-34
Identity = 249/1120 (22.23%), Postives = 408/1120 (36.43%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE------------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIV-----------------IFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV-HGLYYKNGLWNDIKCDYKNSVICSK---------------------DILNSNETIKQQQKYYVH--EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN--GNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYE---------------YESTAEKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFYTN-GLWNDISCNSINSVLCYK---------------PFXXXXXXXXXXGKIDTSKYFVHTGRVT-YEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY------GNEDCL---LGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL-----------EIFK---ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC------SKYSPP---------------IIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLS-LRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC 3459
            Q   T+  A   C  +  +L+ I +    + +  L+        W   N +     +  S G    Y  + PG P++ +   +CV      N  W +  C      IC K S   +     V+  E                    + KE   + +A   C+ +   L    + +  S + +        + WI  ND +    FE SD   + ++ W  GEP++  N  EDCV     K+  W+D  CE     IC      R    FE    +I+                 I +    F  A   C  +G  L+ ++     + +           +W    D      + +++ +++ +  W    P       CV      K GLW+ I C+ K   +C +                     D   S E I    K++    E   T+ E+ +FC      +V I++ E   I+ +   N     FWI    +D     +WVD  G+ L Y NWA  EPNN+   E C E +      WND  C++    I E               YE T++  I  +     I    V   KA E CK    DL+ I ++   K ++      ++  Y+           F + DG  ++Y  +A  EPN  NN E+CV  + Y N G WNDI+C   N  +C +               P      +    GK     +    G  T ++ A   C   +  L T+EN EL    L    K      W+  ND  +E  ++  D   + Y NW +G P          + DC+    G+    G W +  CS    +I    + + ++  +           E FK    +++++EA   C  +   LV I +E TN  +     K +   +WI  N      ++  ++N  L+Y+K+   EP       CV+     +G W   +C      IC      +   PP               I F       ++   K  Y+ +++ C   G SL   ++S + +F+ H +  L  ++ ++WI G     + KW + D   + F NW     PSD  + +C
Sbjct:  215 QAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSS-EPGINCVTLNTGKNGKWENKECNQKLGYICKKGS---ITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYIC-----KRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPE-IGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI---FWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLF--------FRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVEN-ELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGE-PSDHNDEHC 1296          

HSP 6 Score: 96.6709 bits (239), Expect = 1.907e-19
Identity = 148/702 (21.08%), Postives = 253/702 (36.04%), Query Frame = 1
Query: 2068 EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVG-QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK----------------PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN--EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERV-------------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDC-VHGLYYSNGFWNDIACNSKNSFICSKY------------------------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC--LYSSETLSGKWLGTSCVSKNSVIC---------YKPSK-----TIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY------WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKT-QNCLQGNPD-GKWRDVSCDDKNPFFFE 3912
            +  + + +A + C  +  +L+ I   EI++  +     N +    W   N +N    + +S G    Y N+  G P+++   +CV      NG W +  CN     +C K                P           G      Y V      ++EAL  C+     L +  N E    I +     + +  W+  ND K    +   DG  + Y  W +GEP++  N  EDC+  +   +G W+D  C  K  +I           +++I  +                     +F EA  TCI  G  LV +++      +  L       Q+W    D    G +  +N   + ++ +    P       C V       G W+ I C  K  F+C ++                        SP I    +H S +    K T+ E+   C++ G  L+ + + +   I   LS  Y    +WI    S  +  + + DG  L+++NW      + +    C  L+ S  LS  W    C S    IC          +P+K     T D     K  +Y+I    V   +A +FCK+    L+V+++     +LW       I  Y      W++G+               + +  W + + N     +NC+    + G W D++C   NP+  E
Sbjct:  215 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNC----YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDP-KSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGR--RRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFS-RGEEEKRTWFESRSFCKAIGGDLVSINSKEEETI---LSQLYYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLS--WNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE 887          
BLAST of Mannose-binding protein C vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 172.94 bits (437), Expect = 7.971e-43
Identity = 231/1135 (20.35%), Postives = 433/1135 (38.15%), Query Frame = 1
Query:  142 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKL---------LNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYY------------KAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDC-VHGLYYKNALWNDIKCEDLNAVIC------------------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVICSK------------------DILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEW-SKNMKIGRFWINGN-DIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYEST---AEKEITIEIMEG-----------------------KVNYIKALELCKSKGYDLIRIENEEINK-IVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQN--NEDCV---HGLFYTNGLWNDISCNSINSVLCYK------PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE--------------------IFKERVTFE----EAQNTCIKKGWSLVRIDNEETNQNIYDL--AVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            Y I  Q   T+ +A K C  +   L+ I +    T +  L+        W   N +     +++  G   +Y  +  G P++    +CV     K+G W +  C+     IC K +   ++ VI +               + +E   ++ A++ C+ +   L    + +  S + +     Q  + WI  ND ++   F  SDG  + Y  +  GEP++   K E CV      +  W+D  C      IC ++       ++ +++K      +R  YY            +A   C   G  LV ++D    + + +        ++W    D    G ++ ++  ++ F+ W +  P   +   C V     K  LW+ I CE+    +C                        +K     G      S  E    EEK  +  ++  CK  G +L+ I+S E  +++                                +SY+ W  GEPNN++  +    L+    L WND  C+     IC                    ++ +      +  +Y++   +V  ++A  FC ++   +V I++    K ++ +  KN K   ++I     +  E +W+D  G+ + Y+ WA  EPN  NN++     +   G WNDI+C   N  I E +++   A    T    +G                         ++  A   C     +L  +ENE +   + Y++   N     WI  ND N E +F+++D + + Y N+A G P      + DCV    G     G W +  C+     +C        P            K     + +   +++++EA R C+     LV+I +   +  +     K++   +W+  N  K   ++   D  KL+Y  W   EP       C+  +   +G+W   SC+     I    + I  T   +                     +  +V++     +A   C++ G SL   D+   +  ++     +++++  +WI    + VE K++  +N  + +  +  GEP+++ +E CV  +Y S+G WN++ C+S   +IC
Sbjct:  226 YQINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVIPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE----EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLL----------------------------LSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYILKNGKESAYFIGLTLGLDREFRWMD--GSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNI--DVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKK--TTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMY-QNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1313          

HSP 2 Score: 168.318 bits (425), Expect = 2.551e-41
Identity = 207/914 (22.65%), Postives = 355/914 (38.84%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYV------------IIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL-WNDISCADSNAVICYKESKIEVLKKIT--------------VLNK--ELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKN-ALWNDIKCEDLNAVICYKNIGS--RGFTKFEISNK-----EIVIF------------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEP--NNYENEDCV---HGLYYKNGLWNDIKCDYKNSVICSKD---ILNSNETIKQQQKYY--------VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWI--NGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATK--NKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            K E CV      +  W+D  CE     IC ++  P    ++++  K              +I     +FTEAN+ C   G  L+ +ED      + +L       +FW    D    G +++ NG+R+ +  +    P   R   CV      K G W+ I+C++    +C +                        T P+     K  +R     +EK T+  + + CK+ G  L+ I+  +  +++  L + Y+                             +A GEPNN+Q  E C   L+ S  L WND  C  S   IC  +    +  + T              + NK  +  I  E +   KA++ CK     LV I+D+     ++ Y ++N     +     + ++  F   D + + +  WA+ EPN   N E+CV  + YKN   WNDI C   N  IC +   S    F     S +     + + F             E   +  A+  C      L  ++++ + + +       NI   WI  ND   E+ F+++D + + Y  W  G P  + Y + DCV    G     G W + +C      IC  D    L ++ TI    +++        +    ++++EA   C   +  +V I++  TN  +  ++   +   FWI  N N    + KW D+   KL Y  WA  EP       C+  +   +G+W   SC T+NY     +S A          GK                          N+ +A   C   G  L   ++   +  V+    +  ++V  +WI     NVE ++++ D   + + N+  GEP++ N+E CV  ++ ++G WN++ C+S    +C
Sbjct:  448 KQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGE---EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLLLSYE----------------------------NWAYGEPNNHQGIELCGE-LHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYILKNGKESAYFIGLTLGLDREFRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNW--KLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSC-TENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMYQ-NVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYIC 1313          

HSP 3 Score: 168.318 bits (425), Expect = 2.662e-41
Identity = 236/1118 (21.11%), Postives = 435/1118 (38.91%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK-NIGSRGF--------TKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNS--------NETIKQQQK------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLE-GNFYPNGEWNDISCKTKNYLIYE-----------------YESTAEKEITIEIM----------EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCY----KPFXXXXXXXXXXGKIDTS---------KYFVHTGRVTYEEALRFCQIHSCRLVTI-ENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCS--------TKNSFIYYYIENIISTKELEIFKERVTF------------------EEAQNTCIKKGWSLVRIDNEETNQ----NIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEP--NNYGNEDCV---HGLYYSNGFWNDIACNSKNSFICS-------KYSPPI-----IFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKY----------------YIHRIGVT---FQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLS--IEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG-NPDGKWRDVSC 3885
            LT+++A+  C  Q  +L+ I +    + +   +        W   N +     ++ S  +  ++  W  G P++    +CV     KN  W + +C      IC K +I S  F        +    +     + +E  ++K A   C+    +L    + E  S I            WI  ND ++   F +SD   +SY  W  GEP++ +N  EDCV     K+G W+D  C+ K   IC +  L          ++  K+  K      Y + +   ++ EA   C  H   +V + +      +          +FW    D    G +  + G ++++ +W    P        +  GN    G W+ I+C+ K   + +                  +   + + + EI           E K  + ++   CK+ G DL+ I ++E   I+  +                             +SY N+A+GEPNN    +    L  +  L WND  C S    +C      P + +  +        TS         +YF+ T  V  ++A  FC+ +   LV I +++E   L   + +  K S Y++ G  +  + E+  +DG+ + Y+ W   EPN   N++  +  Y   G WND +C          KNS I        ++ +     + +TF                  + A+  C++   +L  ++NE        N+ DL +       WI  NDK  E +F+ ++   + Y+ + +G P  + Y + DCV    G     G W +  C+    +IC          SP I      F   + ++KI  +K+++ EA  KC+SE   L+ + +   +  +   + +Y+   +WI    +K   ++ ++D  +L +  W  A  P  K+   C+Y    + G+W  +SC      IC +      T    K  K                 Y+ ++  T   +Q +L+ C      L   D+   + ++W   ++L   ++ +W+ G  ++ E  W+  D   + F NW  G+ +    ++C++  +  G W ++ C
Sbjct:  234 LTWFQARKSCLQQESELLSITEIHEQTFLTGLS-NTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVIPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGN--KGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLL----------------------------LSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYILKNGKESAYFI-GLTLGLDREFRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNI-----DVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKWTDNWKLRYTKW-AAEEP--KKTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGTWNNLYC 1305          

HSP 4 Score: 160.614 bits (405), Expect = 5.735e-39
Identity = 209/960 (21.77%), Postives = 373/960 (38.85%), Query Frame = 1
Query:  283 RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYK-------------------ESKIEVLKKITVLNKELVIFKE-RLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNAL-WNDIKCEDLNAVICYKNIGS--------RGFTKFE------ISNK--EIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKN-GLWNDIKCDYKNSVICSKDILNSNETIKQQQKY--------------YVHEVL-------VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGK--WVDSKGNKLVYLNWAKNEP--NNYNNEDCL---EGNFYPNGEWNDISCKTKNYLIYEYES----TAEKEI------------TIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK-----PFXXXXXXXXXXGKIDTSKYFVHTG-----RVTYE--------EALRFCQIHSCRLVTIENS-ELDILILNLAR-KHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIIST 2811
            + WI  ND K    FE+ +G  + Y  + +GEP++  N  EDCV     K G W+D  C+     IC +   P     + ++++              +I     ++  A   C   G  L+ ++D    + + +L       ++W    D    G +  ++G+++++  +    P   ++    V        LW+ I+C +    +C +                    +  +   +I    K     +E + T+++++  CK+ G  LV I+ ++  +I+                                + +  WA GEPNN+Q  +    L+    L WND  CE     IC    G+            ++E      I+NK  +  I  E V    A+  CK N  +L+ I+ D     ++ + +K+   + +     +  +  F + D   ++Y  W   EPN   N E+CV  + YKN G WNDI C Y N  IC +   + N T                       +++          ++ A   C + N  +  + N      +    K++ I   WI  ND   E +  W D +G  + Y NWAK  P  + Y + DC+    G+    G W +  C      I + +      A   I            T +I+  K+++ +A   CKS+  +L+ I +E  N  +  V T      +WI  N      Q+ ++D   + Y  +A  EP  +    CV+     +G W   SC      +C +     P    +   K     D   +    G     +V+Y         E LRF       L + ++S E + +   + R + ++  +W+ G     E +W+ +D   + ++NWN GEP+++ +E C +  Y ++G WN+  CS+   +I    +N I T
Sbjct:  410 KVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLL----------------------------LSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYILKNGKESAYFIGLTLGLDREFRWMDGSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNID-VWIGMNDKNEEHRFLWTDQRG--VYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFL-RVYTSKYREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEP--KKTTACVY--MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRF----GGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC-VEMYSSHGTWNNLYCSSYRGYICKIQKNKIKT 1322          

HSP 5 Score: 132.109 bits (331), Expect = 2.717e-30
Identity = 206/973 (21.17%), Postives = 366/973 (37.62%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETI-----------KQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYP-NGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN---GLWNDISCNSINSVLCYK------------PFXXXXXXXXXXGKIDTSKYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSC-------------------STKNSFIYYYI--ENIISTKELEIF--KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPI--IFIDEHMS----------------YKIFIN----KVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK-ENNNCL---YSSETLSGKWLGTSCVSKNSVIC-------YKPSKTIDTGKEVKK---TKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW--LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDD 3891
            +  + +  A+  C     ELL I   EI+   +   + + + T  W   N +     + +S      Y  W PG P++    +CV     KNG W + +C+ K   IC K  + S+  +                Y V +    ++EA++ C +    +    NVE    I    +  +  + WI  ND  +   +  S G  + Y  W + EP++ +N  EDC+   F P +G W+D  C+ K   I + +    +   ++I++                      ++ +A + C   G  L+ +E+      +  +       Q+W    D +  G + +++G+ + + ++    P  +    CV  +  T    GLW+ I+C      +C +               E K     +   +    + H  R      T+ E+  FC+     LV+I + E + ++  L                             L Y NW  GEPNN+ G E C   +      WND  C                    TK+S   Y +  +  I+ K+ + F   E V  ++A+  C K    LV I+++   + ++   +KN     +       ++ +F   +   + Y  +   EPN   N++    +Y + GFWNDI C   N +IC + +  I   F     S                YKIF N       +  A   C     +L  VEN  +   + T +L+   ++ WI   D   + ++ ++D + + + NW        +  + +C+     S   +G W    C      IC          S TI       K     + I    +++ EA   CK    +L+ + +  TN +L   + K   E +W  LN N   N+  W  +D  KL +  W   +   +KT  C+  + DG+W+  SC +
Sbjct:  231 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVIPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVA--FDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRG--CV--VMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLL----------------------------LSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYILKNGKESAYFIGLTLGLDREFRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFL-TYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYKW--TDNWKLRYTKWAAEEP--KKTTACVYMDIDGQWKTSSCTE 1161          

HSP 6 Score: 88.5817 bits (218), Expect = 6.498e-17
Identity = 143/676 (21.15%), Postives = 246/676 (36.39%), Query Frame = 1
Query: 2068 EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVG-QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK----------PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN--EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERV-------------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDC-VHGLYYSNGFWNDIACNSKNSFICSKY------------------------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNG--NDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKT-QNCLQGNPD-GKWRDVSCDDKNPFFFE 3912
            +  + + +A + C  +  +L+ I   EI++  +     N +    W   N +N    + +S G    Y N+  G P+++   +CV      NG W +  CN     +C K          P           G      Y V      ++EAL  C+     L +  N E    I +     + +  W+  ND K    +   DG  + Y  W +GEP++  N  EDC+  +   +G W+D  C  K  +I           +++I  +                     +F EA  TCI  G  LV +++      +  L       Q+W    D    G +  +N   + ++ +    P       C V       G W+ I C  K  F+C ++                        SP I    +H S +    K T+ E+   C++ G  L+ + + +   I+  L L Y+    W  G  + + G     +       +W      S  +     +  E   G  L     +K+SV  Y+   T D     K  +Y+I    V   +A +FCK+    L+V+++     +LW    K   E  +  G     D E  W+D     + +  W + + N     +NC+    + G W D++C   NP+  E
Sbjct:  231 QAALTWFQARKSCLQQESELLSIT--EIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVIPISCPPSWLPYAGNC----YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDP-KSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGR--RRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFS-RGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLLLSYE---NWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSAD-----WICELKKGAPLQPE-PTKSSVPEYE--LTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYILKNGKESAYFIGLTLGLDREFRWMDGS--VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE 883          
BLAST of Mannose-binding protein C vs. Ensembl Mouse
Match: Mrc1 (mannose receptor, C type 1 [Source:MGI Symbol;Acc:MGI:97142])

HSP 1 Score: 209.534 bits (532), Expect = 3.704e-54
Identity = 251/1151 (21.81%), Postives = 446/1151 (38.75%), Query Frame = 1
Query:  142 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVIKLLNREL---------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVL------KKITVLNKE-----LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCV-HGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTK---------------FEISNKEIVIFE-------EKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK----HNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVIC----SKDILNSNETIKQQQ--------------KYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEW-SKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIM--------------------------EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE------DCV---HGLFYTNGLWNDISCNSINSVLCYK------PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI---------------------FKERVT--FEEAQNTCIKKGWSLVRIDNE-ETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPII 3174
            Y I  +   T+ +A   C+ +  +L+ + +      +  L     +G  WI  N + V   +++  G   +Y  +  G P++   + CV     K+  W ++ C      IC K          P  S V      +          I  +EK   + A+  C+ +G  L  I   +    +++          WI  ND++ +  F  SDG  + + K+ PGEP++   + E CV  +   +  W D +C      IC   S+   +      K      K       +I     T+  A   C ++   L  ++D    + + +         +W   +DV+ +GTF  +   +++F+ W A  P   +   CV         LW+ + CE+    +C     + G T+               +  ++K  + F+       EK  +  ++  CK  G EL  I S +   +I+         H +  +W+          F +SD   +SY+ W  GEPNNY+N +    L    G+ WNDI C++ N+ IC     K +L       Q                +YY  +   T + A  FC ++   +  I +    K ++++ +KN     ++I G  I  + K++   G+K+ ++ WA  EPN  N+++     +  +G WNDI+C   N  I +  +++     +                             E K ++  A + CK    +L+ IEN +    V     ++     W   NDIN E  F+++ GQ + Y N+  G P  + +       DCV    G     G W D +C+S    +C        P       K        S Y +   ++ + EA  +C+ H+  L +I +   +           +   W+  N      E+   D  +++Y NW   EP       C+  +   +G W    C+    F+    + I +T+  ++                     F+   T  + +A   C++ G SLV I+   E++   Y +        +WI    + VEGK++  N++ + +  +  G+P+   N DCV  L  S+G WN+I C+S   FIC    P II
Sbjct:  230 YQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSG-LWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKH--WAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHEL--FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFI-GMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVP-IWIALNSNLTNNEYTWTDRWRVRYTNWGADEPKL--KSACVYMD--VDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMF-RNVEGKWLWLNDNPVSFVNWKTGDPSGERN-DCVV-LASSSGLWNNIHCSSYKGFICKM--PKII 1360          

HSP 2 Score: 199.134 bits (505), Expect = 6.383e-51
Identity = 230/1134 (20.28%), Postives = 447/1134 (39.42%), Query Frame = 1
Query:  934 KERLTYYKAQDLCKSQGYKLVKIDD--EQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIF------------------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN--NYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK--------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYE-----------------------YESTAEKEITIEIMEG----KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ--YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCY-----------KPFXXXXXXXXXXGKI--DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL----------------------EIF----KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPN------NYGNEDCV---HGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHM------------SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK--------PSKTIDTGKEVKKTK---------YYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYL-WELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPF 3903
            K  LT+++A+  CK Q   L+ + +  EQ        ++ + +   WI  N + +   ++ +  +  ++  W  G P++   + CV     KNA W +++C      IC K  G+     F I +   V                    EEK + K+A   C+  G +L  I S E    I+           WI  NDI+ +  F +SD   +++ KW PGEP+  N   EDCV  +  K+G W D  C+     IC K +  S+  + +                 Y +   L T+ +A + C      +  + +      +           FW   +D+  +G +  +   ++ + +W  + P        ++      G W+ +SC+ K   + +                       + +T++  +  ++       K  + ++ + CK+ G +L  I++++  ++++ + T +      +W+     +    F +SDG  +SY N+A+GEPNN  N +    L    G+ WNDI+C  +N+ +C             P  +D      +G +     +Y+    + T + A  FC+ +   L TI++      +     K+     +  G  I  + +++ +DG+K+ ++ W  GEPN   +++  +  Y  +G WND +C   N+FI     + I+   +                      +IF    +E+ ++++A+  C     +LV I+N +  Q      +++     W   ND   E  F+ +    + Y+ + +G P       +Y + DCV    G     G W D  C+SK  +IC   + P + +                SY +   K+ + EA   C+    SL+       S     + +    V  WI    +  + ++T++D  ++ + NW  A  P  K  + C+Y    + G W  + C      +C K        P +      E ++T          Y+      ++ +A   C      L+ ++    + +L + +    S   +W+ G  ++ EG W+  +   ++F NW  G  + ++    +  +  G W ++ C     F
Sbjct:  235 KSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSGL---WIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKK--GNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYIC-KMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAGCVAMKTGV-AGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQ-EQAFVTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDH-TSLLASILDPYSNAFAWMKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNW-GADEP--KLKSACVYMD--VDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWI-GMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVVLASSSGLWNNIHCSSYKGF 1352          

HSP 3 Score: 190.66 bits (483), Expect = 2.126e-48
Identity = 212/910 (23.30%), Postives = 355/910 (39.01%), Query Frame = 1
Query:   40 NALWNDFSCEDPSAVICYKETEPKI----SAEIELQSKY-------VIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE--------LVIFKERLTYYK--------AQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNED--CVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEIS---------------NKEIVIF----EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN------NYENEDCV---HGLYYKNGLWNDIKCDYKNSVICSKDI-----LNSNETIKQ------QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRF----WINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIY----EYESTAEKEITIEIMEGK-------------------VNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP 2397
            +  W D +CE P   IC   ++        A+   +  +        +I    +TFT+AN  C  +   L  +ED      + +L        FW   +D++ +GTF +   +++++  +    P   R   CV        G W+ +SC++    +C                          T  KTS   KL  +      EK T+  +   CK+ G +L  I       +++ L      G Y    W+          F  SDG  + Y  +A GEPNNYQ  E+C          WNDI+C   N  IC  +    +L + T   ++         VI+K+   Y+         A+  CK     L  I  E     ++ Y  +N     +     + ++  F   D +K+ F  WA GEP N+ N+D  CV  +Y  +  WNDI C   N  IC ++  S   T    +               NK   IF    EEK  ++ A+  CK     L+ I++ +  + +  + ++ +    W   NDI  E+ F+++  + + Y  W  G P       +YE+ DCV    G   + G W D  CD K   IC         ++   T K       +  Y + ++ + + EA  +C  H   +  I +  +N   +     MK+  F    WI  N  +T  ++  +   ++ Y NW  +EP       C+  +   +G W    C    Y +     E  +T   ++  +  E +                    ++ +A   C   G  L+ IE   E + + Y V        +WI     NVEG++++ +   +S+ N+  G+P+ + N DCV  L  ++GLWN+I C+S    +C  P
Sbjct:  470 DGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGK---HEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITS--SGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEP-NFANDDENCVT-MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAW-----MKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPK--LKSACVYMDV--DGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFR-NVEGKWLWLNDNPVSFVNWKTGDPSGERN-DCVV-LASSSGLWNNIHCSSYKGFICKMP 1357          

HSP 4 Score: 150.984 bits (380), Expect = 3.491e-36
Identity = 208/1000 (20.80%), Postives = 385/1000 (38.50%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD-------ILNSNETIK-----QQQKYYVHEVLVTYEE------AINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDC--LEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEG------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCV-HGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTG------------------RVTYEEALRFCQIHSCRLVTIENSELDILILNL----ARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFANGKWNDFSCSTKNSFI---------------------YYYIENIISTKELEIF--KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNED--CVHGLYYSNGFWNDIACNSKNSFICSKYSPPI------------------IFIDEHMSYKIFI----NKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK------ENNNCLY---SSETLSGKWLGTSCVSKNSVICYK---PSKTIDTGKEVK-------KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY-WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDE 3924
            +  + +  A+  CK    +LL +   EI+  +Y   +  ++ +  WI  N +   + + ++      Y  W PG P++   + CV     KN  W +++C  K   IC K        I+ S   +      Q   Y  H   +  EE      A+  C +    +  I ++E    I+           WI  NDI  +  +  S G  + +  W   EP++ NN  EDC  ++G    +G W D +C+     I +  S +   +     +G                     +  A   C ++   L  +E+      +  +        +W   +D+  +G F ++  + + + ++    P  +    CV        GLW+ +SC      +C K + E      E       K   + G                  + T+ E+  FC+     L +I++ +   +I  L       H++  +WL          +   DG+ + Y NW  GEPNNY N E C          WND +C   N++I                         +  +  K+ + +  KE+ T + A+  C K    L  I +E   + ++    KN     +      +++ KF+  +   + +  +  GEPN + N+D  CV  +Y ++GFWNDI C   N+FIC +++  I                    + ++  +KIF      K ++++A   C+    +L+ +EN+     V T  +R    N W    D   +  + ++ GQ + + NW     P  +      E+ +C+     +   +G W+  +C SK   IC     PS  +      K       K+ Y + ++ + + EA  +CK+    L  + +  +N + W      ++  +  LN N  +NE  W  +D+ ++ + NW   +  ++    C+  + DG WR   C++   F  +  DE
Sbjct:  235 KSALTWHQARASCKQQNADLLSVT--EIHEQMYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVVMKGK---DGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAG--CVAMKTGVAGGLWDVLSCEEKAKFVC-KHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHEL--FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPN-FANDDENCVT-MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKG-YPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVPIWIALNSNLTNNEYTW--TDRWRVRYTNWGADEPKLKSA--CVYMDVDGYWRTSYCNESFYFLCKKSDE 1216          

HSP 5 Score: 102.449 bits (254), Expect = 3.196e-21
Identity = 125/616 (20.29%), Postives = 228/616 (37.01%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVIC--------YKETEPKISAEIELQSKYVIIFQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLL---------------NRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVI---------FKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNK--------------EIVIFEEKVV--FKHAQLLCKNNGYELLKIDSDEINSMI-YDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            Q  E+C      P   WND +CE  +  IC          E  P       + +   +I++        EK T   A   C+    +L  I+ +     ++    +      +     I ++  F +++G ++ +  +A GEPN   +++    M+   GFWNDI+C   N+ IC ++     +  +                  N+   I     +EK ++++A   CK     L+ I++ Q  + V    ++      W   ND+  E  F+ + G+ + Y  +  G P   +     ++  CV    G       W D +C      IC  ++   +    T   K+  +          K +L +++A+  CK     L  I D   N+  +      N+   WI  N       +  +D+ +++++ W A EP       CV+     +  W    C +    +C K+         ++  K                  FE      +  A L C   G  L+ I++   +S + Y      +   +WI       E  +++ +   +S+  W  G+P+  E  DCV  L   +GLWN+I C      IC
Sbjct:  748 QNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNV-PIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPK--LKSACVY--MDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFR-NVEGKWLWLNDNPVSFVNWKTGDPSG-ERNDCVV-LASSSGLWNNIHCSSYKGFIC 1354          
BLAST of Mannose-binding protein C vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 135.576 bits (340), Expect = 1.920e-31
Identity = 197/1007 (19.56%), Postives = 374/1007 (37.14%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIK------------------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE-----------------IMEGKVNYIKALELCKSKGYDLI----RIENEEINKIVYDVATKNKVGQY-WINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKY-------------FVHTGRV----------TYEEALRFCQIHSCRLVTIENSELDILILNLARK---------HKISGYW--LDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI-----------------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEE----TNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFICSKYS----------PPIIFIDEHMSYKIFINK------------VTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQT------ASLPSDKENNNC---LYS-SETLSGKWLGTSCVSK-NSVICYK---PSKTIDTGKEVKKTKYYIHRIGVTFQ---------EALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDK 3894
            F+  + ++ A   C+  G +LL I    +   IN ++  ++      T WI  ND+ T   + +SD+  + Y  W   +P+N   E+C       +G W +  C      +C K    + E I+                  Q   Y +     +++E+   C +    ++ I ++   + I +  K  ++   WI  ND+  +  +  S G+ + + +W   EPNN+ +  EDC+   + P G WND  C      I +      +    E                 + E +V Y  A  LC   G  L+    R E   ++ ++Y     N  G+Y W    D+N  G F +  G  + Y ++   +P  +             GLW   +C S  +    +         +  G   T                  H  +V          ++ +AL  C+    +L+++ + E +  + ++  K         H+   +W  L+  D ++   W   DG    Y N+ +   ++     C + +  A+ +W    C T+  +I      +                     E + F+   ++ +AQ  C      L  + ++       QN+  L+  ++   +WI  +    +G+F  ++   + +  +  G+P   G ++ CV+ +      W D  C++   +IC + +          PP         +  F+NK            V + EA   C+ +   L+ + N  + +FI  T SL     + WI    S+ D +W   + + L + NW        +  PS  +  +C   L+S S   +G+W   SC  + +  IC K   PS +             +  +  TF+         +AL  C+ R   L  V +  T  +L + ++ L     W+    ++    +    ++ L + +W + +   Q +  C   + DG WR  SCD K
Sbjct:  252 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-----STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQ-EVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIY-----NWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAVLD-LASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLS-SDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFI--TASLPNVTFDLWIGLHASQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQT-PLWIGLASEEGSRRYSWLSEEPLNYVSWQDEEP--QHSGGCAYVDVDGTWRTTSCDTK 1236          

HSP 2 Score: 134.035 bits (336), Expect = 6.979e-31
Identity = 226/1166 (19.38%), Postives = 422/1166 (36.19%), Query Frame = 1
Query:  136 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYSNALWNDISCADSNAVICYKESKIE---------VLKKITVLNKELVIFKE-RLTYYKAQDLCKSQGYKLVKIDD--EQ--FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA--LWNDIKCEDLNA-VICYKNIGSRGFTKFEISNKEIVI-------------------------FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK---------HNIGTYWIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHG---LYYKNGLWNDIKCDYKNSVIC---------SKDILNSN--ETIK-QQQKYYVHEVLVTYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSK--NMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKE-------------------------ITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE-------DCVHGLF----YTNGLWNDISCN-SINSVLCYK---PFXXXXXXXXXXGKIDTSKYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE---------------IFKER---------VTFEEAQNTCIKKGWSLVRIDNEETNQNIYD--LAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKF-PRGEPNNYGNEDCVHGLYYSNGFWNDIACN 3129
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++     WND  C  S   IC K  ++            K  T  +       E ++ Y  A+ LC   G +LV I +  EQ   +S++YN+  +     +W    D+   G+F     +++ ++ W   +P  Y+   CV  L   +A  LW    C    A  IC +++G+    +    +    +                          +EK  +  A  +C+  G +LL + S E    +     K         H    +WI  N  D +  +++ +SD    SY  +      +  ++D + G   L   +  W  ++C  +   IC           DI      E ++ Q+ +Y   E   ++ +A   C      +  + S  E + +     K  + +   +WI  + + ++G++  + G+ + +++WA  +P     +           +W D  C T   Y+     S+ E +                         I  +  + +V + +A   C+ +   L+ I N  + +     +  N     WI  +    + Q+I  + + + Y N+A GEP+  +          C   L     +  G W+D SC    +  +C K   P                  Y  HT R     + +++AL  C+  +  L  + +      +   AR  +    W+     +    +  +    L Y++W   EP + G   C   +   +G W   SC TK       +      + +                 F+E          +  +EA   C K G +++ I +E  N  +++     + +    W+  N     G  V  +N A+ YS + P G   +  + +  + +  S+G W   AC 
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQ-------AEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCV-ALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFA----RSRHDDDDIRGCAVLDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIAN-PLEQAFITASLPNVTFDLWIGLHASQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQTP-LWIGLASEEGSRRYSWLSEEPLNYVSWQDEEPQHSGG--CAYVD--VDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPGACT 1383          

HSP 3 Score: 112.079 bits (279), Expect = 3.551e-24
Identity = 177/875 (20.23%), Postives = 332/875 (37.94%), Query Frame = 1
Query: 1711 VTYEEAINFCNQHNCRIVKISNVE----TNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISC---------KTKNYLIYEYESTAEKEITIE--------------IMEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKI-------DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCST-KNSFIYYYIENIISTKEL--------------------------------EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKI-GQ----------YWIDANDK-AVEG-KFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDE---------------HMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVN-----YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIG------------------------VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ-------KTQNC--LQGNPD----GKWRDVSCDDKNPFFF 3909
            +++ EA   C Q    ++ I+ +      N ++  +S  +     WI  ND+ T G W  S  + L YLNW  ++P+N   E+C       +G W +  C         K  N  +   +      + +E              +   K ++ ++   C   G DL+ I +  E+  I   +  K +V + WI  ND+ ++  F +SDG  +S+ ++   EPNN  +  EDCV  ++   G WND  CN     +C K  +  +   +E+            S Y++   +V Y +A R C  H  +LVTI N      + +L    +   +W    D+   G +  + G+++ Y +WN+ +P  Y    C+ L    A G W   +C++ +  +I         T EL                                E  +E+ ++ +A   C + G  L+ + + E    +  +   NKI G+          +WI  N +   EG  +  S+     Y  F R   ++     C   L  ++  W  + C ++  +IC    P  + + E                  YK F +  ++ +A   C      L  V + +++ F+   L    KL +     +WI     ++DG++ ++DG  + F +W         ++  C+Y +      W    C +    IC    K  ++  E +        +G                        V + EA   C+++  +L+ + N     ++      ++ +  W+  +    +  WI  +++ L + NW  G+ +         K  +C  +  +P     G+W D SC ++   F 
Sbjct:  256 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTL-----WIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQI--KQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHML--NKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAV-LDLASLQWVPMQCQTQLDWICKI--PRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQ---KLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQE-DWGDQRCHTALPYIC----KRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFD-LWIGLHASQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFI 1105          

HSP 4 Score: 90.1225 bits (222), Expect = 1.883e-17
Identity = 89/413 (21.55%), Postives = 165/413 (39.95%), Query Frame = 1
Query: 2440 DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIY-----YYIENIISTK----------ELEIFK--------ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN--EDCVHGLYYSNGFWNDIACNSKNSFICSK---------------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYK 3537
            D+   F     +++ EA   C+     L++I        I  L   +  S  W+  ND+   G W   D + LKYLNW   +P+N G E+C +    ++G W +  CS    ++        +E I   +            + F+        E+ +++E++  C++ G  L+ I +    + I    +K ++ + WI  ND  ++  F  S+   + ++ +   EPNN+ +  EDCV  ++   G WND  CN     IC K                     +SP   ++ E        ++V Y +A   C   G  L+ + N      V +L   ++   +W    D  + G + +  G ++ + +W     P  +       ++ +  G W   +C S +   IC +
Sbjct:  245 DSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGE--------DQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQ-PGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQ 645          

HSP 5 Score: 87.0409 bits (214), Expect = 1.534e-16
Identity = 131/622 (21.06%), Postives = 239/622 (38.42%), Query Frame = 1
Query:   55 DFSCEDPSAVICYKETEPKISAE-----IELQSKYVIIFQEKTTFTEANKLC------------QAK----GYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----TQPK----------TSHVIKLLNRELII----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ------KNEHCVHGLYYSNA----LWNDISCA-DSNAVICYKESKIEV-----------LKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNY---QNEDCVH--GLYY--KNALWNDIKCED-LNAVIC-------YKNIGSRGFTKFEISNKEIVIFEE-------KVVFKHAQLL--CKNNGYELLKIDSDEINSMIYDF---AVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPG--EPNNYENEDCVHGLYYKNGLWNDIKC-DYKNSVIC 1641
            D+ C+ P  V      EP I  +     +  Q      F+  +++ +A ++C            QA+    G NL K+  DQ          + H   +WI  + ++ +G F + +G  I +  +A G+P    +++ CV+ M  +   W D  C      IC ++     TQP+           S   + LN+   I     Q++  +  A   C+ +  QL+ I +  L       ++       WI  +  Q +  +I  +   ++Y  +APGEP+         K   C   L+  +A     W+D SC  +++  IC K +   +             +++ LN    + ++ L +  A  LC+S+   L  + D  +       A +      WI             S++   ++S W + EP NY   Q+E+  H  G  Y   +  W    C+  L   +C        + I  RG     +++   + F E       +V+  H + L  C+  G  +L I  +  N  +++    A   + G  W+  N      T V+ D+  ++Y  W P    P+   +  C + +   +GLW    C +    V+C
Sbjct:  804 DWICKIPRGV---DVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQ----------EQH---WWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANP-LEQAFITASLPNVTFDLWIGLHASQRDFQWIEQE--PLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDP-YTQAFLTQAARGLQTPLWIGLA----------SEEGSRRYS-WLSEEPLNYVSWQDEEPQHSGGCAYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGA-WLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSC-YWIQSSSGLWRPGACTNITMGVVC 1391          
BLAST of Mannose-binding protein C vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 109.768 bits (273), Expect = 1.239e-23
Identity = 153/721 (21.22%), Postives = 281/721 (38.97%), Query Frame = 1
Query: 1711 VTYEEAINFCNQHNCRIVKISNVE----TNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISC---------KTKNYLIYEYESTAEKEITIE--------------IMEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKI-------DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCST-KNSFIYYYIENIISTKEL--------------------------------EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKI-GQ----------YWIDANDK-AVEG-KFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDE---------------HMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLV-----NYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDT 3558
            +++ EA   C Q    ++ I+ +      N ++  +S  +     WI  ND+ T G W  S  + L YLNW  ++P+N   E+C       +G W +  C         K  N  +   +      + +E              +   K ++ ++   C   G DL+ I +  E+  I   +  K +V + WI  ND+ ++  F +SDG  +S+ ++   EPNN  +  EDCV  ++   G WND  CN     +C K  +  +   +E+            S Y++   +V Y +A R C  H  +LVTI N      + +L    +   +W    D+   G +  + G+++ Y +WN+ +P  Y    C+ L    A G W   +C++ +  +I         T EL                                E  +E+ ++ +A   C + G  L+ + + E    +  +   NKI G+          +WI  N +   EG  +  S+     Y  F R   ++     C   L  ++  W  + C ++  +IC    P  + + E                  YK F +  ++ +A   C      L  V + +++ F+   L    KL      ++WI     ++DG++ ++DG  + F +W         ++  C+Y +      W    C +    IC + + + +T
Sbjct:  256 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTL-----WIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQI--KQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHML--NKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAV-LDLASLQWVPMQCQTQLDWICKI--PRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQ---KLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQE-DWGDQRCHTALPYICKRSNSSGET 958          

HSP 2 Score: 106.301 bits (264), Expect = 1.552e-22
Identity = 148/731 (20.25%), Postives = 275/731 (37.62%), Query Frame = 1
Query:  136 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYSNALWNDISCADSNAVICYKESKIE---------VLKKITVLNKELVIFKE-RLTYYKAQDLCKSQGYKLVKIDD--EQ--FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA--LWNDIKCEDLNA-VICYKNIGSRGFTKFEISNKEIVI-------------------------FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK---------HNIGTYWIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC---------SKDILNSN--ETIK-QQQKYYVHEVLVTYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSK--NMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKE 2049
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++     WND  C  S   IC K  ++            K  T  +       E ++ Y  A+ LC   G +LV I +  EQ   +S++YN+  +     +W    D+   G+F     +++ ++ W   +P  Y+   CV  L   +A  LW    C    A  IC +++G+    +    +    +                          +EK  +  A  +C+  G +LL + S E    +     K         H    +WI  N  D +  +++ +SD    SY  +     ++ +   C   L   +  W  ++C  +   IC           DI      E ++ Q+ +Y   E   ++ +A   C      +  + S  E + +     K  + +   +WI  + + ++G++  + G+ + +++WA  +P     +           +W D  C T   Y+     S+ E +
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQ-------AEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCV-ALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAV-LDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETQ 959          

HSP 3 Score: 90.1225 bits (222), Expect = 1.362e-17
Identity = 89/413 (21.55%), Postives = 165/413 (39.95%), Query Frame = 1
Query: 2440 DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIY-----YYIENIISTK----------ELEIFK--------ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN--EDCVHGLYYSNGFWNDIACNSKNSFICSK---------------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYK 3537
            D+   F     +++ EA   C+     L++I        I  L   +  S  W+  ND+   G W   D + LKYLNW   +P+N G E+C +    ++G W +  CS    ++        +E I   +            + F+        E+ +++E++  C++ G  L+ I +    + I    +K ++ + WI  ND  ++  F  S+   + ++ +   EPNN+ +  EDCV  ++   G WND  CN     IC K                     +SP   ++ E        ++V Y +A   C   G  L+ + N      V +L   ++   +W    D  + G + +  G ++ + +W     P  +       ++ +  G W   +C S +   IC +
Sbjct:  245 DSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGE--------DQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQ-PGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQ 645          

HSP 4 Score: 65.0846 bits (157), Expect = 6.055e-10
Identity = 75/365 (20.55%), Postives = 143/365 (39.18%), Query Frame = 1
Query: 2827 FKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS--------------------PPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEV-----------KKTKYYIHRIGVTFQEALDFCKERRCKLIVVDN------IDTNIYLWELSKKLSIEKYWLNGNDKDNEGA--WIDSDKKKLTFFN 3801
            F+  +++ EA  +C ++G  L+ I  E   Q   +  +       WI  ND    G +  S+N  LKY  +   +P+N G E+C      S+G W +  C+    ++C K                      P       H  Y++   K +++E+   C   G  L+ + + +++ FI  T  ++ ++   WI   D K    + +SDG  ++F +W      + +++     +     G+W  + C      IC K  +      E              + Y++    V + +A   C +   +L+ + N      + + IY WE       E +W    D ++ G+  W+  D+   T +N
Sbjct:  252 FQSTLSWREAWASCEQQGADLLSI-TEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHC-YRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFI--TKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWE------GEYFWTALQDLNSTGSFRWLSGDEVIYTHWN 606          
BLAST of Mannose-binding protein C vs. Ensembl Mouse
Match: Ly75 (lymphocyte antigen 75 [Source:MGI Symbol;Acc:MGI:106662])

HSP 1 Score: 91.6633 bits (226), Expect = 5.708e-18
Identity = 209/1029 (20.31%), Postives = 382/1029 (37.12%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEP--NNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR-FWINGNDIITEGKWVDSKGNKLVYLNWAKNEPN-NYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-----NYIKALELC-----KSKGYDL-------IRIENEEINKIV--YDVATKNKVGQYWINANDINVEGQFIYSDGQNI----SYRNFAHGEPNNQNNEDCV-HGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKID-------------TSKYFV-HTGRVT----YEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWL----DGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-----------LGNYFAN---GKWNDFSCSTKNSFI-------------YYYIEN--------IISTKELEIFKE-RVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIG-------QYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIA----CNSKNSFICS--------KYSP-PIIFIDEHMSYKIFINK---------VTYREAVDKCQSEGYSLIKV-ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTA------SLPS----DKENNNCLY----SSETLSGKWLGTSCVSKNSV-ICYKPSKTID------TGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDENEQCKE 3942
            +E + +K A + C+N G +LL I S     + Y    +      W+  N + +   + +SD + + +  W PG P         C   +  ++GLW  + C+ +   +C K + N+ E                       Y +     +++ A   C      ++ + ++   +++     N  + +  W    +  +   +  S G ++    W +NEP+  +N            G+W   SC+ K      Y    + EIT +    K+      + +  E C     K   +          R E E +N ++  YD + +     +W    D +  G++ ++  Q +    ++ N+   EP +     CV      T G W   +C S  ++   K   E ++ ++   K D              S Y V H  R+     +EEA RFCQ     L +    E     ++L +       WL    +      +G W   D   +  +        ++   DC            + + + +     W  F+C  K  ++             +Y  E         II   E     +  + +EEA   C      L  I +    +     A+KNK+        ++W+  ++  ++  F+ S      +       P  +G+E C+H    +  +  D++    CN+K  FIC         KYSP P   +     +  F NK         VT+ +A   C S G +L  V    +  FI+  L      +   +  T  +   +WT  D ++LT+ N+         S+P+    D+ + +C          L+G W  TSC  ++S+ +C K S+T D      T K VK     Y I    +T+  AL  C + + +L+ + +     +L  +   L    +W+  + +D+E  +  SD K+L F NW       ++  +C+  + DG W+   CDD  P    +   NE  +E
Sbjct:  235 QEILSWKEAYVSCQNQGADLLSIHS--AAELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFLNWDPGTPVAPVIGGSSCAR-MDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTHCHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKEIWTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLGKLGQWKVQSCEKK----LRYVCKKKGEITKDAESDKLCPPDEGWKRHGETCYKIYEKEAPFGTNCNLTITSRFEQEFLNYMMKNYDKSLRK---YFWTGLRDPDSRGEYSWAVAQGVKQAVTFSNWNFLEPASPGG--CVAMSTGKTLGKWEVKNCRSFRALSICKKVSEPQEPEEAAPKPDDPCPEGWHTFPSSLSCYKVFHIERIVRKRNWEEAERFCQALGAHLPSFSRREEIKDFVHLLKDQFSGQRWLWIGLNKRSPDLQGSWQWSDRTPVSAVMMEPEFQQDFDIRDCAAIKVLDVPWRRVWHLYEDKDYAYWKPFACDAKLEWVCQIPKGNTPQMPDWYNPERTGIHGPPVIIEGSEYWFVADPHLNYEEAVLYCASNHSFLATITSFTGLK-----AIKNKLANISGEEQKWWVKTSENPIDRYFLGSRRRLWHHF------PMTFGDE-CLH--MSAKTWLVDLSKRADCNAKLPFICERYNVSSLEKYSPDPAAKVQCTEKWIPFQNKCFLKVNSGPVTFSQASGICHSYGGTLPSVLSRGEQDFIISLLPEMEASLWIGLRWTAYERINRWT--DNRELTYSNFHPLLVGRRLSIPTNFFDDESHFHCALILNLKKSPLTGTWNFTSCSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLVSITDPYQQAFL-AVQATLRNSSFWIGLSSQDDELNFGWSDGKRLQFSNWAGSN---EQLDDCVILDTDGFWKTADCDDNQPGAICYYPGNETEEE 1231          

HSP 2 Score: 90.8929 bits (224), Expect = 1.076e-17
Identity = 306/1466 (20.87%), Postives = 519/1466 (35.40%), Query Frame = 1
Query:  157 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEP--NNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-----PKT-------SHVIKLLNREL--IILQEKTTYENAIAHCKSKGFQLIKI----DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN-NYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKER-LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQN---NIGRY-WIDANDVRIEGTFE----DSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKN-ALWNDIKCEDLNAV-ICYK---------------NIGSRGFTKFEISNKEIVIFE-EKVVFKH----AQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTY-WIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDC------------VHGLYYKN--GLWNDIKCDYKNSVICS---------KDILNSNET--------IKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNM--KIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEW-NDIS----CKTKNYLI-----------YEYESTAEKEIT-----------IEIMEGKVNYIKALELCKSKGYDLI----RIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAH-------GEPNNQ-NNEDCVHGLFYTN-------GLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYF-----VHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCS-TKNSFIYYYIENIIS--TKELEIFK---------------------------ERVTFEEAQNTCIK---KGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNS--------KNSFICSKY-----------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYKPSKTIDTGKEVKKTK------------------YYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY------WLNGNDKDNEGAWIDSDKKKLTFFNWTN------GKVNIQKTQNCLQGNPDGKWRDVSC 3885
            QE  ++ EA   CQ +G +L+ I         Y    +  A   W+  N +     +E+ + + +K+  +  G P         C   M  + G W  +SC+     +C K        P          HV  L N     ++  E ++++ A   CK+ G  LI +    D + + + ++N  V+ +I   W    +  +   F  SDG ++    +   EP+  + K  +CV  L      W   SC      +C K+ +I    +   L      +K    T YK  +     G         +F     NY ++N   ++ +Y W    D    G +        K  + FS W   EP +     CV     K    W    C    A+ IC K               +    G+  F  S     +F  E++V K     A+  C+  G  L      +EI   ++    + +   + WI  N      + ++ +SD   +S     P    +++  DC            V  LY       W    CD K   +C           D  N   T        I+  + ++V +  + YEEA+ +C  ++  +  I++    K I     N+  +  ++W+  ++   +  ++ S+     +       P  + +E CL  +      W  D+S    C  K   I           Y  +  A+ + T           +++  G V + +A  +C S G  L     R E + I  ++ ++     +G  W     IN      ++D + ++Y NF           P N  ++E   H     N       G WN  SC+  +S+   + + E +D +  E    T KY      + +  +T+  AL+ C     RLV+I +       L +    + S +W+  +    E  +   DG +L++ NW     +N   +DC++ +   +G W    C   +   I YY  N      + L+  K                           + VT EE Q+TC K   K  SL  I NEE N  + +  +       W+           +  +  AL Y+ +  G P    N   + GL  ++GFW+  + N         ++S    K            + P     +   Y +   KVT+ EA++ C   G  L  V N +    +  +  R     +    +   ++  + +SDG+   +  WQ+   P D      LY      G W    C+S K+  ICYKP+K       VK +K                  Y   ++  +F EA   C+E      VV   D N    +   +L  E Y      WL  +    + +W   D   +TF  W N      GK +I    N         WR V C
Sbjct:  235 QEILSWKEAYVSCQNQGADLLSIHSAA--ELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFLNWDPGTPVAPVIGGSSCAR-MDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTHCHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKEI---WTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLG-KLGQWKVQSCEKKLRYVCKKKGEITKDAESDKLCPPDEGWKRHGETCYKIYEKEAPFGTNCNLTITSRFEQEFLNYMMKNYDKSLRKYFWTGLRDPDSRGEYSWAVAQGVKQAVTFSNWNFLEPASPGG--CVAMSTGKTLGKWEVKNCRSFRALSICKKVSEPQEPEEAAPKPDDPCPEGWHTFPSSLSCYKVFHIERIVRKRNWEEAERFCQALGAHLPSFSRREEIKDFVHLLKDQFSGQRWLWIGLNKRSPDLQGSWQWSDRTPVSAVMMEPEFQQDFDIRDCAAIKVLDVPWRRVWHLYEDKDYAYWKPFACDAKLEWVCQIPKGNTPQMPDWYNPERTGIHGPPVIIEGSEYWFVADPHLNYEEAVLYCASNHSFLATITSFTGLKAIKNKLANISGEEQKWWVKTSENPIDRYFLGSRRRLWHHF------PMTFGDE-CLHMS---AKTWLVDLSKRADCNAKLPFICERYNVSSLEKYSPDPAAKVQCTEKWIPFQNKCFLKVNSGPVTFSQASGICHSYGGTLPSVLSRGEQDFIISLLPEMEASLWIGLRWTAYERINR-----WTDNRELTYSNFHPLLVGRRLSIPTNFFDDESHFHCALILNLKKSPLTGTWNFTSCSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLVSITDP-YQQAFLAVQATLRNSSFWIGLSSQDDELNFGWSDGKRLQFSNWAG---SNEQLDDCVILD--TDGFWKTADCDDNQPGAICYYPGNETEEEVRALDTAKCPSPVQSTPWIPFQNSCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHSL-SIRNEEENTFVVEQLLYFNYIASWVMLGITYENNSLMWFDKTALSYTHWRTGRPT-VKNGKFLAGLS-TDGFWDIQSFNVIEETLHFYQHSISACKIEMVDYEDKHNGTLPQFIPYKDGVYSVIQKKVTWYEALNACSQSGGELASVHNPNGKLFLEDIVNRDGFPLWVGLSSHDGSESSFEWSDGRAFDYVPWQSLQSPGD---CVVLYPK----GIWRREKCLSVKDGAICYKPTKDKKLIFHVKSSKCPVAKRDGPQWVQYGGHCYASDQVLHSFSEAKQVCQELDHSATVVTIADENEN--KFVSRLMRENYNITMRVWLGLSQHSLDQSWSWLDGLDVTFVKWENKTKDGDGKCSILIASN-------ETWRKVHC 1651          

HSP 3 Score: 80.8777 bits (198), Expect = 1.078e-14
Identity = 143/706 (20.25%), Postives = 266/706 (37.68%), Query Frame = 1
Query:  550 KTTYENAIAHCKSKGFQLIKI----DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAP-------GEPNNYQKNEHCVHGLYYSN-------ALWNDISCADSNAV-ICYKESKIE-------VLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCED--------------------LNAVICYKNIGSRGFTKFEISNKEIVIFEEK---VVFKHAQLLCK--NNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKC---------DYKNSV-ICSKDILN----SNETIKQQQKYY--VHEVL---VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN-GNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------------NYIKALELCKSKGYD--LIRIENEEINKIVYDVATKNK--VGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCN 2367
              T+  A   C S G  L  +    + D + S++  +     IG  W     +        +D +++ Y  F P         P N+  +E   H     N         WN  SC++ +++ +C K S+ E         K +  LN    I  + LT++ A   C  +  +LV I D    + +   A   N   +WI  +    E  F  SD  +++FS WA    +N Q +DCV  +   +  W    C+D                    L+   C   + S  +  F+ S    +I   +   V  +  Q  C+  ++    L I ++E N+ + +  +  N    W+        N+ ++ D   +SY  W  G P   +N   + GL   +G W DI+           Y++S+  C  ++++     N T+ Q   Y   V+ V+   VT+ EA+N C+Q    +  + N    K+  E   N      W+   +   +E  +  S G    Y+ W   +    +  DC+    YP G W    C +       Y+ T +K++   +   K                          ++ +A ++C+   +   ++ I +E  NK V  +  +N     + W+  +  +++  + + DG +++   F   E   ++ +     L  +N  W  + C+
Sbjct:  971 PVTFSQASGICHSYGGTLPSVLSRGEQDFIISLLPEMEASLWIGLRWTAYERINRW-----TDNRELTYSNFHPLLVGRRLSIPTNFFDDESHFHCALILNLKKSPLTGTWNFTSCSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLVSITDPYQQAFLAVQATLRN-SSFWIGLSSQDDELNFGWSDGKRLQFSNWAG---SNEQLDDCV--ILDTDGFWKTADCDDNQPGAICYYPGNETEEEVRALDTAKCPSPVQSTPWIPFQNSCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHSLSIRNEEENTFVVEQLLYFNYIASWVMLGITYENNSLMWFDKTALSYTHWRTGRP-TVKNGKFLAGL-STDGFW-DIQSFNVIEETLHFYQHSISACKIEMVDYEDKHNGTLPQFIPYKDGVYSVIQKKVTWYEALNACSQSGGELASVHN-PNGKLFLEDIVNRDGFPLWVGLSSHDGSESSFEWSDGRAFDYVPWQSLQ----SPGDCVV--LYPKGIWRREKCLSVKDGAICYKPTKDKKLIFHVKSSKCPVAKRDGPQWVQYGGHCYASDQVLHSFSEAKQVCQELDHSATVVTIADENENKFVSRLMRENYNITMRVWLGLSQHSLDQSWSWLDGLDVT---FVKWENKTKDGDGKCSILIASNETWRKVHCS 1652          

HSP 4 Score: 53.1434 bits (126), Expect = 3.589e-6
Identity = 100/462 (21.65%), Postives = 172/462 (37.23%), Query Frame = 1
Query:   49 WNDFSC-EDPSAVICYKETEPKISAEIELQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQ--YHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICY----------------KNTQPKTS-----------HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE-----------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIG-RYWID-ANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDL-NAVICYK 1260
            WN  SC E  S  +C K +E +     E  SK V        I  +  T+  A K C  +   L+ I D     Q   LA+Q       FWI  +    E  F + +G+R+++  +A    +N + +DCV  +   DGFW    CDD     ICY                K   P  S           + +   NR   +  E+        H K+     + I +++ N+ V    + +     W+         + +  D   + Y  +  G P    KN   + GL  ++  W+  S       + + +  I    KI +++ E                   + ++++T+Y+A + C   G +L  + +   N  ++   + N  G   W+  ++    E +FE SD     +  W + +       DCV  + Y   +W   KC  + +  ICYK
Sbjct: 1076 WNFTSCSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLVSITDPY---QQAFLAVQATLRNSSFWIGLSSQDDELNFGWSDGKRLQFSNWAG---SNEQLDDCV--ILDTDGFWKTADCDDNQPGAICYYPGNETEEEVRALDTAKCPSPVQSTPWIPFQNSCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHS---LSIRNEEENTFVVEQLLYFNYIASWVMLGITYENNSLMWFDKTALSYTHWRTGRPT--VKNGKFLAGL-STDGFWDIQSFNVIEETLHFYQHSISAC-KIEMVDYEDKHNGTLPQFIPYKDGVYSVIQKKVTWYEALNACSQSGGELASVHNP--NGKLFLEDIVNRDGFPLWVGLSSHDGSESSFEWSDGRAFDYVPWQSLQSPG----DCV--VLYPKGIWRREKCLSVKDGAICYK 1514          
BLAST of Mannose-binding protein C vs. Ensembl Mouse
Match: Ly75 (lymphocyte antigen 75 [Source:MGI Symbol;Acc:MGI:106662])

HSP 1 Score: 91.6633 bits (226), Expect = 6.589e-18
Identity = 208/1025 (20.29%), Postives = 380/1025 (37.07%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEP--NNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR-FWINGNDIITEGKWVDSKGNKLVYLNWAKNEPN-NYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-----NYIKALELC-----KSKGYDL-------IRIENEEINKIV--YDVATKNKVGQYWINANDINVEGQFIYSDGQNI----SYRNFAHGEPNNQNNEDCV-HGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKID-------------TSKYFV-HTGRVT----YEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWL----DGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-----------LGNYFAN---GKWNDFSCSTKNSFI-------------YYYIEN--------IISTKELEIFKE-RVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIG-------QYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIA----CNSKNSFICS--------KYSP-PIIFIDEHMSYKIFINK---------VTYREAVDKCQSEGYSLIKV-ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTA------SLPS----DKENNNCLY----SSETLSGKWLGTSCVSKNSV-ICYKPSKTID------TGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDENE 3930
            +E + +K A + C+N G +LL I S     + Y    +      W+  N + +   + +SD + + +  W PG P         C   +  ++GLW  + C+ +   +C K + N+ E                       Y +     +++ A   C      ++ + ++   +++     N  + +  W    +  +   +  S G ++    W +NEP+  +N            G+W   SC+ K      Y    + EIT +    K+      + +  E C     K   +          R E E +N ++  YD + +     +W    D +  G++ ++  Q +    ++ N+   EP +     CV      T G W   +C S  ++   K   E ++ ++   K D              S Y V H  R+     +EEA RFCQ     L +    E     ++L +       WL    +      +G W   D   +  +        ++   DC            + + + +     W  F+C  K  ++             +Y  E         II   E     +  + +EEA   C      L  I +    +     A+KNK+        ++W+  ++  ++  F+ S      +       P  +G+E C+H    +  +  D++    CN+K  FIC         KYSP P   +     +  F NK         VT+ +A   C S G +L  V    +  FI+  L      +   +  T  +   +WT  D ++LT+ N+         S+P+    D+ + +C          L+G W  TSC  ++S+ +C K S+T D      T K VK     Y I    +T+  AL  C + + +L+ + +     +L  +   L    +W+  + +D+E  +  SD K+L F NW       ++  +C+  + DG W+   CDD  P    +   NE
Sbjct:  235 QEILSWKEAYVSCQNQGADLLSIHS--AAELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFLNWDPGTPVAPVIGGSSCAR-MDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTHCHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKEIWTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLGKLGQWKVQSCEKK----LRYVCKKKGEITKDAESDKLCPPDEGWKRHGETCYKIYEKEAPFGTNCNLTITSRFEQEFLNYMMKNYDKSLRK---YFWTGLRDPDSRGEYSWAVAQGVKQAVTFSNWNFLEPASPGG--CVAMSTGKTLGKWEVKNCRSFRALSICKKVSEPQEPEEAAPKPDDPCPEGWHTFPSSLSCYKVFHIERIVRKRNWEEAERFCQALGAHLPSFSRREEIKDFVHLLKDQFSGQRWLWIGLNKRSPDLQGSWQWSDRTPVSAVMMEPEFQQDFDIRDCAAIKVLDVPWRRVWHLYEDKDYAYWKPFACDAKLEWVCQIPKGSTPQMPDWYNPERTGIHGPPVIIEGSEYWFVADPHLNYEEAVLYCASNHSFLATITSFTGLK-----AIKNKLANISGEEQKWWVKTSENPIDRYFLGSRRRLWHHF------PMTFGDE-CLH--MSAKTWLVDLSKRADCNAKLPFICERYNVSSLEKYSPDPAAKVQCTEKWIPFQNKCFLKVNSGPVTFSQASGICHSYGGTLPSVLSRGEQDFIISLLPEMEASLWIGLRWTAYERINRWT--DNRELTYSNFHPLLVGRRLSIPTNFFDDESHFHCALILNLKKSPLTGTWNFTSCSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLVSITDPYQQAFL-AVQATLRNSSFWIGLSSQDDELNFGWSDGKRLQFSNWAGSN---EQLDDCVILDTDGFWKTADCDDNQPGAICYYPGNE 1227          

HSP 2 Score: 90.5077 bits (223), Expect = 1.295e-17
Identity = 306/1466 (20.87%), Postives = 519/1466 (35.40%), Query Frame = 1
Query:  157 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEP--NNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-----PKT-------SHVIKLLNREL--IILQEKTTYENAIAHCKSKGFQLIKI----DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN-NYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKER-LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQN---NIGRY-WIDANDVRIEGTFE----DSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKN-ALWNDIKCEDLNAV-ICYK---------------NIGSRGFTKFEISNKEIVIFE-EKVVFKH----AQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTY-WIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDC------------VHGLYYKN--GLWNDIKCDYKNSVICS---------KDILNSNET--------IKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNM--KIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEW-NDIS----CKTKNYLI-----------YEYESTAEKEIT-----------IEIMEGKVNYIKALELCKSKGYDLI----RIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAH-------GEPNNQ-NNEDCVHGLFYTN-------GLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYF-----VHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCS-TKNSFIYYYIENIIS--TKELEIFK---------------------------ERVTFEEAQNTCIK---KGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNS--------KNSFICSKY-----------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYKPSKTIDTGKEVKKTK------------------YYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY------WLNGNDKDNEGAWIDSDKKKLTFFNWTN------GKVNIQKTQNCLQGNPDGKWRDVSC 3885
            QE  ++ EA   CQ +G +L+ I         Y    +  A   W+  N +     +E+ + + +K+  +  G P         C   M  + G W  +SC+     +C K        P          HV  L N     ++  E ++++ A   CK+ G  LI +    D + + + ++N  V+ +I   W    +  +   F  SDG ++    +   EP+  + K  +CV  L      W   SC      +C K+ +I    +   L      +K    T YK  +     G         +F     NY ++N   ++ +Y W    D    G +        K  + FS W   EP +     CV     K    W    C    A+ IC K               +    G+  F  S     +F  E++V K     A+  C+  G  L      +EI   ++    + +   + WI  N      + ++ +SD   +S     P    +++  DC            V  LY       W    CD K   +C           D  N   T        I+  + ++V +  + YEEA+ +C  ++  +  I++    K I     N+  +  ++W+  ++   +  ++ S+     +       P  + +E CL  +      W  D+S    C  K   I           Y  +  A+ + T           +++  G V + +A  +C S G  L     R E + I  ++ ++     +G  W     IN      ++D + ++Y NF           P N  ++E   H     N       G WN  SC+  +S+   + + E +D +  E    T KY      + +  +T+  AL+ C     RLV+I +       L +    + S +W+  +    E  +   DG +L++ NW     +N   +DC++ +   +G W    C   +   I YY  N      + L+  K                           + VT EE Q+TC K   K  SL  I NEE N  + +  +       W+           +  +  AL Y+ +  G P    N   + GL  ++GFW+  + N         ++S    K            + P     +   Y +   KVT+ EA++ C   G  L  V N +    +  +  R     +    +   ++  + +SDG+   +  WQ+   P D      LY      G W    C+S K+  ICYKP+K       VK +K                  Y   ++  +F EA   C+E      VV   D N    +   +L  E Y      WL  +    + +W   D   +TF  W N      GK +I    N         WR V C
Sbjct:  235 QEILSWKEAYVSCQNQGADLLSIHSAA--ELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFLNWDPGTPVAPVIGGSSCAR-MDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTHCHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKEI---WTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLG-KLGQWKVQSCEKKLRYVCKKKGEITKDAESDKLCPPDEGWKRHGETCYKIYEKEAPFGTNCNLTITSRFEQEFLNYMMKNYDKSLRKYFWTGLRDPDSRGEYSWAVAQGVKQAVTFSNWNFLEPASPGG--CVAMSTGKTLGKWEVKNCRSFRALSICKKVSEPQEPEEAAPKPDDPCPEGWHTFPSSLSCYKVFHIERIVRKRNWEEAERFCQALGAHLPSFSRREEIKDFVHLLKDQFSGQRWLWIGLNKRSPDLQGSWQWSDRTPVSAVMMEPEFQQDFDIRDCAAIKVLDVPWRRVWHLYEDKDYAYWKPFACDAKLEWVCQIPKGSTPQMPDWYNPERTGIHGPPVIIEGSEYWFVADPHLNYEEAVLYCASNHSFLATITSFTGLKAIKNKLANISGEEQKWWVKTSENPIDRYFLGSRRRLWHHF------PMTFGDE-CLHMS---AKTWLVDLSKRADCNAKLPFICERYNVSSLEKYSPDPAAKVQCTEKWIPFQNKCFLKVNSGPVTFSQASGICHSYGGTLPSVLSRGEQDFIISLLPEMEASLWIGLRWTAYERINR-----WTDNRELTYSNFHPLLVGRRLSIPTNFFDDESHFHCALILNLKKSPLTGTWNFTSCSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLVSITDP-YQQAFLAVQATLRNSSFWIGLSSQDDELNFGWSDGKRLQFSNWAG---SNEQLDDCVILD--TDGFWKTADCDDNQPGAICYYPGNETEEEVRALDTAKCPSPVQSTPWIPFQNSCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHSL-SIRNEEENTFVVEQLLYFNYIASWVMLGITYENNSLMWFDKTALSYTHWRTGRPT-VKNGKFLAGLS-TDGFWDIQSFNVIEETLHFYQHSISACKIEMVDYEDKHNGTLPQFIPYKDGVYSVIQKKVTWYEALNACSQSGGELASVHNPNGKLFLEDIVNRDGFPLWVGLSSHDGSESSFEWSDGRAFDYVPWQSLQSPGD---CVVLYPK----GIWRREKCLSVKDGAICYKPTKDKKLIFHVKSSKCPVAKRDGPQWVQYGGHCYASDQVLHSFSEAKQVCQELDHSATVVTIADENEN--KFVSRLMRENYNITMRVWLGLSQHSLDQSWSWLDGLDVTFVKWENKTKDGDGKCSILIASN-------ETWRKVHC 1651          

HSP 3 Score: 80.8777 bits (198), Expect = 1.193e-14
Identity = 143/706 (20.25%), Postives = 266/706 (37.68%), Query Frame = 1
Query:  550 KTTYENAIAHCKSKGFQLIKI----DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAP-------GEPNNYQKNEHCVHGLYYSN-------ALWNDISCADSNAV-ICYKESKIE-------VLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCED--------------------LNAVICYKNIGSRGFTKFEISNKEIVIFEEK---VVFKHAQLLCK--NNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKC---------DYKNSV-ICSKDILN----SNETIKQQQKYY--VHEVL---VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWIN-GNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKV-------------------------NYIKALELCKSKGYD--LIRIENEEINKIVYDVATKNK--VGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCN 2367
              T+  A   C S G  L  +    + D + S++  +     IG  W     +        +D +++ Y  F P         P N+  +E   H     N         WN  SC++ +++ +C K S+ E         K +  LN    I  + LT++ A   C  +  +LV I D    + +   A   N   +WI  +    E  F  SD  +++FS WA    +N Q +DCV  +   +  W    C+D                    L+   C   + S  +  F+ S    +I   +   V  +  Q  C+  ++    L I ++E N+ + +  +  N    W+        N+ ++ D   +SY  W  G P   +N   + GL   +G W DI+           Y++S+  C  ++++     N T+ Q   Y   V+ V+   VT+ EA+N C+Q    +  + N    K+  E   N      W+   +   +E  +  S G    Y+ W   +    +  DC+    YP G W    C +       Y+ T +K++   +   K                          ++ +A ++C+   +   ++ I +E  NK V  +  +N     + W+  +  +++  + + DG +++   F   E   ++ +     L  +N  W  + C+
Sbjct:  971 PVTFSQASGICHSYGGTLPSVLSRGEQDFIISLLPEMEASLWIGLRWTAYERINRW-----TDNRELTYSNFHPLLVGRRLSIPTNFFDDESHFHCALILNLKKSPLTGTWNFTSCSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLVSITDPYQQAFLAVQATLRN-SSFWIGLSSQDDELNFGWSDGKRLQFSNWAG---SNEQLDDCV--ILDTDGFWKTADCDDNQPGAICYYPGNETEEEVRALDTAKCPSPVQSTPWIPFQNSCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHSLSIRNEEENTFVVEQLLYFNYIASWVMLGITYENNSLMWFDKTALSYTHWRTGRP-TVKNGKFLAGL-STDGFW-DIQSFNVIEETLHFYQHSISACKIEMVDYEDKHNGTLPQFIPYKDGVYSVIQKKVTWYEALNACSQSGGELASVHN-PNGKLFLEDIVNRDGFPLWVGLSSHDGSESSFEWSDGRAFDYVPWQSLQ----SPGDCVV--LYPKGIWRREKCLSVKDGAICYKPTKDKKLIFHVKSSKCPVAKRDGPQWVQYGGHCYASDQVLHSFSEAKQVCQELDHSATVVTIADENENKFVSRLMRENYNITMRVWLGLSQHSLDQSWSWLDGLDVT---FVKWENKTKDGDGKCSILIASNETWRKVHCS 1652          

HSP 4 Score: 52.7582 bits (125), Expect = 3.744e-6
Identity = 99/463 (21.38%), Postives = 172/463 (37.15%), Query Frame = 1
Query:   49 WNDFSC-EDPSAVICYKETEPKISAEIELQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQ--YHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKNTQPKTSHVIKLL----------------------------NRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE-----------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIG-RYWID-ANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDL-NAVICYK 1260
            WN  SC E  S  +C K +E +     E  SK V        I  +  T+  A K C  +   L+ I D     Q   LA+Q       FWI  +    E  F + +G+R+++  +A    +N + +DCV  +   DGFW    CDD     ICY     +T   ++ L                            NR   +  E+        H K+     + I +++ N+ V    + +     W+         + +  D   + Y  +  G P    KN   + GL  ++  W+  S       + + +  I    KI +++ E                   + ++++T+Y+A + C   G +L  + +   N  ++   + N  G   W+  ++    E +FE SD     +  W + +       DCV  + Y   +W   KC  + +  ICYK
Sbjct: 1076 WNFTSCSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLVSITDPY---QQAFLAVQATLRNSSFWIGLSSQDDELNFGWSDGKRLQFSNWAG---SNEQLDDCV--ILDTDGFWKTADCDDNQPGAICYYPGN-ETEEEVRALDTAKCPSPVQSTPWIPFQNSCYNFMITNNRHKTVTPEEVQSTCEKLHSKAHS---LSIRNEEENTFVVEQLLYFNYIASWVMLGITYENNSLMWFDKTALSYTHWRTGRPT--VKNGKFLAGL-STDGFWDIQSFNVIEETLHFYQHSISAC-KIEMVDYEDKHNGTLPQFIPYKDGVYSVIQKKVTWYEALNACSQSGGELASVHNP--NGKLFLEDIVNRDGFPLWVGLSSHDGSESSFEWSDGRAFDYVPWQSLQSPG----DCV--VLYPKGIWRREKCLSVKDGAICYK 1514          
BLAST of Mannose-binding protein C vs. UniProt/SwissProt
Match: sp|P22897|MRC1_HUMAN (Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 9.004e-56
Identity = 257/1137 (22.60%), Postives = 448/1137 (39.40%), Query Frame = 1
Query:  934 KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIF------------------EEKVVFKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN--NYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK-------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI-----------------------YEYESTAEKEITIEIMEG----KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ--YWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTS-------------KYFVHTGRVTYEEALRFCQIHSCRLVTIEN-SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNED--CLLGNYFANGKWNDFSCSTKNSFIYYYIE-----------------------NIISTKELEIF----KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPN------NYGNEDCV---HGLYYSNGFWNDIACNSKNSFICSKYS------PPIIFIDEHM------SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNY-------WIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK--------PSKTIDTGKEVKKTK--------YYIH-RIGVTFQEALDFCKERRCKLIVVDNIDTNIYL-WELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSC 3885
            K  LT+++A+  C+ Q  +L+ I +    + +         G  WI  N +     ++ SD++  ++  W  G P+    + CV     KNA W +++C      IC K  G+     F I ++  V                    +EK + + A   C+  G +L  I + +E++ +I     + N    WI  NDI+ +  F +SD   +++ KW  GEP+  N   EDCV  +  K+G W D  C++    IC     +    I + +K             Y +   L T+ EA   CN  N  +  I +      +  +        FW   +DI T+G +  +   ++ + +W  + P        +       G W+ + C  K   +                        ++ +++   +  ++       K  + ++ + C++ G DL  I N+E  + ++ + T +      +W+     +    F +SDG  +SY N+A+GEPNN QN E C          WNDI+C  +N+ +C     +    +      D               +Y+    + T + A  FC+ +   LV+I++ SE   L   + R    S Y++ G  I  + ++  +DG+K+ Y++W  GEP N+ NED  C+   Y  +G WND +C   N+FI                            N  S K  +IF    +ER  ++EA+  CI  G +LV I NE+  Q      +K+     W   ND   E  F+ ++   + Y+ + +G P       +Y + DCV    G     G W D  C+SK  +IC   S      PP     +        SY +   K  + EA   C        K+ NS I+ I+   S  +  +         WI    +  D ++T++D  ++ + NW  A  P  K  + C+Y    L G W    C      +C +        P +      E   T         YYI       + +A   C      L+ +++   + +L + +    S   +W+ G  ++ EG W+  +   ++F NW  G  + ++          G W ++ C
Sbjct:  235 KSALTWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKK--GNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGI-AGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFI-GLLISLDKKFAWMDGSKVDYVSWATGEP-NFANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEK-EQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYC--------KLHNSLIASILDPYSNAFAWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNW-AADEP--KLKSACVYLD--LDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWI-GLFRNVEGTWLWINNSPVSFVNWNTGDPSGERNDCVALHASSGFWSNIHC 1347          

HSP 2 Score: 214.927 bits (546), Expect = 4.954e-55
Identity = 273/1151 (23.72%), Postives = 444/1151 (38.58%), Query Frame = 1
Query:  556 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFK------------------ERLTYYKAQDLCKSQGYKLVKIDD-EQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPN--NYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKE-----------IVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKW---YPG-EPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC---------------------SKDILNSNETIKQQQKYYV--HEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR----FWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYEY--------ESTAEKEITIEIME-GKVNYIK--------------ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQN-NEDCVHGLFYTNGLWNDISCNSINSVLCYK-----------PFXXXXXXXXXXG------KIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPN------NYGNEDCLL---GNYFANGKWNDFSCSTKNSFIYYY-----IENIISTKELEIF-----------KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK------YSPPIIFI----DEHMSYKIFINKVTYRE---------AVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDT 3558
            T+  A   C+ +  +L+ I +    + +  L      G  WI  N +     +  SD     Y  + PG P+  +  + CV      NA W ++ C      IC K +    L    + ++  V                     E+     A   C+ +G  L  I   E+ + I+     + N    WI  ND++I+  FE SD   + F+KW  GEP+  N + EDCV  +  K+  W D  CE     IC     S+G    E+                +I      F  A   C N    L  I+     + +  F        +W   +DIQT+ TF ++  +++ +  W    PG +P        + G     GLW+ +KCD K   +C                      +D   S+ T    + Y    HE   T+ E+ +FC      +  I+N E  + I  W      G     FW+          +  S G+ + Y NWA  EPNNY N E C E    P   WNDI+C+  N  I +         E T   +    + E G V Y                A   CK    DL+ I++E   K ++    +N     +     I+++ +F + DG  + Y ++A GEPN  N +E+CV  ++  +G WNDI+C   N+ +C +           P         +EG      K      F+   R  ++EA + C      LV+I+N E +   L    K      W   ND+  E  ++  DG  + Y NW +G P       +Y + DC++   G     GKW D +C +K  +I        + N  +T + + F           +++  + EA+  C      +  I +  +N   + L ++    + WI  N    + ++  ++   ++Y+ +   EP       CV+     +G+W    CN    F+C +        PP +       +H ++  F     Y E         A  +C   G SL+ +E++ + SF+ + +       N+WI G     +G W + +   ++F NW T   PS  E N+C+ +    SG W    C S    IC +P K ID 
Sbjct:  239 TWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSA-EPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNT--TLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGIAG-----GLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEK-KTWFESRDFCRALGGDLASINNKEEQQTI--WRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQN-EKEQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKL--KSACVY--LDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWI-GLFRNVEGTWLWINNSPVSFVNWNTGD-PSG-ERNDCV-ALHASSGFWSNIHCSSYKGYICKRP-KIIDA 1363          

HSP 3 Score: 211.46 bits (537), Expect = 6.717e-54
Identity = 260/1192 (21.81%), Postives = 471/1192 (39.51%), Query Frame = 1
Query:  103 EPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL----------------IILQEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESK------IEVLKKITVLNKE-----LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVH---GLYYKNALWNDIKCEDLNAVICYK-----------------------NIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK----HNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVICS------------------KDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYN-NEDCLEGNFYPN-GEWNDISCKTKNYLIYEYESTAEKEITIE---------------------------IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE------DCV---HGLFYTNGLWNDISCNSINSVLCY---------KPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI--------------FKERVTFEEAQNT---------CIKKGWSLVRIDNE-ETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYRE 3231
            +P  S   ++ SK  +      T+ +A K CQ +   L+ I +    T +  L     +G  WI  N +     +++ +    +Y  +  G P+    + CV     K+  W ++ C      IC K      S VI   +                   I   EK    +A+  C+ +G  L  I   ++L+ ++  L  +      WI  ND++ +  F  SDG  + + K+  GEP++   + E CV  +   +  W D  C      IC  +S+      +EV K      K+      +I     T+ +A   C ++   L  I+D    + + ++        +W   +D++ +GTF+ + + +++F+ W +  P   +   CV    G+     LW+ +KC++    +C                            SR    F++  K      EK  +  ++  C+  G +L  I++ E    I+         H +  +W+          F +SD   +SY+ W  GEPNNY+N E C          WNDI C++ N+ IC                     +      I +  +YY  +   T + A  FC ++   +V I +    K ++++         +  G  I  + K+    G+K+ Y++WA  EPN  N +E+C+    Y N G WNDI+C   N  I +  +++    T+                            + E + N+ +A + C   G +L+ I+NE+  +       K+     W   ND+N E  F+++DG+ + Y N+  G P  + +       DCV    G     G W D +C+S    +C           P     D   + GK   S Y +   +  + EA  +C++H+  + +I +   +     L  +      W+  N    + ++   D  +++Y NW   EP       C+  +   +G W    C+    F+    + I +T+  ++              F     + E+  T         C++ G SLV I++  E++   Y +        +WI    + VEG ++  NN  + +  +  G+P+   N DCV  L+ S+GFW++I C+S   +IC +  P I  ID   ++++   K   R+
Sbjct:  223 DPLTSVSYQINSKSAL------TWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPG--RKPGCVAMRTGI--AGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGK---HEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKL--FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCV--TMYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEK-EQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGK---SSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKL--KSACVYLDL--DGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLF-RNVEGTWLWINNSPVSFVNWNTGDPSGERN-DCV-ALHASSGFWSNIHCSSYKGYICKR--PKI--IDAKPTHELLTTKADTRK 1378          

HSP 4 Score: 166.777 bits (421), Expect = 3.676e-40
Identity = 224/1001 (22.38%), Postives = 386/1001 (38.56%), Query Frame = 1
Query: 1330 VVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD--ILNS----------NETIKQQQKYYVHEVLVTYEE------AINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDC--LEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEG------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVH---GLFYTNGLWNDISCNSINSVLC------------YKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYE-----EALRFCQIHSCRLVTIENSELDILILNL----ARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE-----------------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNED--CVHGLYYSNGFWNDIACNSKNSFICSKYS---------PPIIFID----------EHMSYKIFI----NKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK------ENNNCLY---SSETLSGKWLGTSCVSKNSVICYK--------PSKTIDTGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW--LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDE 3924
            + +  A+  C+    ELL I   EI+   Y   +  ++ +  WI  N +   + + +SD     Y  W PG P+    + CV     KN  W +++C  K   IC K    LNS               Q   Y  H   +  +E      A+  C +    +  I  +E    I            WI  NDI  +  +  S G  + +  W + EP++ NN  EDC  ++G    +G W D  C+     I + +S ++    +E+ +G                     + +A + C ++   L  IE+      +           +W   +DI  +G F ++  + + + ++    P  +    CV    G+    GLW+ + C+     +C                 E K  +       TS  F    +  +E     E+  FC+     L +I N E    I  L       HK+  +WL          +   DG+ + Y NW  GEPNNY N E C          WND +C   N++I    +      E                           KE+ T + A+  C +    LV I +E   + ++    +N     +      +++ KF   +   + Y  +  GEPN + NED  CV  +Y ++GFWNDI C   N+FIC +++         P +  +            +  +KIF      +  ++EA   C   G +L+ ++N  + +F+  T  ++    + W    D  ++  + ++DG+ + + NW     P  +      E+ +C+     +   +GKW+  +C SK   IC          P  TI T   VK  K+ Y + R    + EA  +CK     +  + +  +N + W L  + S E+ W  LN N  DN+  W  +DK ++ + NW   +  ++    C+  + DG W+   C++   F  +  DE
Sbjct:  238 LTWHQARKSCQQQNAELLSIT--EIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGK---DGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRK--PGCVAMRTGI--AGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKL--FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPN-FANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFL--TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKG-YPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTW--TDKWRVRYTNWAADEPKLKSA--CVYLDLDGYWKTAHCNESFYFLCKRSDE 1217          

HSP 5 Score: 115.546 bits (288), Expect = 1.781e-24
Identity = 135/645 (20.93%), Postives = 247/645 (38.29%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICY--KETEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNED--CVHGMFYKDGFWNDISCDDTNSVICYKN-----------TQPKTSHVIK-----LLNRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVI---------FKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNK-------EIVIFEEKVVF---------KHAQLLCKNNGYELLKIDSDEINSMI-YDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD-ILNSNETIKQQQKYYVHEVLVT 1716
            Q  E+C      P   WND +CE  +  IC   K   PK       Q    +                +EK T   A   C+    +L+ I+ +     ++    +  A   +     I ++  F +++G ++ Y  +A GEPN + NED  CV  M+   GFWNDI+C   N+ IC ++           T P      K       N+   I     +E+  ++ A   C   G  L+ I +++  + +    ++      W   ND+ +E  F+ +DG+ + Y  +  G P   +     ++  CV    G       W D +C      IC   S   +      +  +  +          +++  +++A+  CK     +  I D   N+  +   ++ +  R WI  N    +  +  +DK +++++ WAA EP       CV+     +  W    C +    +C ++         ++  +         + F     +           A L C   G  L+ I+S   +S + Y      +   +WI       E T+++ ++  +S+  W  G+P+  E  DCV  L+  +G W++I C      IC +  I+++  T         HE+L T
Sbjct:  748 QNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPN-FANEDENCVT-MYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFL-TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVY--LDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFR-NVEGTWLWINNSPVSFVNWNTGDPSG-ERNDCV-ALHASSGFWSNIHCSSYKGYICKRPKIIDAKPT---------HELLTT 1372          

HSP 6 Score: 60.077 bits (144), Expect = 1.722e-7
Identity = 84/394 (21.32%), Postives = 151/394 (38.32%), Query Frame = 1
Query: 2830 KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ-YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK------------------YSPPIIFIDEHMSYKIFIN-KVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENN--NCLYSSETLSGKWLGTSCVSKNSVICYKPSKT-------IDTG--KEVKKTKYYIHRIG---VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQ-GNPDGKWRDVSCDDKNPF 3903
            K  +T+ +A+ +C ++   L+ I   E ++  Y   + + +    WI  N  +    +  S+    +Y  +  G P+    + CV      N  W ++ C  K  +IC K                  + P   +      YKI  + K   R+A+  C+ EG  L  +    ++ FI+  L         WI   D K    + +SDG  +TF  W     PS + N   +C+   +   G W    C      IC   S++       ++ G  K  KK  +Y + IG    TF EA   C      L  +++     +L         + +W   +D   +G +  + ++++ F +W +     +     ++ G   G W  + CD+K  F
Sbjct:  235 KSALTWHQARKSCQQQNAELLSIT--EIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGE-PSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGIAGGLWDVLKCDEKAKF 623          
BLAST of Mannose-binding protein C vs. UniProt/SwissProt
Match: sp|Q61830|MRC1_MOUSE (Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 2.591e-53
Identity = 251/1151 (21.81%), Postives = 446/1151 (38.75%), Query Frame = 1
Query:  142 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVIKLLNREL---------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVL------KKITVLNKE-----LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCV-HGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTK---------------FEISNKEIVIFE-------EKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK----HNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVIC----SKDILNSNETIKQQQ--------------KYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEW-SKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIM--------------------------EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE------DCV---HGLFYTNGLWNDISCNSINSVLCYK------PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI---------------------FKERVT--FEEAQNTCIKKGWSLVRIDNE-ETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPII 3174
            Y I  +   T+ +A   C+ +  +L+ + +      +  L     +G  WI  N + V   +++  G   +Y  +  G P++   + CV     K+  W ++ C      IC K          P  S V      +          I  +EK   + A+  C+ +G  L  I   +    +++          WI  ND++ +  F  SDG  + + K+ PGEP++   + E CV  +   +  W D +C      IC   S+   +      K      K       +I     T+  A   C ++   L  ++D    + + +         +W   +DV+ +GTF  +   +++F+ W A  P   +   CV         LW+ + CE+    +C     + G T+               +  ++K  + F+       EK  +  ++  CK  G EL  I S +   +I+         H +  +W+          F +SD   +SY+ W  GEPNNY+N +    L    G+ WNDI C++ N+ IC     K +L       Q                +YY  +   T + A  FC ++   +  I +    K ++++ +KN     ++I G  I  + K++   G+K+ ++ WA  EPN  N+++     +  +G WNDI+C   N  I +  +++     +                             E K ++  A + CK    +L+ IEN +    V     ++     W   NDIN E  F+++ GQ + Y N+  G P  + +       DCV    G     G W D +C+S    +C        P       K        S Y +   ++ + EA  +C+ H+  L +I +   +           +   W+  N      E+   D  +++Y NW   EP       C+  +   +G W    C+    F+    + I +T+  ++                     F+   T  + +A   C++ G SLV I+   E++   Y +        +WI    + VEGK++  N++ + +  +  G+P+   N DCV  L  S+G WN+I C+S   FIC    P II
Sbjct:  230 YQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSG-LWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKH--WAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHEL--FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFI-GMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVP-IWIALNSNLTNNEYTWTDRWRVRYTNWGADEPKL--KSACVYMD--VDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMF-RNVEGKWLWLNDNPVSFVNWKTGDPSGERN-DCVV-LASSSGLWNNIHCSSYKGFICKM--PKII 1360          

HSP 2 Score: 199.134 bits (505), Expect = 4.465e-50
Identity = 230/1134 (20.28%), Postives = 447/1134 (39.42%), Query Frame = 1
Query:  934 KERLTYYKAQDLCKSQGYKLVKIDD--EQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIF------------------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN--NYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK--------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYE-----------------------YESTAEKEITIEIMEG----KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ--YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCY-----------KPFXXXXXXXXXXGKI--DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL----------------------EIF----KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPN------NYGNEDCV---HGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHM------------SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK--------PSKTIDTGKEVKKTK---------YYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYL-WELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPF 3903
            K  LT+++A+  CK Q   L+ + +  EQ        ++ + +   WI  N + +   ++ +  +  ++  W  G P++   + CV     KNA W +++C      IC K  G+     F I +   V                    EEK + K+A   C+  G +L  I S E    I+           WI  NDI+ +  F +SD   +++ KW PGEP+  N   EDCV  +  K+G W D  C+     IC K +  S+  + +                 Y +   L T+ +A + C      +  + +      +           FW   +D+  +G +  +   ++ + +W  + P        ++      G W+ +SC+ K   + +                       + +T++  +  ++       K  + ++ + CK+ G +L  I++++  ++++ + T +      +W+     +    F +SDG  +SY N+A+GEPNN  N +    L    G+ WNDI+C  +N+ +C             P  +D      +G +     +Y+    + T + A  FC+ +   L TI++      +     K+     +  G  I  + +++ +DG+K+ ++ W  GEPN   +++  +  Y  +G WND +C   N+FI     + I+   +                      +IF    +E+ ++++A+  C     +LV I+N +  Q      +++     W   ND   E  F+ +    + Y+ + +G P       +Y + DCV    G     G W D  C+SK  +IC   + P + +                SY +   K+ + EA   C+    SL+       S     + +    V  WI    +  + ++T++D  ++ + NW  A  P  K  + C+Y    + G W  + C      +C K        P +      E ++T          Y+      ++ +A   C      L+ ++    + +L + +    S   +W+ G  ++ EG W+  +   ++F NW  G  + ++    +  +  G W ++ C     F
Sbjct:  235 KSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSGL---WIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKK--GNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYIC-KMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAGCVAMKTGV-AGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQ-EQAFVTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDH-TSLLASILDPYSNAFAWMKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNW-GADEP--KLKSACVYMD--VDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWI-GMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVVLASSSGLWNNIHCSSYKGF 1352          

HSP 3 Score: 190.66 bits (483), Expect = 1.487e-47
Identity = 212/910 (23.30%), Postives = 355/910 (39.01%), Query Frame = 1
Query:   40 NALWNDFSCEDPSAVICYKETEPKI----SAEIELQSKY-------VIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV-HGMFYKDGFWNDISCDDTNSVICYK-----------------------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY----WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE--------LVIFKERLTYYK--------AQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNED--CVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEIS---------------NKEIVIF----EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN------NYENEDCV---HGLYYKNGLWNDIKCDYKNSVICSKDI-----LNSNETIKQ------QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRF----WINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIY----EYESTAEKEITIEIMEGK-------------------VNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP 2397
            +  W D +CE P   IC   ++        A+   +  +        +I    +TFT+AN  C  +   L  +ED      + +L        FW   +D++ +GTF +   +++++  +    P   R   CV        G W+ +SC++    +C                          T  KTS   KL  +      EK T+  +   CK+ G +L  I       +++ L      G Y    W+          F  SDG  + Y  +A GEPNNYQ  E+C          WNDI+C   N  IC  +    +L + T   ++         VI+K+   Y+         A+  CK     L  I  E     ++ Y  +N     +     + ++  F   D +K+ F  WA GEP N+ N+D  CV  +Y  +  WNDI C   N  IC ++  S   T    +               NK   IF    EEK  ++ A+  CK     L+ I++ +  + +  + ++ +    W   NDI  E+ F+++  + + Y  W  G P       +YE+ DCV    G   + G W D  CD K   IC         ++   T K       +  Y + ++ + + EA  +C  H   +  I +  +N   +     MK+  F    WI  N  +T  ++  +   ++ Y NW  +EP       C+  +   +G W    C    Y +     E  +T   ++  +  E +                    ++ +A   C   G  L+ IE   E + + Y V        +WI     NVEG++++ +   +S+ N+  G+P+ + N DCV  L  ++GLWN+I C+S    +C  P
Sbjct:  470 DGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGK---HEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITS--SGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEP-NFANDDENCVT-MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAW-----MKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPK--LKSACVYMDV--DGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFR-NVEGKWLWLNDNPVSFVNWKTGDPSGERN-DCVV-LASSSGLWNNIHCSSYKGFICKMP 1357          

HSP 4 Score: 150.984 bits (380), Expect = 2.442e-35
Identity = 208/1000 (20.80%), Postives = 385/1000 (38.50%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT-YWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD-------ILNSNETIK-----QQQKYYVHEVLVTYEE------AINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDC--LEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEG------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCV-HGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTG------------------RVTYEEALRFCQIHSCRLVTIENSELDILILNL----ARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFANGKWNDFSCSTKNSFI---------------------YYYIENIISTKELEIF--KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNED--CVHGLYYSNGFWNDIACNSKNSFICSKYSPPI------------------IFIDEHMSYKIFI----NKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDK------ENNNCLY---SSETLSGKWLGTSCVSKNSVICYK---PSKTIDTGKEVK-------KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY-WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDE 3924
            +  + +  A+  CK    +LL +   EI+  +Y   +  ++ +  WI  N +   + + ++      Y  W PG P++   + CV     KN  W +++C  K   IC K        I+ S   +      Q   Y  H   +  EE      A+  C +    +  I ++E    I+           WI  NDI  +  +  S G  + +  W   EP++ NN  EDC  ++G    +G W D +C+     I +  S +   +     +G                     +  A   C ++   L  +E+      +  +        +W   +D+  +G F ++  + + + ++    P  +    CV        GLW+ +SC      +C K + E      E       K   + G                  + T+ E+  FC+     L +I++ +   +I  L       H++  +WL          +   DG+ + Y NW  GEPNNY N E C          WND +C   N++I                         +  +  K+ + +  KE+ T + A+  C K    L  I +E   + ++    KN     +      +++ KF+  +   + +  +  GEPN + N+D  CV  +Y ++GFWNDI C   N+FIC +++  I                    + ++  +KIF      K ++++A   C+    +L+ +EN+     V T  +R    N W    D   +  + ++ GQ + + NW     P  +      E+ +C+     +   +G W+  +C SK   IC     PS  +      K       K+ Y + ++ + + EA  +CK+    L  + +  +N + W      ++  +  LN N  +NE  W  +D+ ++ + NW   +  ++    C+  + DG WR   C++   F  +  DE
Sbjct:  235 KSALTWHQARASCKQQNADLLSVT--EIHEQMYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVVMKGK---DGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAG--CVAMKTGVAGGLWDVLSCEEKAKFVC-KHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHEL--FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPN-FANDDENCVT-MYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKG-YPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVPIWIALNSNLTNNEYTW--TDRWRVRYTNWGADEPKLKSA--CVYMDVDGYWRTSYCNESFYFLCKKSDE 1216          

HSP 5 Score: 102.449 bits (254), Expect = 2.236e-20
Identity = 125/616 (20.29%), Postives = 228/616 (37.01%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVIC--------YKETEPKISAEIELQSKYVIIFQ--------EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLL---------------NRELIIL----QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-----KNEHCV---HGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVI---------FKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNK--------------EIVIFEEKVV--FKHAQLLCKNNGYELLKIDSDEINSMI-YDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            Q  E+C      P   WND +CE  +  IC          E  P       + +   +I++        EK T   A   C+    +L  I+ +     ++    +      +     I ++  F +++G ++ +  +A GEPN   +++    M+   GFWNDI+C   N+ IC ++     +  +                  N+   I     +EK ++++A   CK     L+ I++ Q  + V    ++      W   ND+  E  F+ + G+ + Y  +  G P   +     ++  CV    G       W D +C      IC  ++   +    T   K+  +          K +L +++A+  CK     L  I D   N+  +      N+   WI  N       +  +D+ +++++ W A EP       CV+     +  W    C +    +C K+         ++  K                  FE      +  A L C   G  L+ I++   +S + Y      +   +WI       E  +++ +   +S+  W  G+P+  E  DCV  L   +GLWN+I C      IC
Sbjct:  748 QNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNV-PIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPK--LKSACVY--MDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFR-NVEGKWLWLNDNPVSFVNWKTGDPSG-ERNDCVV-LASSSGLWNNIHCSSYKGFIC 1354          
BLAST of Mannose-binding protein C vs. UniProt/SwissProt
Match: sp|Q4TU93|MRC2_RAT (C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 5.375e-34
Identity = 201/1007 (19.96%), Postives = 382/1007 (37.93%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIK------------------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYPNGEWNDISCKTKNYLIYE-----YESTAEKEITIE------------IMEGKVNYIKALELCKSKGYDLI----RIENEEINKIVYDVATKNKVGQY-WINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKY-------------FVHTGRV----------TYEEALRFCQIHSCRLVTIENSELDILILNLARK---------HKISGYW--LDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI-----------------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEE----TNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFICSKYS----------PPIIFIDEHMSYKIFINK------------VTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQT------ASLPSDKENNNC---LYS-SETLSGKWLGTSCVSK-NSVICYKPS----------KTIDTGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDK 3894
            F+  + ++ A   C+  G +LL I    +   IN ++  ++      T WI  ND+ T   + +SD+  + Y  W   +P+N   E+C       +G W +  C      +C K    + E I+                  Q   Y +     +++E+   C +    ++ I ++   + I +  K  ++   WI  ND+  +  +  S G+ + + +W   EPNN+ +  EDC+   + P G WND  C      I +      + TAE++                + E +V Y  A  LC   G  L+    R E   ++ ++Y     N  G+Y W    D+N  G F +  G  + Y ++   +P  +             GLW   +C S  +    +         +  G   T                  H  +V          ++ EAL  C+    +L+++ + E +  + N+  K         H+   +W  L+  D ++   W   DG    Y N+ + + ++     C + +  A+ +W    C T+  +I      +                     E + F+   ++ +AQ  C      L  + ++       QN+  L+  ++   +WI  +    +G+F  S+   + +  +  G+P   G ++ CV+ +      W D  C++   +IC + +          PP         +  F+NK            V + EA   C+ +   L+ + N  + ++I  T SL     + WI    S+ D +W   + + L + NW        +  PS  +  +C   L+S S   +G+W   SC  + +  IC K +               G E+      + + +  + +++AL  C+ R   L  V +  T  +L + ++ L     W+    ++    +    ++ L + +W +G+   Q T  C   + DG WR  SCD K
Sbjct:  252 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-----STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMTELEFITKQIKQ-EVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIY-----NWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIEALGVCRELGAQLLSLASYEEEHFVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSQHDDDNIRGCAVLD-LASLQWVAMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQKLS-SDQEQHWWIGLHTSESDGRFRWSDGSVINFVSWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETRPHDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAYI--TASLPNVTFDLWIGLHGSQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAAALPAPGTELSYLNRTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQA-PLWIGLASEEGSRRYSWLSEEPLNYASWQDGEP--QHTGGCAYVDVDGTWRTTSCDTK 1236          

HSP 2 Score: 130.568 bits (327), Expect = 4.709e-29
Identity = 226/1178 (19.19%), Postives = 422/1178 (35.82%), Query Frame = 1
Query:  136 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYSNALWNDISCADSNAVICYKESKIE---------VLKKITVLNKELVIFKE-RLTYYKAQDLCKSQGYKLVKIDD--EQ--FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA--LWNDIKCEDLNA-VICYKNIGSRGFTKFEISNKEIVI-------------------------FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK---------HNIGTYWIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHG---LYYKNGLWNDIKCDYKNSVIC---------SKDILNSN--ETIK-QQQKYYVHEVLVTYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSKNMKI------GRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEK-------------------------EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE-------DCVHGLF----YTNGLWNDISCN-SINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGR--------VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE---------------IFKER---------VTFEEAQNTCIKKGWSLVRIDNEETNQNIYD--LAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKF-PRGEPNNYGNEDCVHGLYYSNGFWNDIAC-NSKNSFIC 3150
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++     WND  C  S   IC K  ++            K  T  +       E ++ Y  A+ LC   G +LV I +  EQ   +S++YN+  +     +W    D+   G+F     +++ ++ W   +P  Y+   CV  L   +A  LW    C    A  IC +++G+    +    +    +                          +EK  +  A  +C+  G +LL + S E    + +   K         H    +WI  N  D +  +++ +SD    SY  +      +  ++D + G   L   +  W  ++C  +   IC           DI      E ++ Q+ +Y   E   ++ +A   C      +  + S  E + +     +NM+         +WI  +   ++G++  S G+ + +++WA  +P     +           +W D  C T   Y+     S+ E                           I  +  + +V + +A   C+ +   L+ I N  + +     +  N     WI  +    + Q+I  + + + Y N+A GEP+  +          C   L     +  G W+D SC    +  +C K                      +  R        + +++AL  C+  +  L  + +      +   AR  + +  W+     +    +  +    L Y +W  GEP + G   C   +   +G W   SC TK       +        +                 F+E          +  +EA   C + G +++ I +E  N  +++     + +    W+  N     G  V  +N A+ YS + P G   +  + +  + +  S+G W   AC N     +C
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQ-------AEKRSWQESKRACLRGGGDLLSIHSMTELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGE----YFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQP-GYRRGGCV-ALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIEALGVCRELGAQLLSLASYEEEHFVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFA----RSQHDDDNIRGCAVLDLASLQWVAMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQAELTSVHSQAELDFL----GQNMQKLSSDQEQHWWIGLHTSESDGRFRWSDGSVINFVSWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETRPHDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIAN-PLEQAYITASLPNVTFDLWIGLHGSQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAAALPAPGTELSYLNRTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQ-APLWIGLASEEGSRRYSWLSEEPLNYASWQDGEPQHTGG--CAYVD--VDGTWRTTSCDTKLQGAVCGVSRGPPPPRISYRGSCPQGLADSSWIPFREHCYSFHTELLLGHKEALQRCQRAGGTVLSILDEMENVFVWEHLQTAETQSRGAWLGMNFNPKGGMLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPGACTNVTMGVVC 1391          

HSP 3 Score: 118.627 bits (296), Expect = 2.330e-25
Identity = 180/875 (20.57%), Postives = 336/875 (38.40%), Query Frame = 1
Query: 1711 VTYEEAINFCNQHNCRIVKISNVE----TNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKE---------ITIE--------------IMEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKI-------DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCST-KNSFIYYYIENIISTKEL--------------------------------EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKI-GQ----------YWIDANDK-AVEG-KFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDE---------------HMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVN-----YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIG------------------------VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ-------KTQNC--LQGNPD----GKWRDVSCDDKNPFFF 3909
            +++ EA   C Q    ++ I+ +      N ++  +S  +     WI  ND+ T G W  S  + L YLNW  ++P+N   E+C       +G W +  C      + + +  A  E         + +E              +   K ++ ++   C   G DL+ I +  E+  I   +  K +V + WI  ND+ ++  F +SDG  +S+ ++   EPNN  +  EDCV  ++   G WND  CN     +C K  +  +   +E+            S Y++   +V Y +A R C  H  +LVTI N      + +L    +   +W    D+   G +  + G+++ Y +WN+ +P  Y    C+ L    A G W   +C++ +  +I         T EL                                E  +E+ ++ EA   C + G  L+ + + E    + ++   NKI G+          +WI  N +   EG  +  S+     Y  F R + ++     C   L  ++  W  + C ++  +IC    P  + + E                  YK F +  ++ +A   C      L  V + +++ F+   +    KL +     +WI    S++DG++ +SDG  + F +W         ++  C+Y +      W    C +    IC    K  ++  E +        +G                        V + EA   C+++  +L+ + N     Y+      ++ +  W+  +    +  WI  +++ L + NW  G+ +         K  +C  +  +P     G+W D SC ++   F 
Sbjct:  256 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTL-----WIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMTELEFITKQI--KQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQP-GYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIEALGVCRELGAQLLSLASYEEEHFVANML--NKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSQHDDDNIRGCAV-LDLASLQWVAMQCQTQLDWICKI--PRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQ---KLSSDQEQHWWIGLHTSESDGRFRWSDGSVINFVSWAPGKPRPIGKDKKCVYMTARQE-DWGDQRCHTALPYIC----KRSNSSGETRPHDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAYITASLPNVTFD-LWIGLHGSQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFI 1105          

HSP 4 Score: 91.2781 bits (225), Expect = 4.979e-17
Identity = 88/414 (21.26%), Postives = 162/414 (39.13%), Query Frame = 1
Query: 2437 IDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIIST---------------KELEIFK--------ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN--EDCVHGLYYSNGFWNDIACNSKNSFICSK---------------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYK 3537
             D+   F     +++ EA   C+     L++I        I  L   +  S  W+  ND+   G W   D + LKYLNW   +P+N G E+C +    ++G W +  CS    ++     N  +                   + F+        E+ +++E++  C++ G  L+ I +  T        +K ++ + WI  ND  ++  F  S+   + ++ +   EPNN+ +  EDCV  ++   G WND  CN     IC K                     +SP   ++ E        ++V Y +A   C   G  L+ + N      V +L   ++   +W    D  + G + +  G ++ + +W     P  +       ++ +  G W   +C S +   IC +
Sbjct:  244 TDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSI-HSMTELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGE--------DQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQ-PGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQ 645          

HSP 5 Score: 83.5741 bits (205), Expect = 1.098e-14
Identity = 118/604 (19.54%), Postives = 224/604 (37.09%), Query Frame = 1
Query:   55 DFSCEDPSAVICYKETEPKISAE-----IELQSKYVIIFQEKTTFTEANKLC---QAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----TQPK----------TSHVIKLLNRELII----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ------KNEHCVHGLYYSNA----LWNDISCA-DSNAVICYKESKIEVL-----------KKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYY--KNALWNDIKCED-LNAVICYKNIGS-------RGFTKFEISNKEIVIFEEKVVFKHAQLL---------CKNNGYELLKIDSDEINSMIYDF---AVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPG--EPNNYENEDCVHGLYYKNGLWNDIKC-DYKNSVIC 1641
            D+ C+ P  V      EP I  +     +  Q      F+  +++ +A ++C   QA+  ++    +  F  Q            +WI  +  + +G F + +G  I +  +A G+P    +++ CV+ M  +   W D  C      IC ++     T+P            S   + LN+   I     Q++  +  A   C+ +  QL+ I +  L       ++       WI  +  Q +  +I  +   ++Y  +APGEP+         K   C   L+  +A     W+D SC  +++  IC K +   +             +++ LN+   + ++ L +  A  LC+S+   L  + D  +       A +      WI          +    +  + ++ W  GEP +        G  Y   +  W    C+  L   +C  + G        RG     +++   + F E     H +LL         C+  G  +L I  +  N  +++    A   + G  W+  N        V+ D+  ++Y  W P    P+   +  C + +   +GLW    C +    V+C
Sbjct:  804 DWICKIPRGV---DVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQKLSSDQEQHWWIGLHTSESDGRFRWSDGSVINFVSWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETRPHDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANP-LEQAYITASLPNVTFDLWIGLHGSQRDFQWIEQE--PLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAAALPAPGTELSYLNRTFRLLQKPLRWKDALLLCESRNASLAHVPDP-YTQAFLTQAARGLQAPLWIGLASEEGSRRYSWLSEEPLNYASWQDGEPQH------TGGCAYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPPRISYRGSCPQGLADSSWIPFREHCYSFHTELLLGHKEALQRCQRAGGTVLSILDEMENVFVWEHLQTAETQSRGA-WLGMNFNPKGGMLVWQDNTAVNYSNWGPPGLGPSMLSHNSC-YWIQSSSGLWRPGACTNVTMGVVC 1391          
BLAST of Mannose-binding protein C vs. UniProt/SwissProt
Match: sp|Q9UBG0|MRC2_HUMAN (C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 7.876e-32
Identity = 230/1170 (19.66%), Postives = 429/1170 (36.67%), Query Frame = 1
Query:  136 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYSNALWNDISCADSNAVICYKESKIE---------VLKKITVLNKELVIFKE-RLTYYKAQDLCKSQGYKLVKIDD--EQ--FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA--LWNDIKCEDLNA-VICYKNIGSRGFTKFEISNKEIVI-------------------------FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK---------HNIGTYWIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHG---LYYKNGLWNDIKCDYKNSVIC----SKDILNSNETIK--------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSK--NMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEY----ESTAEKEITIEIMEG----------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE-------DCVHGLF----YTNGLWNDISCN-SINSVLCYKPFXXXXXXXXXXGKIDTS---KYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYW--LDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTK--------------NSFIYYY--IENIISTKELEIFKER---------VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ---YWIDANDKAVEGKFVDSNNHALKYSKF-PRGEPNNYGNEDCVHGLYYSNGFWNDIACN 3129
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++     WND  C  S   IC K  ++            K  T  +       E ++TY +A+ LC   G +LV I +  EQ   +S++YN+  +     +W    D+   G+F     +++ ++ W   +P  Y    CV  L   +A  LW    C    A  IC +++G+    +    +    +                          ++K  +  AQ  C+  G +LL + S E    + +   K         H    +WI  N  D +   ++ +SD    SY  +      +  ++D + G   L   +  W  ++CD +   IC      D+   +++ +        Q+ +Y   E   T+ +A   C      +  + S  E + + +   K    +   +WI  +   ++G++  + G+ + +++WA  +P     +           +W D  C T    I +     + T   ++    + G                      +V + +A   C+ +   L+ I N  + +     +  N     WI  +    + Q++  + + + Y N+A GEP+  +          C   L     +  G W+D SC    +  +C K                      Y   T R     + + +AL  C+  +  L  + +      +   AR  +    W  L G +  +   WV+ +   L Y+ W  GEP   G   C   +   +G W   SC TK                 I Y+      ++      F+E          +  +EA+  C + G +++ I +E  N  +++  +++  GQ    W+  N     G  V  +N A+ YS + P G   +  + +  + +  ++G W   AC 
Sbjct:  247 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQ-------AEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGE----YFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQP-GYSRGGCV-ALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFD----RSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITN-PLEQAFITASLPNVTFDLWIGLHASQRDFQWV--EQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTP-LWIGLAGEEGSRRYSWVSEE--PLNYVGWQDGEPQQPGG--CTYVD--VDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWE-HLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWRPGACT 1385          

HSP 2 Score: 139.043 bits (349), Expect = 1.154e-31
Identity = 199/1008 (19.74%), Postives = 375/1008 (37.20%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIK------------------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE-----------------IMEGKVNYIKALELCKSKGYDLI----RIENEEINKIVYDVATKNKVGQY-WINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINS-VLCYK--------------PFXXXXXXXXXXGKIDTSKYFVH--------TGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARK---------HKISGYW--LDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI-----------------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEE----TNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFICSK------YSPPIIFIDE----HMSYKIFINK------------VTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQT------ASLPSDKENNNC---LYS-SETLSGKWLGTSCVSK-NSVICYKPS----------KTIDTGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY-WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDK 3894
            F+  + ++ A   C+  G +LL I    +   IN ++  ++      T WI  ND+ T   + +SD+  + Y  W   +P+N   E+C       +G W +  C      +C K    + E                     Q   Y +     +++E+   C +    +V I ++   + I +  K  ++   WI  ND+  +  +  S G+ + + +W   EPNN+ +  EDC+   + P G WND  C      I +      +    E                 + E +V Y +A  LC   G  L+    R E   ++ ++Y     N  G+Y W    D+N  G F +  G  + Y ++   +P                GLW   +C S  +  +C +              P         +    DT   + +          + ++ +A   CQ    +L+++ + E +  + N+  K         H+   +W  L+  D +    W   DG    Y N+++   ++     C + +  A+ +W    C T+  +I                            E + F+   T+ +AQ  C      L  + ++      + N+   + + +   +WI  +    +G+F  ++   + +  +  G+P   G ++ CV+ +  S   W D  C +   +IC +        PP +           +  F+NK            V + EA   C+ +   L+ + N  + +FI  T SL     + WI    S+ D +W   + + L + NW        +  PS  +  +C   L+S S   +G+W   SC  + +  IC K +               G E+      + + +  + + +AL  C+ R   L  V +  T  +L + ++ L    +  L G +     +W+   ++ L +  W +G+   Q+   C   + DG WR  SCD K
Sbjct:  253 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-----STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQ-EVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIY-----NWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAVLD-LASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFS-RAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVY-MTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFI--TASLPNVTFDLWIGLHASQRDFQWV--EQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVS--EEPLNYVGWQDGEP--QQPGGCTYVDVDGAWRTTSCDTK 1237          

HSP 3 Score: 138.658 bits (348), Expect = 1.842e-31
Identity = 230/1170 (19.66%), Postives = 440/1170 (37.61%), Query Frame = 1
Query:  541 LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKES---------------KIEVLKKITVLNKELVIFK-ERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYK-----------NIGSR-GFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVH-GLYYKNGLWNDIKC-DYKNSVICSKDI------------------------LNSNETIKQQQKYYVHEVLV---TYEEAINFCNQHNCRIVKISNVE--------TNKIIYEWSKNMKIGR-FWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKT---------KNYLIYEYESTAE--------KEITIEIMEGKVNYIKALELCKSKGYDLIRIENE-EINKIVYDVA--TKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLC-----YKPFXXXXXXXXXXGKIDT------SKYFVHTG-----RVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFAN-------------GKWNDFSCSTK-NSFI------------------YYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSN--GFWNDIACNSK-NSFIC--SKYSPPIIFIDEHMS-----------------YKIFINKVT-YREAVDKCQSEGYSLIKV--ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASL-PSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYKP 3540
             Q   ++  A A C+ +G  L+ I +    + +  L   Y     WI  ND+   G +  SD   + Y  +   +P+N    E+C      S+  W +  C+ +   +C K+                K+E               + E+ ++ +++  C   G  LV I        +    ++  +   WI  ND++++  FE SD + + F+ W   EPNN+++  EDCV  ++     WND  C      IC K           + G R G+T    S     + E++V +  A+ LC ++G +L+ I    +   ++S+IY++  ++    +W    D+ +  +F +    ++ Y  W   +P  Y    CV        GLW    C  ++   IC + +                          S+  ++   K +  E L    ++ +A   C +   +++ +++ E         NKI  E    +     FWI  N     G   W  S G    Y N+ ++  ++ +   C   +   + +W  + C T         +   + E + + +        +E   +  E    + +A  +C     +L  + ++ E++ + +++   ++ +   +WI  +    +G+F ++DG  I++ ++A G+P     ++ CV+ +  +   W D  C +    +C      K  +         G   +      +K F   G     RV + EA   C+    +LVTI N  L+   +  +  +     W+  +  +++ +WV  +   L Y NW  GEP+  G      GN   +             G+W+D SC+ + + FI                      E         + ++ + + +A   C  +  SL  + +  T Q     A +      WI    +    ++   +   L Y  +  GEP   G      G  Y +  G W   +C++K    +C  S   PP   I  H S                 Y   +  +  ++EA  +CQ  G +++ +  E  ++    H  S   +    W+    +   G   + D   + + NW    L PS   +N+C Y  ++ SG W   +C +    V+C  P
Sbjct:  253 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDN-PSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSC--YWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPG-YSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAVLDLA-SLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVY-MTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNP-LEQAFITASLPNVTFDLWIGLHASQRDFQWVEQE--PLMYANWAPGEPS--GPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYT-QAFLTQAARGLRTPLWIGLAGEEGSRRYSWVSEEPLNYVGWQDGEPQQPG------GCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSC-YWIQSNSGLWRPGACTNITMGVVCKLP 1396          

HSP 4 Score: 136.732 bits (343), Expect = 7.045e-31
Identity = 180/866 (20.79%), Postives = 340/866 (39.26%), Query Frame = 1
Query: 1711 VTYEEAINFCNQHNCRIVKISNVE----TNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITI-----------------------EIMEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKI-------DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCST-KNSFIYYYIENIISTKEL--------------------------------EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKI-GQ----------YWIDANDKAVEG--KFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC-------------SKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLS--LRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKY-------YIHRIGVTFQ-------------EALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ-------KTQNC--LQGNPD----GKWRDVSCDDKNPFFF 3909
            +++ EA   C Q    ++ I+ +      N ++  +S  +     WI  ND+ T G W  S  + L YLNW  ++P+N + E+C       +G W +  C      + + +  A  E T                         +   K ++ ++ + C   G DL+ I +  E+  I   +  K +V + WI  ND+ ++  F +SDG  +S+ ++   EPNN  +  EDCV  ++   G WND  CN     +C K  +  +   +E+            S Y++   +VTY EA R C  H  +LVTI N      + +L    +   +W    D+   G +  + G+++ Y +WN+ +P  Y    C+ L    A G W   +C++ +  +I         T EL                                E  +++ ++ +AQ  C + G  L+ + + E    + ++   NKI G+          +WI  N +   G   +  S+     Y  F R   ++     C   L  ++  W  + C+++  +IC             S          +   YK F +  T+ +A   C      L  V + +++ F+ H L    R +  ++WI    S++DG++ ++DG  + F +W         ++  C+Y + +    W    C++    IC + + T +T      T         +I  +   FQ             EA   C+++  +L+ + N     ++      ++ +  W+  +    +  W+  +++ L + NW  G+ +         K  +C  +  +P     G+W D SC ++   F 
Sbjct:  257 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTL-----WIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQI--KQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQP-GYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANML--NKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAV-LDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASRE-DWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFD-LWIGLHASQRDFQWV--EQEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFI 1106          

HSP 5 Score: 85.8853 bits (211), Expect = 2.336e-15
Identity = 111/577 (19.24%), Postives = 212/577 (36.74%), Query Frame = 1
Query:  124 IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDD------QFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVIC-----YKNTQPK----------TSHVIKLLNRELII----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ------KNEHCVHGLYYSNA----LWNDISCAD-SNAVICYKESKIEVL-----------KKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCED-LNAVIC--------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLL---------CKNNGYELLKIDSDEINSMIYDFAVKHNIGT--YWIDANDIQTENTFVYSDSKKISYQKWYPG--EPNNYENEDCVHGLYYKNGLWNDIKC-DYKNSVIC 1641
            +  Q      F+  +T+ +A ++C      L  +           N Q ++ A + H   +WI  +  + +G F + +G  I +  +A G+P    +++ CV+    ++  W D  C      IC      K TQP            S  I+ LN+   +     Q +  +  A   C+ +  QL+ I +  L       ++       WI  +  Q +  ++  +   ++Y  +APGEP+         K   C   L+  +A     W+D SC + ++  IC K +   +             +++ LN    + ++ L ++ A  LC+S+   L  + D  +       A +      WI          +    +  + +  W  GEP   Q   C +     +  W    C+  L   +C         + I   G     +++   + F E     H +LL         C+  G  +L I  +  N  +++    +   +   W+  N      T V+ D+  ++Y  W P    P+   +  C + +   +GLW    C +    V+C
Sbjct:  830 LRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQH---WWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASRED-WGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNP-LEQAFITASLPNVTFDLWIGLHASQRDFQWVEQE--PLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDP-YTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVSEEPLNYVGWQDGEPQ--QPGGCTY--VDVDGAWRTTSCDTKLQGAVCGVSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSC-YWIQSNSGLWRPGACTNITMGVVC 1393          
BLAST of Mannose-binding protein C vs. UniProt/SwissProt
Match: sp|Q64449|MRC2_MOUSE (C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3)

HSP 1 Score: 135.576 bits (340), Expect = 1.343e-30
Identity = 197/1007 (19.56%), Postives = 374/1007 (37.14%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIK------------------QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE-----------------IMEGKVNYIKALELCKSKGYDLI----RIENEEINKIVYDVATKNKVGQY-WINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKY-------------FVHTGRV----------TYEEALRFCQIHSCRLVTIENSELDILILNLARK---------HKISGYW--LDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI-----------------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEE----TNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFICSKYS----------PPIIFIDEHMSYKIFINK------------VTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQT------ASLPSDKENNNC---LYS-SETLSGKWLGTSCVSK-NSVICYK---PSKTIDTGKEVKKTKYYIHRIGVTFQ---------EALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDK 3894
            F+  + ++ A   C+  G +LL I    +   IN ++  ++      T WI  ND+ T   + +SD+  + Y  W   +P+N   E+C       +G W +  C      +C K    + E I+                  Q   Y +     +++E+   C +    ++ I ++   + I +  K  ++   WI  ND+  +  +  S G+ + + +W   EPNN+ +  EDC+   + P G WND  C      I +      +    E                 + E +V Y  A  LC   G  L+    R E   ++ ++Y     N  G+Y W    D+N  G F +  G  + Y ++   +P  +             GLW   +C S  +    +         +  G   T                  H  +V          ++ +AL  C+    +L+++ + E +  + ++  K         H+   +W  L+  D ++   W   DG    Y N+ +   ++     C + +  A+ +W    C T+  +I      +                     E + F+   ++ +AQ  C      L  + ++       QN+  L+  ++   +WI  +    +G+F  ++   + +  +  G+P   G ++ CV+ +      W D  C++   +IC + +          PP         +  F+NK            V + EA   C+ +   L+ + N  + +FI  T SL     + WI    S+ D +W   + + L + NW        +  PS  +  +C   L+S S   +G+W   SC  + +  IC K   PS +             +  +  TF+         +AL  C+ R   L  V +  T  +L + ++ L     W+    ++    +    ++ L + +W + +   Q +  C   + DG WR  SCD K
Sbjct:  252 FQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-----STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQ-EVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIY-----NWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAVLD-LASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLS-SDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFI--TASLPNVTFDLWIGLHASQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQT-PLWIGLASEEGSRRYSWLSEEPLNYVSWQDEEP--QHSGGCAYVDVDGTWRTTSCDTK 1236          

HSP 2 Score: 134.035 bits (336), Expect = 4.881e-30
Identity = 226/1166 (19.38%), Postives = 422/1166 (36.19%), Query Frame = 1
Query:  136 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT-----------------------QPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYSNALWNDISCADSNAVICYKESKIE---------VLKKITVLNKELVIFKE-RLTYYKAQDLCKSQGYKLVKIDD--EQ--FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA--LWNDIKCEDLNA-VICYKNIGSRGFTKFEISNKEIVI-------------------------FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVK---------HNIGTYWIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHG---LYYKNGLWNDIKCDYKNSVIC---------SKDILNSN--ETIK-QQQKYYVHEVLVTYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSK--NMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKE-------------------------ITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE-------DCVHGLF----YTNGLWNDISCN-SINSVLCYK---PFXXXXXXXXXXGKIDTSKYFVHTGR-----VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE---------------IFKER---------VTFEEAQNTCIKKGWSLVRIDNEETNQNIYD--LAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKF-PRGEPNNYGNEDCVHGLYYSNGFWNDIACN 3129
            S Y   FQ   ++ EA   C+ +G +L+ I +    T +  L   Y +   WI  ND+   G +++ +   +KY  +   +P+N   E+C        G W +  C      +C K                         QP   H  +L         EK +++ +   C   G  L+ I        +    ++ ++   WI  ND++ + NF  SDG  + +  + P EPNN++ + E CV  ++     WND  C  S   IC K  ++            K  T  +       E ++ Y  A+ LC   G +LV I +  EQ   +S++YN+  +     +W    D+   G+F     +++ ++ W   +P  Y+   CV  L   +A  LW    C    A  IC +++G+    +    +    +                          +EK  +  A  +C+  G +LL + S E    +     K         H    +WI  N  D +  +++ +SD    SY  +      +  ++D + G   L   +  W  ++C  +   IC           DI      E ++ Q+ +Y   E   ++ +A   C      +  + S  E + +     K  + +   +WI  + + ++G++  + G+ + +++WA  +P     +           +W D  C T   Y+     S+ E +                         I  +  + +V + +A   C+ +   L+ I N  + +     +  N     WI  +    + Q+I  + + + Y N+A GEP+  +          C   L     +  G W+D SC    +  +C K   P                  Y  HT R     + +++AL  C+  +  L  + +      +   AR  +    W+     +    +  +    L Y++W   EP + G   C   +   +G W   SC TK       +      + +                 F+E          +  +EA   C K G +++ I +E  N  +++     + +    W+  N     G  V  +N A+ YS + P G   +  + +  + +  S+G W   AC 
Sbjct:  246 SCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGY-SSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQ-------AEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCV-ALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFA----RSRHDDDDIRGCAVLDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIAN-PLEQAFITASLPNVTFDLWIGLHASQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQTP-LWIGLASEEGSRRYSWLSEEPLNYVSWQDEEPQHSGG--CAYVD--VDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPGACT 1383          

HSP 3 Score: 112.079 bits (279), Expect = 2.484e-23
Identity = 177/875 (20.23%), Postives = 332/875 (37.94%), Query Frame = 1
Query: 1711 VTYEEAINFCNQHNCRIVKISNVE----TNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISC---------KTKNYLIYEYESTAEKEITIE--------------IMEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKI-------DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCST-KNSFIYYYIENIISTKEL--------------------------------EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKI-GQ----------YWIDANDK-AVEG-KFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDE---------------HMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVN-----YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIG------------------------VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ-------KTQNC--LQGNPD----GKWRDVSCDDKNPFFF 3909
            +++ EA   C Q    ++ I+ +      N ++  +S  +     WI  ND+ T G W  S  + L YLNW  ++P+N   E+C       +G W +  C         K  N  +   +      + +E              +   K ++ ++   C   G DL+ I +  E+  I   +  K +V + WI  ND+ ++  F +SDG  +S+ ++   EPNN  +  EDCV  ++   G WND  CN     +C K  +  +   +E+            S Y++   +V Y +A R C  H  +LVTI N      + +L    +   +W    D+   G +  + G+++ Y +WN+ +P  Y    C+ L    A G W   +C++ +  +I         T EL                                E  +E+ ++ +A   C + G  L+ + + E    +  +   NKI G+          +WI  N +   EG  +  S+     Y  F R   ++     C   L  ++  W  + C ++  +IC    P  + + E                  YK F +  ++ +A   C      L  V + +++ F+   L    KL +     +WI     ++DG++ ++DG  + F +W         ++  C+Y +      W    C +    IC    K  ++  E +        +G                        V + EA   C+++  +L+ + N     ++      ++ +  W+  +    +  WI  +++ L + NW  G+ +         K  +C  +  +P     G+W D SC ++   F 
Sbjct:  256 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTL-----WIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQI--KQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP-GYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHML--NKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAV-LDLASLQWVPMQCQTQLDWICKI--PRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQ---KLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTARQE-DWGDQRCHTALPYIC----KRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFD-LWIGLHASQRDFQWI--EQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFI 1105          

HSP 4 Score: 90.1225 bits (222), Expect = 1.317e-16
Identity = 89/413 (21.55%), Postives = 165/413 (39.95%), Query Frame = 1
Query: 2440 DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIY-----YYIENIISTK----------ELEIFK--------ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN--EDCVHGLYYSNGFWNDIACNSKNSFICSK---------------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYK 3537
            D+   F     +++ EA   C+     L++I        I  L   +  S  W+  ND+   G W   D + LKYLNW   +P+N G E+C +    ++G W +  CS    ++        +E I   +            + F+        E+ +++E++  C++ G  L+ I +    + I    +K ++ + WI  ND  ++  F  S+   + ++ +   EPNN+ +  EDCV  ++   G WND  CN     IC K                     +SP   ++ E        ++V Y +A   C   G  L+ + N      V +L   ++   +W    D  + G + +  G ++ + +W     P  +       ++ +  G W   +C S +   IC +
Sbjct:  245 DSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYS-STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGE--------DQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQ-PGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQ 645          

HSP 5 Score: 87.0409 bits (214), Expect = 1.073e-15
Identity = 131/622 (21.06%), Postives = 239/622 (38.42%), Query Frame = 1
Query:   55 DFSCEDPSAVICYKETEPKISAE-----IELQSKYVIIFQEKTTFTEANKLC------------QAK----GYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-----TQPK----------TSHVIKLLNRELII----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ------KNEHCVHGLYYSNA----LWNDISCA-DSNAVICYKESKIEV-----------LKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNY---QNEDCVH--GLYY--KNALWNDIKCED-LNAVIC-------YKNIGSRGFTKFEISNKEIVIFEE-------KVVFKHAQLL--CKNNGYELLKIDSDEINSMIYDF---AVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPG--EPNNYENEDCVHGLYYKNGLWNDIKC-DYKNSVIC 1641
            D+ C+ P  V      EP I  +     +  Q      F+  +++ +A ++C            QA+    G NL K+  DQ          + H   +WI  + ++ +G F + +G  I +  +A G+P    +++ CV+ M  +   W D  C      IC ++     TQP+           S   + LN+   I     Q++  +  A   C+ +  QL+ I +  L       ++       WI  +  Q +  +I  +   ++Y  +APGEP+         K   C   L+  +A     W+D SC  +++  IC K +   +             +++ LN    + ++ L +  A  LC+S+   L  + D  +       A +      WI             S++   ++S W + EP NY   Q+E+  H  G  Y   +  W    C+  L   +C        + I  RG     +++   + F E       +V+  H + L  C+  G  +L I  +  N  +++    A   + G  W+  N      T V+ D+  ++Y  W P    P+   +  C + +   +GLW    C +    V+C
Sbjct:  804 DWICKIPRGV---DVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQ----------EQH---WWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICKRSNSSGETQPQDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANP-LEQAFITASLPNVTFDLWIGLHASQRDFQWIEQE--PLLYTNWAPGEPSGPSPAPSGTKPTSCAVILHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQKPLRWKDALLLCESRNASLAHVPDP-YTQAFLTQAARGLQTPLWIGLA----------SEEGSRRYS-WLSEEPLNYVSWQDEEPQHSGGCAYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCPQGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAEAQSRGA-WLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSC-YWIQSSSGLWRPGACTNITMGVVC 1391          
BLAST of Mannose-binding protein C vs. TrEMBL
Match: Q8WSX2 (Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN=lec1 PE=2 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 3.044e-173
Identity = 344/1106 (31.10%), Postives = 567/1106 (51.27%), Query Frame = 1
Query:  454 DDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV-IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ-NEDCVHGLYYKNALWNDIKCEDLNAVIC-------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICS---KDILNSNETIKQ--------QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYN-NEDCLEGNFYPNGEWNDISCKTKNYLIYEY---------ESTAEKEITIEIME--------GKV-----------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQN-NEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXX-------------XGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEE--TNQNIYDLAVKNKI-GQYWI--DANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPS 3543
            D  NSVIC     PK +      N    +   K T  +A  +CK +   L++I +  +N +V+NLA +  +GRYWI+ ND + EG ++ ++ +++ Y+ +  GEPNN+  ++HC+ G Y+ N  W+D +C   N+VIC      EV K     N E   +   ++T+  A   CK +   LV+I +   N IV+N A +NN+GRYWI+ ND   EGT+  ++  ++ +  W AGEPNN+  ++ C+ G+Y+ N  W+D  C+  NAVIC             Y+   S G    ++  +   +   K  F  A   CK+   +L++I + + N  +Y+ AVK+ IG YWI+ ND + E T+VY+++K+++Y+ W  GEPNN   ++ C+ G YY NG W+D  CD KN V+C     D  +SNE  ++        ++ Y V+   +T+++A+ +C  +   +VKI+N   N  +Y  +   KIGR+WINGND   EG WVD+   +L Y NW   EPNN   ++ C+ G +YPNG W+D +C TKN +I E          ++    ++T +  E        GKV            +  A++ CK K  DL+RI N + NK VY++A K K+G+YWIN ND   EG ++ ++ + ++Y+N+  GEPNN   ++ C+ G +Y NG W+D +C++ N V+C     +      +             EGK+ +  Y ++  ++ +++A+++C+     +V I N+E++  +  L+ K+ +  YW++GND   +G WV+ +  +L Y NW +GEPNN G  + C+ G Y+++G W+D +C  K S I             E  K + +  +  +T    G  ++  DNE   T + + D   ++   GQ  I  D +DK  E         AL Y K+                                   + +K S   +      SY +   K+ + +AV  C+ +   L+K+ N +++ +V   + +Y L  YW++G D   +G W  +D   LT+KNW T    ++  N +CL  S  L+G W  + C   NSV+C + S
Sbjct:    1 DTKNSVIC---EVPKDTDNDN--NEGYHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVIC------EVPKDTDNDNNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTG----KVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVI------------CESRKSKDSSGKG-DTDANNGLYVIIKDNEGKGTGKLVIDKGTEDSTNGQILIIRDKDDKGSE---------ALNYGKY-----------------------------------VITKESETKVV---STSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVCVRIS 1031          

HSP 2 Score: 534.258 bits (1375), Expect = 2.505e-166
Identity = 326/1001 (32.57%), Postives = 534/1001 (53.35%), Query Frame = 1
Query: 1327 KVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVIC--SKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYN-NEDCLEGNFYPNGEWNDISCKTKNYLI------------YEYESTAEKEITIE----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQN-NEDCVHGLFYTNGLWNDISCNSINSVLC------YKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYG-NEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL------------EIFKER----------------VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFIC--------------SKYSPPIIFIDEH-----MSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQT-------------------------------------------ASLPSDKENNNCLY-----SSETLSGKWL---GTSCVSKNSVICY-----KPSKTIDTGK---------EVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ-KTQNCLQG--NPDGKWRDVSCDDKN 3897
            K+    A   CK+   +L++I + ++N ++++ A K+N+G YWI+ ND + E T+VY+++++++Y+ W  GEPNN+  ++ C+ G Y+ NG W+D  CD KNSVIC   KD  N N      + Y++    +T+++A+ +C      +V+I N   N I++  +    +GR+WINGND   EG WV +   +L Y NW   EPNN+  ++ C+ G ++PNG W+D +C TKN +I             EYE T      ++    +   K  +  A++ CKS+  DL+RI N + N+ VY++A K K+G+YWIN ND   EG ++Y++ + ++Y+N+  GEPNN   ++ C+ G +Y NG W+D +C++ N V+C           E+ +E    GK+    Y V+  ++T+++A+++C+ +   LV I N+  +  + NLA K+KI  YW++GND  KEG WV+ +  +L Y NW  GEPNN G ++ C++G Y+ NG W+DF+C TKN+ I   ++    T E             E ++E+                 TF++A   C  K   LVRI N + N+ +Y+LAVK KIG+YWI+ ND+  EG +VD+NN  L Y  +  GEPNN G ++ C+ G YY NGFW+D  C++KN  IC              +  S  +IF D       ++Y+I   K+ + +AV  C+ +   ++++ N++I+  V  LS +Y L  YWI+G D   DG W  ++ ++L +KNWQ                                            +S   D + NN LY     +    +GK +   GT   +   ++       K S+ ++ GK         +V  T Y++    + F +A+ +CK+++  L+ + N + N  +++ + K ++E YWLNGND+  EG W+D+D   LT+ NW+ G+ N     ++CLQG  N +G W    C+  N
Sbjct:   28 KMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDNDN-----NEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKDSSGKGDTDANNGLYVIIKDNEGKGTGKLVIDKGTEDSTNGQILIIRDKDDKGSEALNYGKYVITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLN 1023          

HSP 3 Score: 495.738 bits (1275), Expect = 9.916e-152
Identity = 278/815 (34.11%), Postives = 449/815 (55.09%), Query Frame = 1
Query:  163 KTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVIC---------YKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNY-QNEDCVHGLYYKNALWNDIKCEDLNAVIC-------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY-ENEDCVHGLYYKNGLWNDIKCDYKNSVIC----------------SKDILNSNETIKQQ-------QKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY-NNEDCLEGNFYPNGEWNDISCKTKNYLIYE---------------------YESTAEKEITI--EIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFYTNGLWNDISCNSINSVLC 2388
            K T  +A K C+ +  +L++I +   N  V+NLA + + GR+WI+ ND + EGT+ Y N + + Y  +  GEPNN+  ++ C+ G ++ +GFW+D +CD  NSVIC     PK +      N    +   K T+++A+ +CK +   L++I ++ +N +V+NLA +  +GRYWI+ ND + EG ++ ++ +++ Y+ +  GEPNN+  ++HC+ G+Y+ N  W+D +C   NAVIC           E   E      V+ +   +   + T+  A   CKSQ   LV+I +   N  VYN AV+  IGRYWI+ ND   EGT+  ++  ++ +  W +GEPNN   ++ C+ G YY N  W+D  C+  N V+C             Y+   S G    ++  +   +   K+ F  A   CK+N  +L+KI +   N  +Y+ AVK+ IG YWI+ ND   E T+V +++K+++Y+ W  GEPNN   ++ C+ G YY NG W+D  CD KN+VIC                 K   +SNE  +++       ++ Y      T+++A+ +C      +V+I+N + NK +Y  +   KIGR+WINGND   EG WVD+   +L Y NW   EPNN   ++ C+ G +YPNG W+D +C TKN +I E                     ++    K I+I  +I   K+N+  A++ CK K  D++RI N EIN  V+ ++ K  +G+YWIN ND  V+G ++ ++ + + Y+N+  GEPNN    + C+ G +Y++G W+DI+C+   SV+C
Sbjct:   28 KMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVIC---EVPKDTDNDN--NEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTG----KVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVIC 833          

HSP 4 Score: 478.404 bits (1230), Expect = 2.479e-145
Identity = 278/833 (33.37%), Postives = 459/833 (55.10%), Query Frame = 1
Query: 1618 DYKNSVIC--SKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY-NNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEG--KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLC------YKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFIYYYI-----------ENIISTKEL-----EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPI-----------IFIDEHMSYK-------------IFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVIC--YKPSKTIDTGK---------------EVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKV-NIQKTQNCLQGN--PDGKWRDVSCDDK 3894
            D KNSVIC   KD  N N      + Y++    +T  +A  +C      +V+I N + N I++  +    +GR+WINGND   EG WV +   +L Y NW   EPNN+  ++ C+ G ++PNG W+D +C TKN +I E     + +       G  K+ +  A++ CK +  DL+RI N  +N IV+++A KN +G+YWIN ND   EG ++Y++ + ++Y+N+  GEPNN   ++ C+ G+++ NG W+D +C++ N+V+C           E+ +E    GK+    Y V   + T+++A+++C+     LV I N++ +  + NLA K+KI  YW++GND +KEG WV  +  +L Y NW  GEPNN  G++ C++G Y+ NG W+DF+C TKN  +   +           E   ST ++      +   ++TF++A   C      LV+I N   N  +Y+LAVK KIG+YWI+ ND+A EG +VD+NN  L Y  +  GEPNN  G++ C+ G YY NGFW+D  C++KN+ IC                  +  D +  Y+                N  T+ +AV  C+ +   L+++ N+D +  V+ L+++YK+  YWI+G D + +G W  ++ ++LT+KNWQ+    +   + +C+  +   +G W   +C +KN VIC   +      +GK               +V    Y I+   + F +A+ +CK+++  ++ + N + N ++++LS+K  + KYW+NGND+  +G W+D++ K+L + NW  G+  N    Q+C+QG    DG W D++CD K
Sbjct:    1 DTKNSVICEVPKDTDNDN-----NEGYHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDNDNNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVK 828          

HSP 5 Score: 449.899 bits (1156), Expect = 1.145e-134
Identity = 248/739 (33.56%), Postives = 401/739 (54.26%), Query Frame = 1
Query:   10 EHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVIC---------YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVIC---------YKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNY-QNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIV-----IFEEK----------------VVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY-ENEDCVHGLYYKNGLWNDIKCDYKNSVIC-----------SKDILNSNETIKQQQK-------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAE 2043
            +HC+ G Y+PN  W+DF+C+  ++VIC     PK +     +  +  +   K TF +A K C+ +  +L++I ++  N  V+NLA + + GR+WI+ ND + EGT+ Y N + + Y  +  GEPNN+  ++ C+ G+++ +GFW+D +CD  N+VIC               +T    K++ R   +   K T+++A+ +CKS+   L++I +   N  VYNLAV+Y+IGRYWI+ ND + EG ++ ++ K++ Y+ +  GEPNN   ++HC+ G YY N  W+D +C   N V+C           E   E      V+ +   +   ++T+  A   CK     LVKI +   N  VYN AV+  IGRYWI+ ND   EGT+ D++  ++ +  W +GEPNN   ++ C+ G YY N  W+D  C+  NAVIC    G  G  +    N ++       +EEK                  F  A   CK+   +L++I + + N  +Y+ AVK+ IG YWI+ ND + E T+V +++K+++Y+ W  GEPNN   ++ C+ G YY NG W+D  CD KN VIC            K   +SN  I +  +       Y ++   + +++A+ +C      +V+ISN E N  +++ S+   +G++WINGND   +G WVD+   +L Y NW K EPNN    + C++G +Y +G W+DI+C  K  +I E   + +
Sbjct:  107 QHCILGAYFPNGFWDDFNCDTKNSVIC---EVPKDTDNDNNEGYH--MGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKD 840          

HSP 6 Score: 406.371 bits (1043), Expect = 1.110e-118
Identity = 227/667 (34.03%), Postives = 378/667 (56.67%), Query Frame = 1
Query: 2092 ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYG-NEDCLLGNYFANGKWNDFSCSTKNSFI--------------YYYIENI--ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEH------------MSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVIC--YKPSKTID----------------------TGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNCLQGN--PDGKWRDVSCDDKNPFFFEFI 3918
            A + CK +  DL+RI N+++N IV+++A KN +G+YWIN ND   EG ++Y++ + ++Y+N+  GEPNN   ++ C+ G ++ NG W+D +C++ NSV+C  P   D D        +   Y +   ++T+++A+++C+     LV I N+ +++++ NLA K+ +  YW++GND +KEG WV  +  +L Y NW  GEPNN+G ++ C+LG YF NG W+DF+C TKN+ I              Y   ++   +  +   +   + TF++A   C  +   LVRI N + N+ +Y+LAVK KIG+YWI+ NDK  EG +V +NN  L Y  +  GEPNN G ++ C+ G YY NGFW+D  C++KN  +C          +E              +Y++   K+T+ +AV  C+     L+K+ N++ +  V+ L+++YK+  YWI+G D   +G W  ++ ++LT+KNWQ+    +   + +C+  +   +G W   +C +KN+VIC   K     D                       GK VK+   Y      TF +A+ +CK+++  L+ + N D N +++ L+ K  I +YW+NGND++ EG W+D++ K+LT+ NW +G+ N    +Q+C+ G   P+G W D +CD KN    E +
Sbjct:   34 AAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDND--------NNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRN--YRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELV 690          

HSP 7 Score: 399.053 bits (1024), Expect = 4.095e-116
Identity = 250/801 (31.21%), Postives = 395/801 (49.31%), Query Frame = 1
Query:   10 EHCVHGLYYPNALWNDFSCEDPSAVIC-------------YKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVIC---------YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVIC-------------------YKESKIEVLKKITVLNKELVIFKERL----TYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNY-QNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFE-ISNKEIVIFEE---------------KVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVIC----SKDILNSNETIKQQQKYYV-----------------------HEVLVTYE------EAINF---------------------------------CNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEP-NNYNNEDCLEGNFYPNGEWNDISCKTKNYLI 2019
            +HC+ G+Y+PN  W+DF+C+  +AVIC             Y+ET+    +  ++  +   +   K TF +A K C+++  +L++I +   N  VYNLA++Y  GR+WI+ ND + EGT+ Y N + + Y  +  GEPNN   ++ C+ G +Y +GFW+D +CD  N V+C               +T    K++ R   +   K T+++A+ +CK     L+KI +   N  VYNLAV+Y+IGRYWI+ ND   EG ++ ++ K++ Y+ +  GEPNN   ++HC+ G YY N  W+D +C   NAVIC                    ++S  E  +K    N ++V    R+    T+  A   CK +   LV+I +   N  VYN AV+  IGRYWI+ ND   EGT+ D++  ++ +  W +GEPNN   ++ C+ G YY N  W+D  C+  N VIC    G  G    +   +   VIF++               K+ F  A   CK+   ++++I + EIN+ ++  + K+ +G YWI+ ND   + T+V +++K++ Y+ W  GEPNN    + C+ G YY +G W+DI CD K SVIC    SKD     +T      Y +                        ++L+  +      EA+N+                                 C      +VKI N E N ++++ +    +  +W+NGND   EG WVD+  N L Y NW+  EP NN  N+ CL+G+   NG W    C   N ++
Sbjct:  232 QHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETD----STGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDN--NGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKDSSGKGDTDANNGLYVIIKDNEGKGTGKLVIDKGTEDSTNGQILIIRDKDDKGSEALNYGKYVITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVV 1026          

HSP 8 Score: 333.954 bits (855), Expect = 7.383e-93
Identity = 184/545 (33.76%), Postives = 313/545 (57.43%), Query Frame = 1
Query: 2374 NSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYG-NEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIIS--TKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEH------------MSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVIC-----------YKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKV-NIQKTQNCLQGN--PDGKWRDVSCDDKNPFFFEFI 3918
            NSV+C  P   D D        +   Y +   ++T  +A ++C+     LV I N ++++++ NLA K+ +  YW++GND +KEG WV  +  +L Y NW  GEPNN+G ++ C+LG YF NG W+DF+C TKNS I    ++  +   +   +   ++TF++A   C  +   LVRI N   N  +++LA KN +G+YWI+ ND+  EG +V +NN  L Y  +  GEPNN+G ++ C+ G+Y+ NGFW+D  C++KN+ IC          +E              +Y++   K T+ +AV  C+S+   L+++ N+D +  V+ L+++YK+  YWI+G D + +G W +++ ++LT+KNWQ+    +   + +C+  +   +G W   +C +KN V+C            +  +T  TGK VK+  Y ++   +TF +A+ +CK+ +  L+ + N + N +++ L+ K  I +YW+NGND+  EG W+D++ K+LT+ NW +G+  N   +Q+C+ G   P+G W D +CD KN    E +
Sbjct:    4 NSVICEVPKDTDND--------NNEGYHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDNDNNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRN-YRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELV 539          

HSP 9 Score: 313.923 bits (803), Expect = 7.958e-86
Identity = 196/663 (29.56%), Postives = 322/663 (48.57%), Query Frame = 1
Query:   10 EHCVHGLYYPNALWNDFSCEDPSAVIC-------------YKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICY----------------KNTQPKTSHVIKLLNRELII-----LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVIC-YKESKIEVLKKITVLNKELVIFKE---------------RLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKNALWNDIKCEDLNAVIC-----------------------YKNIGSRGFTKFEI-------SNKEIVIF----------------------EEKVV------------FKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEP-NNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSK 1647
            +HC+ G YYPN  W+DF+C+  + V+C             Y+ET+    +  ++  +   +   K TF +A K C+    +L+KI +   N  VYNLA++Y  GR+WI+ ND   EGT+   N + + Y  +  GEPNN   ++ C+ G +Y +GFW+D +CD  N+VIC                 K T+       +  N   ++     +    T+++A+ +CK K   L++I +   N  VYNLAV+Y+IGRYWI+ ND + EG ++ ++ K++ Y+ +  GEPNN   ++HC+ G YY N  W+D +C   N VIC                +   VIFK+               ++ +  A   CK +   +V+I + + N+ V+  + +  +G+YWI+ ND  ++GT+ D++  ++ +  W  GEPNN    + C+ G YY +  W+DI C+   +VIC                        K+   +G  K  I       +N +I+I                       E KVV            F  A   CK+   +L+KI ++E+N++++  A K+N+ TYW++ ND   E T+V +D+  ++Y+ W  GEP NN  N+ C+ G    NG W    C+  NSV+C +
Sbjct:  371 QHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETD----STGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKDSSGKGDTDANNGLYVIIKDNEGKGTGKLVIDKGTEDSTNGQILIIRDKDDKGSEALNYGKYVITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVCVR 1029          

HSP 10 Score: 90.1225 bits (222), Expect = 2.696e-14
Identity = 48/137 (35.04%), Postives = 81/137 (59.12%), Query Frame = 1
Query: 3511 SKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKV-NIQKTQNCLQGN--PDGKWRDVSCDDKNPFFFE 3912
            +KNSVIC  P  T +   E     Y++    +T  +A  +CK+R+  L+ + N D N+ ++ L+ K ++ +YW+NGND++ EG W+ ++ ++LT+ NW  G+  N   +Q+C+ G   P+G W D +CD KN    E
Sbjct:    2 TKNSVICEVPKDTDNDNNE----GYHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICE 134          
BLAST of Mannose-binding protein C vs. TrEMBL
Match: Q8WSX1 (Lectin 2a OS=Girardia tigrina OX=6162 GN=lec2a PE=4 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 3.322e-109
Identity = 203/628 (32.32%), Postives = 337/628 (53.66%), Query Frame = 1
Query:  532 LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKE-SKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNS-VICSKDILNSNETIKQQQKYYVHEVLV-----TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI-YEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCY 2391
            L + +   TY  AI  CK++G  L+++   + N++V   A +     YW+D ND  NEG ++ + G ++ Y+ FAP EPN   KNE+C+  +Y  N +WND++C      IC ++ S++ +  +I +    L+I + ++T+  AQ+ C ++G ++VKI     N++V+++A +     YWIDAND+  E  + D+D  ++    +  GEPN  + E+C HG    + LWN   C      ICY+     G T        I+   E++ F  AQ  CK  G ++ K D+   N MI+ F+ +  +  YW+D ND + E  +V SD   + ++ +YPGEPN   NE+C++G    +GLWND  C YKN   +C KD L       +  +Y V+ +++     TY EA+ +C     ++V++ +  +  I+  ++K +    +WI+GND  TEG WVD+ G  + Y NWA NEPN    E+C+  +    G W DI+C  K   +     S  E+ +       K+ +  A++ C S G ++I I+++  N ++   A K  +G +WI+ ND   EG+++      +S++NF  GEP+      C+  L   +G W D  C+S+NSV+CY
Sbjct:   26 LFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNG-NKNENCLM-VYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYR----EGETNNGPDPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTM--PYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTVDYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSL--PSGYWIDSKCDSLNSVICY 643          

HSP 2 Score: 337.035 bits (863), Expect = 1.792e-97
Identity = 196/635 (30.87%), Postives = 327/635 (51.50%), Query Frame = 1
Query:  127 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYK-DGFWNDISCDDTNSVICYKN-TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNA-VICYKNIGSRGFTK-FEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI 2019
            ++ +  + + +   T+ EA + C+A+G  L+++   + NT V   A +  A  +W+D ND   EGT+    G ++ Y  FA  EPN  +NE+C+  M Y+ +G WND++C      IC ++ +Q    + I++    LII + K T+ +A   C ++G +++KI     N++V++ A +     YWIDAND+ NE  ++ +DGK++V++ F PGEPN   + E+C HG    + LWN   C      ICY+E +             ++   ERLT+ +AQD CK  G K+ K D+   N +++ ++ +  +  YW+D ND + EG + DSD   +K   +  GEPN   NE+C++G    + LWND  C   N   +CYK+  +  + +  E     ++I  E+  +  A   C+  G +L+++ S     ++  +  K     YWID ND  TE T+V ++ + ++Y+ W   EPN    E+C+       G W DI C  K   +C  D      T+     Y+     +T++ A+ +CN     I+ I +   N +I   +K + +G  WI+GND   EGKWV+ K  +L + N+   EP+      CL+    P+G W D  C + N +I
Sbjct:   20 DIDANTLFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCL--MVYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNG-GRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNT----IIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTV----DYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQS--LPSGYWIDSKCDSLNSVI 641          

HSP 3 Score: 336.65 bits (862), Expect = 2.421e-97
Identity = 207/636 (32.55%), Postives = 326/636 (51.26%), Query Frame = 1
Query: 1693 YVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTA---EKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENII---------STKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC-SKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSK 3546
            +V +V+VTY EAI  C      +V++++ E N I+  ++  +    +W++GND   EG WVD++GN+L Y N+A +EPN   NE+CL   +  NG WND++C  + + I + + +      +I IE     I  GK+ +  A E C ++G  +++I +   N +V+  A +     YWI+ANDI  E +++ +DG+ + ++NF  GEPN    E+C HG    +GLWN   CN     +CY+       E +     D +       R+T+ EA  +C+    ++   +N+  + +I   +R+  +  YWLDGND K+EG+WV+ D   LK+  +  GEPN   NE+C+ G    +G WNDF C+ KN F   Y + +              L I  ER T+ EA   C  +G  LVR+ +  +   +     K     YWID ND   EG +VD+N   + Y  +   EPN    E+C+       G W DIAC +K   +C +  S     +D H S      K+T+  AV  C S G ++I +++ + + ++   + +  L  +WIDG D+  +GKW      +L+FKN+ +   PS     +CL S    SG W+ + C S NSVICY   K
Sbjct:   27 FVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYR-------EGETNNGPDPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTVDYHFSRT----KLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGE-PSGGRERSCLQSLP--SGYWIDSKCDSLNSVICYGSVK 647          

HSP 4 Score: 326.25 bits (835), Expect = 1.620e-93
Identity = 193/623 (30.98%), Postives = 323/623 (51.85%), Query Frame = 1
Query: 2053 TIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYY---IENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSF-ICSKYSPPIIFIDEHM----SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKN 3897
            T+ + +  V Y +A++ CK++G  L+R+ + E N IV   A K     YW++ ND   EG ++ + G  + Y+NFA  EPN   NE+C+  ++  NG+WND++C +    +C +   +     +   +I+ S   +  G++T+ +A  FC     R+V I ++  + ++ + AR+     YW+D NDI  E +WV+ DG +L + N++ GEPN    E+C  G    +G WN F C+ +   I Y      N      +    ER+TF EAQ+ C   G  + + DN   N  I+  + +  +  YW+D ND   EGK+VDS++  LK+  F  GEPN   NE+C++G    +G WND  C  KN F +C K    + + ++      S  I   + TY EA+  C++ G  L++V+++    I+   + +     YWIDG D   +G W  ++GQ +T+KNW     P+     NC+ S   L G W   +C +K   +C     T  +G E +   Y+  R  +T+  A+ +C      +I + + + N  +   +KKL++  +W++GND   EG W++    +L+F N+ +G+ +  + ++CLQ  P G W D  CD  N
Sbjct:   25 TLFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQI--EIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNE-PNGGRGENCIISHNNLEGAWWDIACTNKYIAVCI----TDPSGGE-RTVDYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSLPSGYWIDSKCDSLN 638          

HSP 5 Score: 316.235 bits (809), Expect = 6.790e-90
Identity = 189/639 (29.58%), Postives = 318/639 (49.77%), Query Frame = 1
Query: 1276 GFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD---ILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYES---TAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINS-VLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIIS-------TKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            G  + +I    + + +  V +  A   CK  G  L+++ S E N+++  +A K    TYW+D ND   E T+V +   ++ Y+ + P EPN  +NE+C+  +Y  NG+WND+ C  +   IC +D   +   N+   +     +    +T+ +A  FC     R+VKI +   N +++ +++      +WI+ NDI+ E KWVD+ G +LV+ N+   EPN    E+C  G    +G WN   C  + + I   E          TI     ++ + +A + CK  G  + + +N   N +++  + +  +  YW++ ND   EG+++ SD  ++ ++ F  GEPN + NE+C++G    +GLWND  C   N   LCYK        +    + D +   + T R TY EAL++C+    +LV ++++    ++    +K     YW+DGND   EG WV+ +G  + Y NW   EPN    E+C++ +    G W D +C+ K      YI   I+       T +    + ++T++ A   C   G +++ I ++  N  I   A K  +G +WID ND A EGK+V+  N  L +  F  GEP+      C+  L   +G+W D  C+S NS IC
Sbjct:   15 GNCRSDIDANTLFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDI--EYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNK------YIAVCITDPSGGERTVDYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSL--PSGYWIDSKCDSLNSVIC 642          

HSP 6 Score: 281.952 bits (720), Expect = 7.436e-78
Identity = 171/554 (30.87%), Postives = 274/554 (49.46%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK----NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNA-VICYKES-KIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNI-GSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            KNE+C+  +Y  N +WND +C      IC ++ ++  +  +IE++   +II + K TF +A + C  +G  ++KI     N  V++ A + ++  +WIDANDI  E  +   +G+ + +  F  GEPN  R E+C HG    DG WN   C+     ICY+    N  P  + +I           E+ T+  A  +CK  G ++ K D+   N M++  + +  +  YW+D ND + EG ++ SD   + ++ F PGEPN  + NE+C++G    + LWND  C   N   +CYK+   +   + I      L+I  ER TY +A   C+++G +LV++       I+  Y  +     YWID ND   EGT+ D++   + +  WA  EPN  + E+C+         W DI C +    +C  +  G      +  S         K+ +  A   C + G  ++ I  D  NS+I   A K N+GT+WID ND   E  +V   + ++S++ +  GEP+      C+  L   +G W D KCD  NSVIC
Sbjct:  108 KNENCLM-VYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIA--------SHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNG-RINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTVDYHFS-------RTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSL--PSGYWIDSKCDSLNSVIC 642          

HSP 7 Score: 259.225 bits (661), Expect = 5.657e-70
Identity = 163/505 (32.28%), Postives = 250/505 (49.50%), Query Frame = 1
Query: 2437 IDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTK--------NSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSP------PIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNS-VICYKPSKTIDTGKEVK--KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCL--QGNPDGKWRDVSCDDK 3894
            ID +  FV    VTY EA++ C+     LV + ++E + ++   A K     YWLDGND   EG WV+  GN+L Y N+   EPN   NE+CL+  Y  NG WND +C  +         S +Y   +  I    L I + ++TF +AQ  C  +G  +V+I +   N  ++  A +     YWIDAND   E K+VD++   L +  F  GEPN    E+C HG    +G WN   CN +   IC +         P   I  H        ++T+ EA D C+  G  + K +N+  + ++H  S R  L  YW+DG D+K +GKW  SD   L  K +     P+ + N NC+       G W    C  KN   +CYK   T+   ++++       I     T+ EAL +C+ R  +L+ V +  +   L   +KK+  + YW++GND   EG W+D++ + +T+ NW N + N  + +NC+    N +G W D++C +K
Sbjct:   21 IDANTLFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIASH-------ERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGE-PNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNK 516          

HSP 8 Score: 209.149 bits (531), Expect = 5.629e-53
Identity = 123/424 (29.01%), Postives = 208/424 (49.06%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNS-VICYKN--TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNI 1266
            + E+C HG    + LWN F C      ICY+E E     +       +I   E+ TF+EA   C+  G  + K ++   N  ++  + + +   +W+D ND K EG +   +   +K+  F  GEPN   NE+C++G    DG WND  C   N   +CYK+  T P    +   +N  L+I  E+ TY  A+ +C+++G QL+++       ++     +     YWID ND   EG ++ ++G+ + Y+ +A  EPN   + E+C+         W DI+C +    +C  +       + TV   +    + +LT+  A   C S G  ++ I D+  NS++   A + N+G +WID ND   EG + +    ++ F  + +GEP+  +   C+  L   +  W D KC+ LN+VICY ++
Sbjct:  237 RGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPD----PNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVN-SLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNG-GRGENCIISHNNLEGAWWDIACTNKYIAVCITDPS---GGERTV---DYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSL--PSGYWIDSKCDSLNSVICYGSV 646          

HSP 9 Score: 146.362 bits (368), Expect = 2.833e-32
Identity = 89/295 (30.17%), Postives = 144/295 (48.81%), Query Frame = 1
Query:    7 NEHCVHGLYYPNALWNDFSCEDPSA-VICYKE--TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESK 882
            NE+C++G    + LWNDF C   +   +CYK+  T P    +IE     ++I  E+ T+ EA + C+ +G  L++++       +     +  A  +WID ND   EGT+   NGQ + Y  +A  EPN  R E+C+      +G W DI+C +    +C  +       V    +R       K T++ A+ +C S G  +I I DD  NS++   A +  +G +WID ND   EG +++    ++ ++ F  GEP+   +   C+  L   +  W D  C   N+VICY   K
Sbjct:  363 NENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMP-YPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTVDYHFSRT------KLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSG-GRERSCLQSL--PSGYWIDSKCDSLNSVICYGSVK 647          

HSP 10 Score: 66.6254 bits (161), Expect = 3.716e-7
Identity = 33/108 (30.56%), Postives = 59/108 (54.63%), Query Frame = 1
Query: 3565 EVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG-NPDGKWRDVSC 3885
            ++     ++ ++ VT+ EA+  CK R   L+ V + + N  +   + K+  + YWL+GND  NEG W+D+   +L + N+   + N  K +NCL     +G W D++C
Sbjct:   20 DIDANTLFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRVNGMWNDLNC 127          
BLAST of Mannose-binding protein C vs. TrEMBL
Match: Q8WSW9 (Lectin 2c OS=Girardia tigrina OX=6162 GN=lec2c PE=4 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.300e-107
Identity = 206/634 (32.49%), Postives = 341/634 (53.79%), Query Frame = 1
Query:  532 LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKE-SKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNS-VICSKDILNSNETIKQQQKYYVH--EVLV-----TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI-----YEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCY 2391
            L + +   TY  AI  CK++G  L+++   + N++V   A +     YWID ND  NEG ++ + G ++ Y+ FAP EPN   KNE+C+  +Y  N +WND++C      IC ++ S++ +  +I +    L++ + ++T+  AQ+ C ++G K+VKI     N++V+++A +     YWIDAND+  EG + D+D  ++    +  GEP   + E+C HG    + LWND  C      ICYK                I+   E++ F  AQ  CK  G ++ K +S   + MI+ F  +  +  YW+D ND + E  +V SD  ++ ++ +YPGEPN   NE+C++G    + LWND+ C YKN   +C KD L    T+     Y V+   +++     TY EA+ +C     ++V+I N  +   +  ++K +    +WI+GND  +EG WVD+ G  + Y NWA NEPN    E+C+  +    G W DI C  K + +     YE +S+    + +   + K+ +  A+  CKS G  +IRI++ E ++++   + K+KV  YWI+ ND   E +++ +D   +SY+NFA GEP+    ++C+  +    G W   SC  +N V+CY
Sbjct:   26 LFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNG-NKNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNR----NTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGL----TMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSS----LDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCL--IVNKTGQWFAESCRKLNRVVCY 643          

HSP 2 Score: 344.354 bits (882), Expect = 4.013e-100
Identity = 206/637 (32.34%), Postives = 331/637 (51.96%), Query Frame = 1
Query: 1693 YVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTA---EKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI---------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTI 3552
            +V +VLVTY EAI  C      +V++++ E N I+  ++  +    +WI+GND   EG WVD++GN+L Y N+A +EPN   NE+CL   +  N  WND++C  + + I + + +      +I IE     +  GK+ +  A E C ++G  +++I +   N +V+  A +     YWI+ANDI  EG+++ +DG+ + ++NF  GEP     E+C HG    +GLWND  C+     +CYK       E       D +       R+T+ EA  +C+    ++    ++    +I    R+  +  YWLDGND K EG+WV+ D  +LK+  +  GEPN   NE+C+ G    +  WND  C+ KN F   Y + +         ++   L I  ER T+ EA   C  +G  LVRI NE +   +   A K     YWID ND   EG +VD+N   + Y  +   EPN    E+C+       G W DI C++K   +CS+ +P     D  +       K+T+  A+  C+S G  +I++++ +   +++  SL++K+ +YWIDG D++ + +W  +D  +L++KN+ +   PS     NCL  ++T  G+W   SC   N V+CY   K I
Sbjct:   27 FVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYK-------EDNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSR-NP--YEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGE-PSGGREKNCLIVNKT--GQWFAESCRKLNRVVCYGNLKRI 649          

HSP 3 Score: 343.199 bits (879), Expect = 1.153e-99
Identity = 194/635 (30.55%), Postives = 343/635 (54.02%), Query Frame = 1
Query:  127 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYK-DGFWNDISCDDTNSVICYKN-TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNA-VICYKNIGSRGFT-KFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI 2019
            ++ +  + + +   T+ EA + C+A+G  L+++   + NT V   A +  A  +WID ND   EGT+    G ++ Y  FA  EPN  +NE+C+  M Y+ +  WND++C      IC ++ +Q    + I++    LI+ + K T+ +A  +C ++G +++KI     N++V++ A +     YWIDAND+ NEG ++ +DGK++V++ F PGEP    + E+C HG    + LWND  C+     ICYKE      +        ++   ERLT+Y+AQD CK  G K+ K +    + +++ +  +  +  YW+D ND ++EG + DSD  ++K   +  GEPN  +NE+C++G    +ALWND+ C   N   +CYK+  +  +   +E++   ++I  E+  +  A   C+  G +L++I ++     +  FA K     YWID ND  +E T+V ++ + ++Y+ W   EPN    E+C+       G W DI C  K   +CS++    + ++      +  +  +T++ A+ +C     ++++I + ET+++I   S   K+  +WI+GND   E +WVD+   +L Y N+A  EP+    ++CL  N    G+W   SC+  N ++
Sbjct:   20 DIDANTLFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCL--MVYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKG-GRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDN----RNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSL----DVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCLIVN--KTGQWFAESCRKLNRVV 641          

HSP 4 Score: 325.479 bits (833), Expect = 2.973e-93
Identity = 198/634 (31.23%), Postives = 333/634 (52.52%), Query Frame = 1
Query:  922 LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGF-TKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTA------EKEITIE---IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK-PFXXXXXXXXXXGKIDTSKYFVHT-GRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYY 2787
            L + K  +TY +A   CK++G  LV++   + N+IV  YA +     YWID ND   EGT+ D+  N++ +  +A  EPN  +NE+C+  +Y  N +WND+ C      IC ++        + EI    +++   K+ F  AQ  C N G +++KI     N++++ FA +     YWIDANDI  E  +V +D K++ ++ ++PGEP     E+C HG    +GLWND  C Y+   IC K+  N N           HE L T+ EA ++C     ++ K ++   + +I+ +++ + +  +W++GND   EGKWVDS   +L +  +   EPN   NE+C+ G    +  WND+ C  KN     Y+         + E+ ++   I   +  Y +AL+ C+++G  L+RI+NE     +   A K     YWI+ ND   EG ++ ++G+ ++Y+N+A+ EPN    E+C+       G W DI C++    +C + P++            D+S    +T  ++T++ A+ +C+    +++ I++ E D LI   + KHK+  YW+DGND ++E  WV+ D  +L Y N+  GEP+    ++CL+ N    G+W   SC   N  + Y
Sbjct:   26 LFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKED-NRNTNADPNTIIASHERL-TFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEG-----------DSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCLIVN--KTGQWFAESCRKLNRVVCY 643          

HSP 5 Score: 323.168 bits (827), Expect = 2.217e-92
Identity = 190/619 (30.69%), Postives = 325/619 (52.50%), Query Frame = 1
Query: 2053 TIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIF---KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSF-ICSKYSPPIIFIDEHM----SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSC 3885
            T+ + +  V Y +A++ CK++G  L+R+ + E N IV   A K     YWI+ ND   EG ++ + G  + Y+NFA  EPN   NE+C+  ++  N +WND++C +    +C +   +     +   +I+ S   V  G++T+ +A  +C     ++V I ++  + ++ + AR+     YW+D NDI  EG+WV+ DG +L + N++ GEP     E+C  G    +G WNDF CS +   I Y  +N  +  +        ER+TF EAQ+ C   G  + + ++   +  I+    +  +  YW+D ND  VEGK+VDS++  LK+  F  GEPN   NE+C++G    +  WND+ C  KN F +C K    + ++D++     +  I   + TY EA+  C++ G  L++++N      +   + +     YWIDG D  ++G W  ++G+ +T+KNW     P+     NC+ S   L G W    C +K   +C +     D+  +V  TK       +TF  A+ +CK    K+I + + +T+  +   S K  +  YW++GND + E  W+D+DK +L++ N+ +G+ +  + +NCL  N  G+W   SC
Sbjct:   25 TLFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQI--EIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNE-PNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSLDVHYTK-----AKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCLIVNKTGQWFAESC 634          

HSP 6 Score: 310.842 bits (795), Expect = 4.625e-88
Identity = 186/635 (29.29%), Postives = 315/635 (49.61%), Query Frame = 1
Query: 1276 GFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD---ILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYE---STAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINS-VLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENII---STKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            G  + +I    + + +  V +  A   CK  G  L+++ S E N+++  +A K    TYWID ND   E T+V +   ++ Y+ + P EPN  +NE+C+  +Y  N +WND+ C  +   IC +D   +   N+   +     V    +T+ +A  +C+    ++VKI +   N +++ +++      +WI+ NDI+ EGKWVD+ G +LV+ N+   EP     E+C  G    +G WND  C  + + I   E   +T     TI     ++ + +A + CK  G  + +  +   + +++    +  +  YW++ ND  VEG+++ SD   + ++ F  GEPN   NE+C++G    + LWND+ C   N   LCYK             +++     + T R TY EAL++C+    +LV I+N      +   A+K     YW+DGND   EG WV+ +G  + Y NW   EPN    E+C++ +    G W D  CS  N +      N     S+ ++   K ++TF+ A   C   G  ++RI + ET++ I   ++K+K+  YWID ND   E ++VD++   L Y  F  GEP+    ++C+  +    G W   +C   N  +C
Sbjct:   15 GNCRSDIDANTLFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDY--EVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCS--NKYFAVCSRNPYEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCL--IVNKTGQWFAESCRKLNRVVC 642          

HSP 7 Score: 285.034 bits (728), Expect = 6.912e-79
Identity = 169/556 (30.40%), Postives = 285/556 (51.26%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK------NTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNA-VICYKES-KIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEI-SNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            KNE+C+  +Y  N +WND +C      IC ++ ++  +  +IE++   +I+ + K TF +A + C  +G  ++KI     N  V++ A + ++  +WIDANDI  EG +   +G+ + +  F  GEP   R E+C HG    DG WND  C      ICYK      N  P T          +I   E+ T+  A  +CK  G ++ K +    + M++    +  +  YW+D ND + EG ++ SD  ++ ++ F PGEPN   +NE+C++G    +ALWND+ C   N   +CYK+   +  +    V    L+I  ER TY +A   C+++G +LV+I +E     +  +A +     YWID ND   EGT+ D++   + +  WA  EPN  + E+C+         W DI C +    +C +N        +E  S+ ++   + K+ F  A   CK+ G ++++I   E + +I   ++KH + +YWID ND + E+ +V +D  ++SY+ +  GEP+    ++C+  +  K G W    C   N V+C
Sbjct:  108 KNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNT----------IIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNG-GRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRN-------PYEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCL--IVNKTGQWFAESCRKLNRVVC 642          

HSP 8 Score: 256.529 bits (654), Expect = 5.211e-69
Identity = 161/505 (31.88%), Postives = 248/505 (49.11%), Query Frame = 1
Query: 2437 IDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTK--------NSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKY------SPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNS-VICYKPSKTID--TGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCL--QGNPDGKWRDVSCDDK 3894
            ID +  FV    VTY EA++ C+     LV + ++E + ++   A K     YW+DGND   EG WV+  GN+L Y N+   EPN   NE+CL+  Y  N  WND +C  +         S +Y   +  I    L + + ++TF +AQ  C  +G  +V+I +   N  ++  A +     YWIDAND   EGK+VD++   L +  F  GEP     E+C HG    +G WND  C+ +   IC K       + P   I  H        ++T+ EA D C+  G  + K  ++  S ++H  + R  L  YW+DG D+K +GKW  SD  +L  K +     P+   N NC+         W    C  KN   +CYK   T+      EV      I     T+ EAL +C+ R  +L+ + N  +  +L   +KK+  + YW++GND  +EG W+D++ + +T+ NW N + N  + +NC+    N +G W D+ C +K
Sbjct:   21 IDANTLFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASH-------ERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGE-PNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNK 516          

HSP 9 Score: 150.599 bits (379), Expect = 1.067e-33
Identity = 89/301 (29.57%), Postives = 161/301 (53.49%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSA-VICYKE--TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLK 897
            +NE+C++G    +ALWND  C   +   +CYK+  T P +  + E+    ++I  E+ T+ EA + C+ +G  L++I+++     +   A +  A  +WID ND   EGT+   NG+ + Y  +A  EPN  R E+C+      +G W DI C +    +C +N     S +      ++   + K T++ A+A+CKS G ++I+I D + + ++   ++++++  YWID ND + E  ++ +D  ++ Y+ FA GEP+   + ++C+  +      W   SC   N V+CY   K  +LK
Sbjct:  362 RNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMD-DYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSL------DVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSG-GREKNCL--IVNKTGQWFAESCRKLNRVVCYGNLK-RILK 651          
BLAST of Mannose-binding protein C vs. TrEMBL
Match: Q8WSX0 (Lectin 2b OS=Girardia tigrina OX=6162 GN=lec2b PE=4 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 1.130e-104
Identity = 204/632 (32.28%), Postives = 333/632 (52.69%), Query Frame = 1
Query:  532 LIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKE-SKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNS-VICSKDILNSNETIKQQQKYYVHE--VLV-----TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYE---YESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCY 2391
            L + +   TY  AI  CK++G  L++I   + N++V   A +    +YWID ND  NEG ++ + G ++ Y+ FAP  PN  Q NE+C   +Y  N LW D +C      IC ++ S++ +  +I +    L++ + ++T+  AQ+ C ++G K+VKI     N++V+++A +     YWIDAND+  EG + D D  ++    +  GEPN  + E+C HG    + LWND  C      ICY+                I+   E+  F  AQ  CK  G ++ K +S   N +I+ F  +  +  YW+D ND + E  +V SD  ++ ++ ++PGEPN   NE+C++G    +GLWND  C YKN   +C KD L    T+   + Y V    +++     TY EA+ +C     ++V+I N     ++  ++K +    +WI+GND  TEG W+D+ G  L Y NWA NEPN    E+C+  +    G W DI C  K + I     YE   +  + +   + K+ +  A+  CKS G  +IRI++ E ++++   + K+K+  YWI+ ND + E +++ +D   +SY+NF  GEP+    ++C+       G W    C  +N V+CY
Sbjct:   26 LFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQ-NENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNR----NTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGL----TMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYED--DTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCL--TVNKTGQWFAEGCTRLNRVVCY 643          

HSP 2 Score: 352.443 bits (903), Expect = 5.872e-103
Identity = 213/637 (33.44%), Postives = 328/637 (51.49%), Query Frame = 1
Query: 1693 YVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTA---EKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI---------ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTI 3552
            +V +VLVTY EAI  C      +V+I++ E N I+  ++  +   ++WI+GND   EG WVD++GN+L Y N+A N PN   NE+C    +  NG W D +C  + + I + + +      +I IE     +  GK+ +  A E C ++G  +++I +   N +V+  A +     YWI+ANDI  EG+++  DG+ + ++NF  GEPN    E+C HG    +GLWND  C+     +CY+       E       DT+       R T+ EA  +C+    ++    ++  + LI    R+  +  YWLDGND K EG+WV+ D  +LK+  ++ GEPN   NE+CL G    +G WNDF C+ KN F   Y + +         +    L I  ER T+ EA   C  +G  LVRI NE     +   A K     YWID ND   EG ++D+N   L Y  +   EPN    E+C+       G W DI C +K   ICS+ +P     D  +       K+T+  A+  C+S G  +I++++ +   +++  SL++KL  YWIDG D+  + +W  +D  +L++KN+ T+  PS     NCL  ++T  G+W    C   N V+CY   K I
Sbjct:   27 FVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYR-------EDNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSR-NP--YEDDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNF-TSGEPSGGREKNCLTVNKT--GQWFAEGCTRLNRVVCYGNLKRI 649          

HSP 3 Score: 330.487 bits (846), Expect = 5.196e-95
Identity = 188/634 (29.65%), Postives = 331/634 (52.21%), Query Frame = 1
Query:  127 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN-TQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNA-VICYKNIGSRGFTK-FEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI 2019
            ++ +  + + +   T+ EA + C+A+G  L++I   + NT V   A +  A ++WID ND   EGT+    G ++ Y  FA   PN  +NE+C   ++  +G W D +C      IC ++ +Q    + I++    LI+ + K T+ +A  +C ++G +++KI     N++V++ A +     YWIDAND+  EG ++  DGK++V++ F PGEPN   + E+C HG    + LWND  C+     ICY+E      +        ++   ER T+ +AQD CK  G K+ K +    N +++ +  +  +  YW+D ND ++EG + DSD  ++K   +  GEPN   NE+C++G    + LWND  C   N   +CYK+  +  + + +E+    ++I  E+  +  A   C+  G +L++I ++    ++  FA K     YWID ND  TE T++ ++ + ++Y+ W   EPN    E+C+       G W DI C  K   ICS++    +  +      +  +  +T++ A+ +C     ++++I + ET+++I   S   K+  +WI+GND   E +WVD+   +L Y N+   EP+    ++CL  N    G+W    C   N ++
Sbjct:   20 DIDANTLFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNG-GRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDN----RNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTAL----DVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLTVN--KTGQWFAEGCTRLNRVV 641          

HSP 4 Score: 329.717 bits (844), Expect = 8.558e-95
Identity = 198/619 (31.99%), Postives = 322/619 (52.02%), Query Frame = 1
Query: 2053 TIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI---ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSF-ICSKYSPPIIFIDEHM----SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSC 3885
            T+ + +  V Y +A++ CK++G  L+RI + E N IV   A K    +YWI+ ND   EG ++ + G  + Y+NFA   PN   NE+C   ++  NGLW D +C      +C +   +     +   +I+ S   V  G++T+ +A  +C     ++V I ++  + ++ + AR+     YW+D NDI  EG+WV+ DG +L + N++ GEPN    E+C  G    +G WNDF CS +   I Y  +N      T  +    ER TF EAQ+ C   G  + + ++   N  I+    +  +  YW+D ND  VEGK+VDS++  LK+  F  GEPN   NE+C++G    +G WND  C  KN F +C K    + +++++     +  I   + TY EA+  C++ G  L++++N     ++   + +     YWIDG D   +G W  ++G+ LT+KNW     P+     NC+ S   L G W    C +K   IC +     DT  +V  TK       +TF  A+ +CK    K+I + + +T+  +   S K  +  YW++GND D E  W+D+DK +L++ N+T+G+ +  + +NCL  N  G+W    C
Sbjct:   25 TLFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQI--EIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNE-PNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTALDVHYTK-----TKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLTVNKTGQWFAEGC 634          

HSP 5 Score: 327.405 bits (838), Expect = 5.203e-94
Identity = 203/638 (31.82%), Postives = 327/638 (51.25%), Query Frame = 1
Query:  922 LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGF-TKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYL------------IYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK-PFXXXXXXXXXXGKIDTSKYFVH--TGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYY 2787
            L + K  +TY +A   CK++G  LV+I   + N+IV  YA +    +YWID ND   EGT+ D+  N++ +  +A   PN  QNE+C   +Y  N LW D  C      IC ++        + EI    +++   K+ F  AQ  C N G +++KI     N++++ FA +     YWIDANDI TE  +V  D K++ ++ ++PGEPN    E+C HG    +GLWND  C Y+   IC ++  N N           HE   T+ EA ++C     ++ K ++   N +I+ +++   +  +W++GND   EGKWVDS   +L +  +   EPN   NE+CL G    +G WND  C  KN              + +YE  A+    + I   +  Y +AL+ C+++G  L+RI+NE    ++   A K     YWI+ ND   EG ++ ++G+ ++Y+N+A+ EPN    E+C+       G W DI C +    +C + P++            D +   VH    ++T++ A+ +C+    +++ I++ E D LI   + KHK+S YW+DGND  +E  WV+ D  +L Y N+  GEP+    ++CL  N    G+W    C+  N  + Y
Sbjct:   26 LFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYRED-NRNTNADTNTIIASHERF-TFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDAD---NLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYE------------DDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLTVN--KTGQWFAEGCTRLNRVVCY 643          

HSP 6 Score: 314.694 bits (805), Expect = 1.997e-89
Identity = 192/637 (30.14%), Postives = 313/637 (49.14%), Query Frame = 1
Query: 1276 GFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD---ILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYE---STAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINS-VLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI-----ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            G  + +I    + + +  V +  A   CK  G  L++I S E N+++  +A K     YWID ND   E T+V +   ++ Y+ + P  PN  +NE+C   +Y  NGLW D  C Y+   IC +D   +   N+   +     V    +T+ +A  +C+    ++VKI +   N +++ +++      +WI+ NDI+TEGKWVD  G +LV+ N+   EPN    E+C  G    +G WND  C  + + I   E   +T     TI     +  + +A + CK  G  + +  +   N +++    +  +  YW++ ND  VEG+++ SD   + ++ F  GEPN   NE+C++G    +GLWND  C   N   LCYK        +    ++D     + T R TY EAL++C+    +LV I+N     L+   A+K     YW+DGND   EG W++ +G  L Y NW   EPN    E+C++ +    G W D  C+ K    Y+ I +       +  ++   K ++TF+ A   C   G  ++RI + ET++ I   ++K+K+  YWID ND   E ++VD++   L Y  F  GEP+    ++C+       G W    C   N  +C
Sbjct:   15 GNCRSDIDANTLFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDY--EVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNK----YFAICSRNPYEDDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCL--TVNKTGQWFAEGCTRLNRVVC 642          

HSP 7 Score: 280.411 bits (716), Expect = 2.643e-77
Identity = 167/550 (30.36%), Postives = 279/550 (50.73%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-TEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNA-VICYKES-KIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIF-EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            +NE+C   +Y  N LW D++C      IC ++ ++  +  +IE++   +I+ + K TF +A + C  +G  ++KI     N  V++ A + ++  +WIDANDI  EG +   +G+ + +  F  GEPN  R E+C HG    DG WND  C      ICY+     T+         +I   E+ T+  A  +CK  G ++ K +    N +++    +  +  YW+D ND + EG ++ SD  ++ ++ F PGEPN    NE+C++G    + LWND  C   N   +CYK+   +  ++   V    L+I  ER TY +A   C+++G +LV+I +E    ++  +A +     YWID ND   EGT+ D++   + +  WA  EPN  + E+C+         W DI C +    IC +N        +E      V + + K+ F  A   CK+ G ++++I   E + +I   ++KH + TYWID ND   E+ +V +D  ++SY+ +  GEP+    ++C+     K G W    C   N V+C
Sbjct:  108 QNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTN----TIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNG-GINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRN-------PYEDDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCL--TVNKTGQWFAEGCTRLNRVVC 642          

HSP 8 Score: 254.603 bits (649), Expect = 2.481e-68
Identity = 162/499 (32.46%), Postives = 244/499 (48.90%), Query Frame = 1
Query: 2437 IDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTK--------NSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNS-VICYKPSKTIDTGK--EVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCL--QGNPDGKWRDVSCDDK 3894
            ID +  FV    VTY EA++ C+     LV I ++E + ++   A K     YW+DGND   EG WV+  GN+L Y N+    PN   NE+C L  Y  NG W D++C  +         S +Y   +  I    L + + ++TF +AQ  C  +G  +V+I +   N  ++  A +     YWIDAND   EGK+VD +   L +  F  GEPN    E+C HG    +G WND  C+ +   IC +        D +        + T+ EA D C+  G  + K  ++  + ++H  + R  L  YW+DG D+K +GKW  SD  +L  K +     P+   N NCL     L G W    C  KN   +CYK   T+   +  EV      I     T+ EAL +C+ R  +L+ + N      L   +KK+  + YW++GND   EG W+D++ + LT+ NW N + N  + +NC+    N +G W D+ C +K
Sbjct:   21 IDANTLFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTNTIIASH-ERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGE-PNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNK 516          
BLAST of Mannose-binding protein C vs. TrEMBL
Match: A0A2U9CI73 (Putative macrophage mannose receptor 1-like OS=Scophthalmus maximus OX=52904 GN=SMAX5B_013795 PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 3.652e-75
Identity = 327/1442 (22.68%), Postives = 580/1442 (40.22%), Query Frame = 1
Query:  166 TTFTEANKLCQAKGYNLIKI--EDDQF--NTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNE-DCVHGMFYK---DGFWNDISCDDTNSVIC-------YKNTQPKTSHVIK--LLNRELIILQEK---TTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVH--GLYYSNA-LWNDISCADSNAVICYKESKIEVLKKITVLNKE------------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIG-RYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVIC------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMI--YDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSK-----DILNSNETIKQQQK---------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVD---SKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYEST----AEKEITIEIMEG-------------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFYTNGL---WNDISCNSINSVLCY-----KPFXXXXXXXXXXGKI-----------DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIK--KEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNS------FIYYYIENIISTKELE---------------IFKE-----RVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNN-HALKYSKFPRGEPNNYGNEDCVHGLYYS---NGFWNDIACNSKNSFICSKYSPPII---------FIDEHMS-----YKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC--LYSSETLSGKWLGTSCVSKNSVIC------YKPSKTIDTGKEVK------KTKYYIH--RIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWEL--SKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ------KTQNCLQGNPDGKWRDVSCDDKNPF 3903
            TT+ EA   C   G +L+ I  +++QF  N  + +   Q      WI  +D   +G F++V+   I +  +  G P N     DC  G  +    DG W   SC  +   IC        K T    SH     LL R+     E     T+++A AHC S+   L      +  S +      +  G  W+  ND+  E  F+ +DG    +  + P +P+N Q NE CVH  G+ ++ A   ND  C+ +   IC K        +                         L  +     + +A+  C +QG  LV + D    + +      +  G   W   +D   EG +E +D +  ++ +W AG P++Y  EDC+  +Y  +  WND  C+     IC            +  +   G   +E        F ++  +  A+  C++ G +L+ + S    S +  Y +    ++   WI  ND+     F +SD   +++  W PGEPNN++   EDCV  + ++ G WND+ C   N+ IC        + +   T+    +         Y+  E   ++ +A  FC + +  ++ I +V   +  +  + + K+G +W+           VD     G+ L + +W +++PNN +            G W+D  C  K+  I E          K  T    +G                         + ++  A E C ++G +L+ I ++E  +    ++  +K    WI       EG + +SDG  +S+ N+  GEPN+ +  E+CV  +  TNG    WND++C++    +C       P                         +   Y   T  V ++ A+  C      LV+I N E    + ++     ++  W+ G  +      +++ +D + + Y +W  GEPNN  G E C+  N    G WND +C    +      F          T+  E               +FK      +  +  A++ C  +G  L  ID++  N  +    +++     WI  +D   E ++  S+    ++Y+ +   EPNN G  +    + +S   +G WND AC+  +SF+C +     I           D ++S     YK+     ++  A   C+ +G +L  V+ S D +F+    ++     + WI G   K+DG + ++DG  + F  W     PS+ ++  C  +++S    G W  T C      IC        P+     GK +       +  YY++  + G ++ ++  +C+  R +L+ + +     ++  L  +K+  I   W+ G  +D    W  +DK  + F NW  G+ N          ++C++   DG+W D +C  K  F
Sbjct:  325 TTWHEALTKCSDMGAHLLIINSQEEQFFINGNLPDFH-QVDIPDIWIGLSDKDQDGDFKWVDKSLITFSNYGAGWPRNTAGLWDC--GQIFTGNYDGKWETTSCFKSLGYICEMTGGQNPKPTSAPDSHCDPGYLLYRDFCYHFEGERVKTWQDAEAHCNSEQGHLTSFHSQEELSFL----TAHMPGEAWVGLNDINIENQFVYTDGTPADFLLWEPHQPDNGQNNEDCVHLRGMTHTEAGKLNDDVCSSTKEYICKKAKGQGPPPQPPTSGPGWNAKCGSWMSDPFNDYCYLFNYLSMRKWAEARADCVNQGGDLVSVTDPFEQAFIQGVIQMSPTGIALWTGGHDSITEGGWEWTDGSPFRYIRWGAGNPDDYYGEDCL-SIYINSGYWNDDNCDYNRGYICKRRGNTPEPPPPHDELRCSGPDWYEFGEFCYKPFGDRKTWHGARDTCRSLGADLVSVLSMTEQSWLESYMYMATSDV---WIGLNDLFVPGMFSWSDEHMVTFTYWAPGEPNNHDGFTEDCVK-MLHQTGRWNDMSCTELNTYICKTPKAHYPVPSVRPTVYGCPQGWDAYGYSCYWTEETARSWSDAKAFCTEQDGFLLHIGDV-YEQAHFTVALSGKMGLWWLGLRARGGTAGGVDYIWDDGSPLTFTHWDRDQPNNEDGTCVAMTTGQIGGFWDDKQCSEKHAFICERHRPDITPPTKPPTPPPAQGCADGWTAQPHFRHCYRLFHNVDWSLRKSWGAAHEDCVARGANLVSIHSQEEEEF---LSVYSKASSKWIGLKHNPTEGGYSWSDGTPLSHTNWGRGEPNDHDGREECVEMVSSTNGTYSWWNDLNCDAHQDWICMIAKGKNPILPPVPPPPVPAPECGTNVGWRKNNNICYYHNDTDIVDFQTAMMRCYAEKASLVSILNKEEQAYVNSMVGTGDVAAAWI-GMRVAGIANAQYIWVDYSPVMYTHWGSGEPNNANGEEQCVQMNR-QQGGWNDANCGRAGAGYVCKKFPGSDHTPPPPTQPWEGNCPEGWLRFKDKCFMFKGKKDDVKANWSHARSWCKDQGGELAVIDDQYENDFVSSY-LRDLELPTWIGLSDLLSENQYAWSDGVSPVRYTNWNDKEPNNAGGAEHCVAMSHSPLVSGKWNDDACHKDHSFVCYRKKSSSIDPPPPTASPCPDGYVSWYQSCYKLMEEPASWDAAQTACEQQGGNLASVDMSYDQAFLAG--AVLQGRADAWI-GLRRKDDGSYAWTDGWPVFFTQWGPGE-PSNIKDEGCVSMHASRVFHGTWNDTRCDVAKPYICKISSESPPPTPVPGDGKCLPFWVPYGRHCYYVYDEQQGFSWPDSRHYCQSIRAELVSLHSRAEVEFVRNLNYTKRHHI---WI-GLTRDRNFGWGWTDKTSVGFLNWAPGEPNAAFHPGDVAEESCVEMYADGRWNDNNCLQKRGF 1739          

HSP 2 Score: 237.654 bits (605), Expect = 1.933e-59
Identity = 324/1453 (22.30%), Postives = 563/1453 (38.75%), Query Frame = 1
Query:  127 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQR-IKYHKF-AKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL--------IILQEKTTYENAIAHCKSKGFQLIKI----DDDQLNSMVYNLAVQYQIGRYWIDANDMQNE---GN--FISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSN---ALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERL----TYYKAQDLCKSQGYKLVKID--DEQF--NSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNE-DCVHGLYYKN--ALWNDIKCEDLNAVICYKNIG----------SRGFTKFEISNKEIVIFEEKVV--FKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVH--GL-YYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK--------------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIG-RFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPN-GEWNDISCK-TKNYLIYEYESTAEK------------------EITIEIMEGKVNYIKALELCKSKGYDLIRI----ENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKP---FXXXXXXXXXXG------KIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEG------EWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI-----------------------------FKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNG---FWNDIACNSKNSFIC--SKYSPPIIFIDEHMS--------------------YKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSK-NDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNS-VICYK--------PSKT------IDTGKEVKKTKYYIHR-----IGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGND--KDNEGAWIDSDKKKLTFFNWTNGKV-NIQKTQNC--LQGNP--DGKWRDVSCDDKNPF 3903
            E ++K      +  ++ EAN  C     NL+ I+D   + +++ +  Q     +W+  ND   EG +E+ +G   I+Y  F    +P+N++NEDC H +    G WND +C+     IC K+  P       L N           +    + ++  A   C  +G  L+ I    D+  +   +        +G   +  N +  E   GN  F  SD +++ Y  +A GEP    ++  C   +  ++     W    C      +C +                       +    T+++A   C   G  L+ I+  +EQF  N  + ++  Q +I   WI  +D   +G F+  DK+ I FS + AG P N     DC   ++  N    W    C      IC    G          S     + +       FE + V  ++ A+  C +    L    S E  S    F   H  G  W+  NDI  EN FVY+D     +  W P +P+N + NEDCVH  G+ + + G  ND  C      IC K                                   + +  +  + EA   C      +V +++      I    +    G   W  G+D ITEG W  + G+   Y+ W    P++Y  EDCL  + Y N G WND +C   + Y+     +T E                   E   +    +  +  A + C+S G DL+ +    E   +   +Y +AT +     WI  ND+ V G F +SD   +++  +A GEPNN +   EDCV  + +  G WND+SC  +N+ +C  P   +          G          S Y+      ++ +A  FC      L+ I +   +     +A   K+  +WL    ++  G      +++  DG+ L + +W++ +PNN       +      G W+D  CS K++FI       I+                                   +  R ++  A   C+ +G +LV I ++E  +    L+V +K    WI       EG +  S+   L ++ + RGEPN++ G E+CV  +  +NG   +WND+ C++   +IC  +K   PI+                           Y    + V ++ A+ +C +E  SL+ + N +    V+++     +   WI    +   + ++ + D   + + +W +    +      C+  +    G W   +C    +  +C K        P  T         G    K K ++ +     +   +  A  +CK++  +L V+D+   N ++    + L +   W+  +D   +N+ AW D     + + NW + +  N    ++C  +  +P   GKW D +C   + F
Sbjct:   31 EYETKCYFFSTDVKSWMEANAFCLEHNSNLMSIQD--IHERLW-VRTQISTEIYWMGLNDQVSEGVWEWSDGSPFIEYLSFWMPNQPDNWQNEDCGHVVGSSYGQWNDENCNIKRKYIC-KHVNPNPGPQCDLANGWRPHGSNCYKLKADVRKSWAAARHDCVLEGGDLVSIASAADEQYVTGTLDPSRFDLWLGLSTLKCNQISCEVEAGNSQFTWSDAQQVQYTNWAGGEPTVDAQSGSCSAIIKDASEEFGKWRSHVCRYERPYMCKRPLNTICPTGWMSFAGSCYWMVSNINLLTTWHEALTKCSDMGAHLLIINSQEEQFFINGNLPDFH-QVDIPDIWIGLSDKDQDGDFKWVDKSLITFSNYGAGWPRNTAGLWDCGQ-IFTGNYDGKWETTSCFKSLGYICEMTGGQNPKPTSAPDSHCDPGYLLYRDFCYHFEGERVKTWQDAEAHCNSEQGHLTSFHSQEELS----FLTAHMPGEAWVGLNDINIENQFVYTDGTPADFLLWEPHQPDNGQNNEDCVHLRGMTHTEAGKLNDDVCSSTKEYICKKAKGQGPPPQPPTSGPGWNAKCGSWMSDPFNDYCYLFNYLSMRKWAEARADCVNQGGDLVSVTDPFEQAFIQGVIQMSPTGIALWTGGHDSITEGGWEWTDGSPFRYIRWGAGNPDDYYGEDCL--SIYINSGYWNDDNCDYNRGYICKRRGNTPEPPPPHDELRCSGPDWYEFGEFCYKPFGDRKTWHGARDTCRSLGADLVSVLSMTEQSWLESYMY-MATSD----VWIGLNDLFVPGMFSWSDEHMVTFTYWAPGEPNNHDGFTEDCVK-MLHQTGRWNDMSCTELNTYICKTPKAHYPVPSVRPTVYGCPQGWDAYGYSCYWTEETARSWSDAKAFCTEQDGFLLHIGDV-YEQAHFTVALSGKMGLWWL---GLRARGGTAGGVDYIWDDGSPLTFTHWDRDQPNNEDGTCVAMTTGQIGGFWDDKQCSEKHAFICERHRPDITPPTKPPTPPPAQGCADGWTAQPHFRHCYRLFHNVDWSLRKSWGAAHEDCVARGANLVSIHSQEEEEF---LSVYSKASSKWIGLKHNPTEGGYSWSDGTPLSHTNWGRGEPNDHDGREECVEMVSSTNGTYSWWNDLNCDAHQDWICMIAKGKNPILPPVPPPPVPAPECGTNVGWRKNNNICYYHNDTDIVDFQTAMMRCYAEKASLVSILNKEEQAYVNSMVGTGDVAAAWIGMRVAGIANAQYIWVDYSPVMYTHWGSGEPNNANGEEQCVQMNRQ-QGGWNDANCGRAGAGYVCKKFPGSDHTPPPPTQPWEGNCPEGWLRFKDKCFMFKGKKDDVKANWSHARSWCKDQGGELAVIDDQYENDFVSSYLRDLELPT-WIGLSDLLSENQYAWSDG-VSPVRYTNWNDKEPNNAGGAEHCVAMSHSPLVSGKWNDDACHKDHSF 1455          

HSP 3 Score: 220.705 bits (561), Expect = 3.545e-54
Identity = 333/1516 (21.97%), Postives = 567/1516 (37.40%), Query Frame = 1
Query:    4 KNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK--------YVIIFQEKTTFTEANKLCQAKGYNLIKIE---DDQFNTQVYNLA-IQYHAGRFWIDANDIKVE-----GTFEYVNGQRIKYHKFAKGEPN-NYRNEDCVHGMFYKD-----GFWNDISCDDTNSVICYK--NTQPKTSHVIKLLNRELII--LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMV-YNLAVQYQ--IGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSN--ALWNDISCADSNAVICY---KESKIEVLKKITVLNKELVIFK--------ERL-TYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVH--GLYYKNA-LWNDIKCEDLNAVICYK-------------------NIGSRGFTKFEISNKEIVIFEEKVVFKHAQLL--CKNNGYELLKIDSDEINSMIYDFAVKHNIG-TYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK---------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN--EDCLEGNFYPNGEWNDISCKTKNYLI-----YEYESTAEKEITIEIMEG--------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWIN--ANDINVEG-QFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC--YKP----FXXXXXXXXXXGKID---TSKYFVHTGRV----------TYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGK---WNDFSCSTKNSFIYYYIE---------------------NIISTKELEIF-----KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVE-GKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNS-FICSKY-----SPP--------------IIFIDEHMSYKIFIN--KVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDG-QQLTFKNWQTASLPSDKENNN--------CLYSSETLSGKWLGTSCVSKNSVICY-KPSKTIDTGKEVK-----------KTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPD----GKWRDVSCDDKNPFFFEFIDENE 3930
            +NE C H +      WND +C      IC K   P    + +L +         Y +    + ++  A   C  +G +L+ I    D+Q+ T   + +      G   +  N I  E       F + + Q+++Y  +A GEP  + ++  C      KD     G W    C      +C +  NT   T  +    +   ++  +   TT+  A+  C   G  L+ I+  +    +  NL   +Q  I   WI  +D   +G+F   D   I +  +  G P N      C   ++  N    W   SC  S   IC     ++        +  +   ++++        ER+ T+  A+  C S+   L     ++  S +      +  G  W+  ND+ IE  F  +D     F  W   +P+N QN EDCVH  G+ +  A   ND  C      IC K                     GS     F   N    +F    + K A+    C N G +L+ +      + I         G   W   +D  TE  + ++D     Y +W  G P++Y  EDC+  +Y  +G WND  CDY    IC K   N+ E      +               Y       T+  A + C      +V + ++ T +   E    M     WI  ND+   G +  S  + + +  WA  EPNN++   EDC++   +  G WND+SC   N  I       Y   + +       +G                ++  A   C  +   L+ I  +   +  + VA   K+G +W+   A      G  +I+ DG  +++ ++   +PNN++            G W+D  C+  ++ +C  ++P      +       +G  D      +F H  R+          ++  A   C      LV+I + E +     L+   K S  W+       EG +   DG  L + NW +GEPN++ G E+C+      NG    WND +C     +I    +                     N+   K   I       + V F+ A   C  +  SLV I N+E    +  +     +   WI      +   +++  +   + Y+ +  GEPNN  G E CV  +    G WND  C    + ++C K+     +PP              + F D+   +K   +  K  +  A   C+ +G  L  +++   +  V +  LR   +  WI  +D  ++ ++ +SDG   + + NW      +DKE NN         +  S  +SGKW   +C   +S +CY K S +ID                 ++ Y +     ++  A   C+++   L  VD      +L     +   +  W+    KD +G++  +D   + F  W  G+ +  K + C+  +      G W D  CD   P+  +   E+ 
Sbjct:  118 QNEDCGHVVGSSYGQWNDENCNIKRKYIC-KHVNPNPGPQCDLANGWRPHGSNCYKLKADVRKSWAAARHDCVLEGGDLVSIASAADEQYVTGTLDPSRFDLWLGLSTLKCNQISCEVEAGNSQFTWSDAQQVQYTNWAGGEPTVDAQSGSC--SAIIKDASEEFGKWRSHVCRYERPYMCKRPLNTICPTGWMSFAGSCYWMVSNINLLTTWHEALTKCSDMGAHLLIINSQEEQFFINGNLPDFHQVDIPDIWIGLSDKDQDGDFKWVDKSLITFSNYGAGWPRNTAGLWDCGQ-IFTGNYDGKWETTSCFKSLGYICEMTGGQNPKPTSAPDSHCDPGYLLYRDFCYHFEGERVKTWQDAEAHCNSEQGHLTSFHSQEELSFL----TAHMPGEAWVGLNDINIENQFVYTDGTPADFLLWEPHQPDNGQNNEDCVHLRGMTHTEAGKLNDDVCSSTKEYICKKAKGQGPPPQPPTSGPGWNAKCGSWMSDPF---NDYCYLFNYLSMRKWAEARADCVNQGGDLVSVTDPFEQAFIQGVIQMSPTGIALWTGGHDSITEGGWEWTDGSPFRYIRWGAGNPDDYYGEDCL-SIYINSGYWNDDNCDYNRGYIC-KRRGNTPEPPPPHDELRCSGPDWYEFGEFCYKPFGDRKTWHGARDTCRSLGADLVSVLSM-TEQSWLESYMYMATSDVWIGLNDLFVPGMFSWSDEHMVTFTYWAPGEPNNHDGFTEDCVK-MLHQTGRWNDMSCTELNTYICKTPKAHYPVPSVRPTVYGCPQGWDAYGYSCYWTEETARSWSDAKAFCTEQDGFLLHI-GDVYEQAHFTVALSGKMGLWWLGLRARGGTAGGVDYIWDDGSPLTFTHWDRDQPNNEDGTCVAMTTGQIGGFWDDKQCSEKHAFICERHRPDITPPTKPPTPPPAQGCADGWTAQPHFRHCYRLFHNVDWSLRKSWGAAHEDCVARGANLVSIHSQEEEEF---LSVYSKASSKWIGLKHNPTEGGYSWSDGTPLSHTNWGRGEPNDHDGREECVEMVSSTNGTYSWWNDLNCDAHQDWICMIAKGKNPILPPVPPPPVPAPECGTNVGWRKNNNICYYHNDTDIVDFQTAMMRCYAEKASLVSILNKEEQAYVNSMVGTGDVAAAWIGMRVAGIANAQYIWVDYSPVMYTHWGSGEPNNANGEEQCVQ-MNRQQGGWNDANCGRAGAGYVCKKFPGSDHTPPPPTQPWEGNCPEGWLRFKDKCFMFKGKKDDVKANWSHARSWCKDQGGELAVIDDQYENDFVSSY-LRDLELPTWIGLSDLLSENQYAWSDGVSPVRYTNW------NDKEPNNAGGAEHCVAMSHSPLVSGKWNDDACHKDHSFVCYRKKSSSIDPPPPTASPCPDGYVSWYQSCYKLMEEPASWDAAQTACEQQGGNLASVDMSYDQAFLAGAVLQGRADA-WIGLRRKD-DGSYAWTDGWPVFFTQWGPGEPSNIKDEGCVSMHASRVFHGTWNDTRCDVAKPYICKISSESP 1604          

HSP 4 Score: 201.83 bits (512), Expect = 2.559e-48
Identity = 253/1160 (21.81%), Postives = 428/1160 (36.90%), Query Frame = 1
Query:  142 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG--RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK---NTQPKTSH-VIKLLNRELIILQE--------KTTYENAIAHCKSKGFQLIKI----DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK-NEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKI--TVLNKE----------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDS------DKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKN-------------IGSRGFTKFEISNKEI---------VIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGL---WNDIKCDYKNSVIC-----SKDILNSNETIKQQQK---------------YYVHEV-LVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDI-ITEGKWVDSKGNKLVYLNWAKNEPNNYNNED-CLEGNFYPNGEWNDISC--KTKNYLIYEYE-STAEKEITIEIMEG-----------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDG-QNISYRNFAHGEPNNQNN-EDCV---HGLFYTNGLWNDISCNSINSVLCYKP------FXXXXXXXXXXGKID--TSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDC--LLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE------------------IFKERVTF--EEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWID-ANDKAVEGKFVDSNNHALKYSKFPRGEPN------NYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKY 3159
            Y+  +     + EA   C  +G +L+ + D  F        IQ        W   +D   EG +E+ +G   +Y ++  G P++Y  EDC+  ++   G+WND +CD     IC +     +P   H  ++    +     E        + T+  A   C+S G  L+ +    +   L S +Y           WI  ND+   G F  SD   + +  +APGEPNN+    E CV  + +    WND+SC + N  IC        +  +  TV                  +   ++  A+  C  Q   L+ I D  +    +  A+   +G +W+    +R  G           D + + F+ W   +PNN                W+D +C + +A IC ++               ++G      +             V +  +  +  A   C   G  L+ I S E    +   +V     + WI      TE  + +SD   +S+  W  GEPN+++  E+CV  +   NG    WND+ CD     IC        IL                          YY ++  +V ++ A+  C      +V I N E    +        +   WI      I   +++    + ++Y +W   EPNN N E+ C++ N    G WND +C      Y+  ++  S        +  EG                       K N+  A   CK +G +L  I+++  N  V       ++   WI  +D+  E Q+ +SDG   + Y N+   EPNN    E CV   H     +G WND +C+  +S +CY+                 +G +    S Y +     +++ A   C+     L +++ S  D   L  A     +  W+ G   K +G +   DG  + +  W  GEP+N  +E C  +  +   +G WND  C     +I            +                   ++ E+  F   ++++ C      LV + +    + + +L    K    WI    D+     + D    ++ +  +  GEPN      +   E CV    Y++G WND  C  K  F C  +
Sbjct:  610 YLFNYLSMRKWAEARADCVNQGGDLVSVTD-PFEQAFIQGVIQMSPTGIALWTGGHDSITEGGWEWTDGSPFRYIRWGAGNPDDYYGEDCL-SIYINSGYWNDDNCDYNRGYICKRRGNTPEPPPPHDELRCSGPDWYEFGEFCYKPFGDRKTWHGARDTCRSLGADLVSVLSMTEQSWLESYMY-----MATSDVWIGLNDLFVPGMFSWSDEHMVTFTYWAPGEPNNHDGFTEDCVK-MLHQTGRWNDMSCTELNTYICKTPKAHYPVPSVRPTVYGCPQGWDAYGYSCYWTEETARSWSDAKAFCTEQDGFLLHIGD-VYEQAHFTVALSGKMGLWWL---GLRARGGTAGGVDYIWDDGSPLTFTHWDRDQPNNEDGTCVAMTTGQIGGFWDDKQCSEKHAFICERHRPDITPPTKPPTPPPAQGCADGWTAQPHFRHCYRLFHNVDWSLRKSWGAAHEDCVARGANLVSIHSQEEEEFL---SVYSKASSKWIGLKHNPTEGGYSWSDGTPLSHTNWGRGEPNDHDGREECVEMVSSTNGTYSWWNDLNCDAHQDWICMIAKGKNPILPPVPPPPVPAPECGTNVGWRKNNNICYYHNDTDIVDFQTAMMRCYAEKASLVSILNKEEQAYVNSMVGTGDVAAAWIGMRVAGIANAQYIWVDYSPVMYTHWGSGEPNNANGEEQCVQMN-RQQGGWNDANCGRAGAGYVCKKFPGSDHTPPPPTQPWEGNCPEGWLRFKDKCFMFKGKKDDVKANWSHARSWCKDQGGELAVIDDQYENDFVSSYLRDLEL-PTWIGLSDLLSENQYAWSDGVSPVRYTNWNDKEPNNAGGAEHCVAMSHSPL-VSGKWNDDACHKDHSFVCYRKKSSSIDPPPPTASPCPDGYVSWYQSCYKLMEEPASWDAAQTACEQQGGNLASVDMS-YDQAFLAGAVLQGRADAWI-GLRRKDDGSYAWTDGWPVFFTQWGPGEPSNIKDEGCVSMHASRVFHGTWNDTRCDVAKPYICKISSESPPPTPVPGDGKCLPFWVPYGRHCYYVYDEQQGFSWPDSRHYCQSIRAELVSLHSRAEVEFVRNLNY-TKRHHIWIGLTRDRNFGWGWTDKT--SVGFLNWAPGEPNAAFHPGDVAEESCVE--MYADGRWNDNNCLQKRGFACRHH 1744          

HSP 5 Score: 199.904 bits (507), Expect = 9.220e-48
Identity = 231/1078 (21.43%), Postives = 419/1078 (38.87%), Query Frame = 1
Query:    7 NEHCVHGLYYPNALWNDFSCEDPSAVICYKE---TEPKISAE---------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHA-GRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN--EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQE---------------KTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEG---NFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYS-NALWNDISCADSNAVICYKESKIEVLKKITVLNKEL----------------------VIFKERLTYYKAQDLCKSQGYKLVKI---DDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKN---ALWNDIKCEDLNAVICY-----------------------KNIGSRGFTKFEISNKEIVIFE---EKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENT-FVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNET----------------IKQQQKYYVH-----EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKG-NKLVYLNWAKNEPNNYNN-EDCLEGNFYP--NGEWNDISC-KTKNYLIYEYESTAEK-----------------EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCV--HGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGR-----------VTYEEALRFCQIHSCRLVTIEN-SELDILI-LNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPN------NYGNEDCLLGNYFANGKWNDFSCSTKNSF 2778
             E C+  +Y  +  WND +C+     IC +     EP    +          E        F ++ T+  A   C++ G +L+ +       Q +  +  Y A    WI  ND+ V G F + +   + +  +A GEPNN+    EDCV  M ++ G WND+SC + N+ IC     PK  + +  +   +    +                 ++ +A A C  +   L+ I D       + +A+  ++G +W+            ++I  DG  + +  +   +PNN  ++  CV          W+D  C++ +A IC +                                       V +  R ++  A + C ++G  LV I   ++E+F S VY+ A        WI       EG +  SD   +  + W  GEPN++   E+CV  +   N   + WND+ C+     IC                         N+G R        N  I  +    + V F+ A + C      L+ I + E  + +       ++   WI        N  +++ D   + Y  W  GEPNN   E+    +  + G WND  C    +    K    S+ T                ++ + K ++      +V   +  A ++C      +  I +   N  +  + +++++   WI  +D+++E ++  S G + + Y NW   EPNN    E C+  +  P  +G+WND +C K  +++ Y  +S++                   +   ++ME   ++  A   C+ +G +L  ++       +     + +    WI     + +G + ++DG  + +  +  GEP+N  +E CV  H     +G WND  C+     +C K   E        G      ++V  GR            ++ ++  +CQ     LV++ + +E++ +  LN  ++H I   W+     +  G W   D   + +LNW  GEPN      +   E C+    +A+G+WND +C  K  F
Sbjct:  695 GEDCL-SIYINSGYWNDDNCDYNRGYICKRRGNTPEPPPPHDELRCSGPDWYEFGEFCYKPFGDRKTWHGARDTCRSLGADLVSVL--SMTEQSWLESYMYMATSDVWIGLNDLFVPGMFSWSDEHMVTFTYWAPGEPNNHDGFTEDCVK-MLHQTGRWNDMSCTELNTYIC---KTPKAHYPVPSVRPTVYGCPQGWDAYGYSCYWTEETARSWSDAKAFCTEQDGFLLHIGD-VYEQAHFTVALSGKMGLWWLGLRARGGTAGGVDYIWDDGSPLTFTHWDRDQPNN--EDGTCVAMTTGQIGGFWDDKQCSEKHAFICERHRPDITPPTKPPTPPPAQGCADGWTAQPHFRHCYRLFHNVDWSLRKSWGAAHEDCVARGANLVSIHSQEEEEFLS-VYSKASSK-----WIGLKHNPTEGGYSWSDGTPLSHTNWGRGEPNDHDGREECVEMVSSTNGTYSWWNDLNCDAHQDWICMIAKGKNPILPPVPPPPVPAPECGTNVGWR-------KNNNICYYHNDTDIVDFQTAMMRCYAEKASLVSILNKEEQAYVNSMVGTGDVAAAWIGMRVAGIANAQYIWVDYSPVMYTHWGSGEPNNANGEEQCVQMNRQQGGWNDANCGRAGAGYVCKKFPGSDHTPPPPTQPWEGNCPEGWLRFKDKCFMFKGKKDDVKANWSHARSWCKDQGGELAVIDDQYENDFVSSYLRDLELPT-WIGLSDLLSENQYAWSDGVSPVRYTNWNDKEPNNAGGAEHCVAMSHSPLVSGKWNDDACHKDHSFVCYRKKSSSIDPPPPTASPCPDGYVSWYQSCYKLMEEPASWDAAQTACEQQGGNLASVDMSYDQAFLAGAVLQGRA-DAWIGLRRKD-DGSYAWTDGWPVFFTQWGPGEPSNIKDEGCVSMHASRVFHGTWNDTRCDVAKPYIC-KISSESPPPTPVPGDGKCLPFWVPYGRHCYYVYDEQQGFSWPDSRHYCQSIRAELVSLHSRAEVEFVRNLNYTKRHHI---WIGLTRDRNFG-WGWTDKTSVGFLNWAPGEPNAAFHPGDVAEESCV--EMYADGRWNDNNCLQKRGF 1739          

HSP 6 Score: 157.532 bits (397), Expect = 1.074e-34
Identity = 228/1039 (21.94%), Postives = 395/1039 (38.02%), Query Frame = 1
Query: 1246 VICYKNIGSRGFTKFEISNKEIVIFEEKV-VFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGT--YWIDANDIQTENTFVYSD-SKKISYQK-WYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVH---------EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRF--WIN---------------GNDIITEGKWVDSKGNKLVYLNWAKNEPN-NYNNEDC---LEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYI-----------------KALELCKSKGYDLIRIENEE----INKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE-DCVHGLFYT---NGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTG--------RV-TYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNN-YGNEDC--LLG-NYFANGKWNDFSCSTKNSFI----------------------------------YYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIG-QYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS----PPIIFIDEHMS-----------YKIFINKVTYREAVDKCQSEGYSLIKV-ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETL-----SGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTK--------------YYIHRIGVTFQEALDFCKERRCKLIVVDNI-DTNIYLWELSKKLSIEKYWLNGNDKDNEGAWID---SDKKKLTFFNWTNGKVNIQKTQNCLQ---GNPDGKWRDVSCDDKNPFFFE 3912
            ++C      +G+ ++E    +   F   V  +  A   C  +   L+ I   +I+  ++   V+  I T  YW+  ND  +E  + +SD S  I Y   W P +P+N++NEDC H +    G WND  C+ K   IC     N          +  H         +V  ++  A + C      +V I++    + +   +  +   RF  W+                GN   T   W D++  ++ Y NWA  EP  +  +  C   ++      G+W    C+      YE     ++ +      G +++                  +AL  C   G  L+ I ++E    IN  + D    + +   WI  +D + +G F + D   I++ N+  G P N     DC  G  +T   +G W   SC      +C     ++              Y ++          RV T+++A   C      L +  + E     L+    H     W+  NDI  E ++V  DG    +L W   +P+N   NEDC  L G  +   GK ND  CS+   +I                                  Y Y+ N +S ++         + EA+  C+ +G  LV + +      I  +   +  G   W   +D   EG +  ++    +Y ++  G P++Y  EDC+  +Y ++G+WND  C+    +IC +      PP    +   S           YK F ++ T+  A D C+S G  L+ V   ++ S++   + +    V  WI   D    G +++SD   +TF  W        + NN+  ++ + +     +G+W   SC   N+ IC  P         V+ T               Y+      ++ +A  FC E+   L+ + ++ +   +   LS K+ +  +WL    +      +D    D   LTF +W   + N  +   C+    G   G W D  C +K+ F  E
Sbjct:   18 LVCAHCQCQQGWREYET---KCYFFSTDVKSWMEANAFCLEHNSNLMSIQ--DIHERLW---VRTQISTEIYWMGLNDQVSEGVWEWSDGSPFIEYLSFWMPNQPDNWQNEDCGHVVGSSYGQWNDENCNIKRKYICKHVNPNPGPQCDLANGWRPHGSNCYKLKADVRKSWAAARHDCVLEGGDLVSIASAADEQYV---TGTLDPSRFDLWLGLSTLKCNQISCEVEAGNSQFT---WSDAQ--QVQYTNWAGGEPTVDAQSGSCSAIIKDASEEFGKWRSHVCR------YERPYMCKRPLNTICPTGWMSFAGSCYWMVSNINLLTTWHEALTKCSDMGAHLLIINSQEEQFFINGNLPDFHQVD-IPDIWIGLSDKDQDGDFKWVDKSLITFSNYGAGWPRNTAGLWDC--GQIFTGNYDGKWETTSCFKSLGYICEMTGGQNPKPTSAPDSHCDPGYLLYRDFCYHFEGERVKTWQDAEAHCNSEQGHLTSFHSQEE----LSFLTAHMPGEAWVGLNDINIENQFVYTDGTPADFLLWEPHQPDNGQNNEDCVHLRGMTHTEAGKLNDDVCSSTKEYICKKAKGQGPPPQPPTSGPGWNAKCGSWMSDPFNDYCYLFNYLSMRK---------WAEARADCVNQGGDLVSVTDPFEQAFIQGVIQMSPTGIALWTGGHDSITEGGWEWTDGSPFRYIRWGAGNPDDYYGEDCL-SIYINSGYWNDDNCDYNRGYICKRRGNTPEPPPPHDELRCSGPDWYEFGEFCYKPFGDRKTWHGARDTCRSLGADLVSVLSMTEQSWLESYMYMATSDV--WIGLNDLFVPGMFSWSDEHMVTFTYWAPG-----EPNNHDGFTEDCVKMLHQTGRWNDMSCTELNTYICKTPKAHYPV-PSVRPTVYGCPQGWDAYGYSCYWTEETARSWSDAKAFCTEQDGFLLHIGDVYEQAHFTVALSGKMGL--WWLGLRARGGTAGGVDYIWDDGSPLTFTHWDRDQPN-NEDGTCVAMTTGQIGGFWDDKQCSEKHAFICE 1006          
BLAST of Mannose-binding protein C vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 206.453 bits (524), Expect = 2.242e-53
Identity = 255/1155 (22.08%), Postives = 443/1155 (38.35%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--------------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEI------------SNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV-HGLYYKNGLWNDIKCDYKNSVICSK---DILNSNETIKQQ---------QKYYVHEVLV---------TYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYEYE-STAEKEITIEIMEGKVN--------------YI--------KALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP--FXXXXXXXXXXGKIDTS-----------KYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEP-------NNYGNE-DCLL---GNYFANGKWNDFSCSTKNSFI--------YYYIENIISTK--------ELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS------PPIIF--IDEHMSYKIFI------------NKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLS-LRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIH 3594
            Q   T+  A   C+ +G  L+ I   +L+   Y   +   +G   WI  N +  E  +  S+G    Y  +APG P+  +   +CV       + W  ++C      IC K +    +    V ++                 I + ++ +  A   C   G +L  I + + +S + + +        WI  ND + +  FE SD+  + F+KW  GEP++  N  EDCV  +  K+  W D  CE  +  IC K    +     EI            S+    I  E   F  A+  C+ +   L+++     N+ +           +WI  ++ +  + F +++ + +++  +  G P+    + CV        GLW+   CD K   IC K    +  + E    Q         +K     + V         T+ EA ++C      +    S  ETN + Y  S +      WI  + + T   +V S      Y NW+  EPNNYN+ E C E +FY    WND +C++ N  I +    T  K    +  + K N              YI         A   CK    DL+ I  +   + ++   ++    QY+I    + ++  F + DG  + Y ++   EPN  NN++    ++ + G WNDI+C      +C +   F           K   +           K+       ++ +A ++C      LV+I  S  +   L           W+  ND+  E  ++  DG  + + NW +G P        +YG + DC++         G W    CS K  FI               +S+K          ++  E+++++EA+  C      L  + +  T + +  L         WI  N     G++   +N  L+Y+K+  GEP    N  CV+    ++G W    C++    +C + S      PP +     E   +K +I                +  A  +C   G S++ VE+  + +FI   L  L+    ++WI G    ++G+W + D   + + NW    +P+     +C+    + SG W  T C    + IC K  K I   ++      Y H
Sbjct:  236 QSVLTWHQARKSCQQQGADLLSIV--ELHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPS-LEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIR-SHAEQAFLTTMMLSASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVT-EALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPKR--NLACVY--IDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWI-GMHRNHEGEWMWIDNMVVDYTNW-APRMPT--AYGDCV-EVRSDSGLWYTTRCSGYRAYIC-KTEKVIPPTEKQPGVGKYKH 1367          

HSP 2 Score: 203.371 bits (516), Expect = 2.210e-52
Identity = 240/1151 (20.85%), Postives = 445/1151 (38.66%), Query Frame = 1
Query:  148 IIFQEKT----TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK-NEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV------------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA-LWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIF-------------------EEKVVFKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQ------------------QKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEG-KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYE----YESTAEKEITIE---------IMEGKV----------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE--------DC---VHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYF--------VHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI---------FKERVTFE---------------EAQNTCIKKGWSLVRIDN----EETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC--SKYSPP 3168
            +++Q  T    T+ +A K CQ +G +L+ I +    T +  L         WI  N +  E  +++ NG   +Y  +A G P+     +CV     K   W  ++C+     IC K     T     + ++                 I + K  + +A++ C   G +L  I + + +S + + +        WI  ND + +  F  SD   + + K+  GEP++     E CV  +   +  W D  C   +  IC K++ I+      +++                I  E   +  A+  C+     LV++     N+ + +         +WI  ++      F+ ++K  + F+ +  G P+  Q   CV      +A LW+   C+     IC K       TK   + + +                      E+K  +  A+  C+  G +L    S DE N++ Y  +        WI  + + T   FV+SD    +Y  W  GEPNNY + E C    +Y    WND  C+  N  IC   +  + +    Q                   +YY++   ++ ++A  FC +++  +V I+     + I++        +++I     + +   WVD  G+ +VY +W +NEPN  NN++     +   G WNDI+C      I +    + ++     TI             GK           ++  A + C S+G +L+ I +      +  +   +     WI  ND+N E +F+++DG+ +++ N+A G P +  +         DC   V       G+W    C+     +C +        +     + +  YF        + T +++++EA R C+     L ++ ++  + L +    + K    W+  N     G +  +D   L+Y  W  GEP    N  C+  +   +G W    CS     +      I  T+  ++          K  + F                 A   C++ G S+V +++        +N+  L   +K   +WI  + +  EG+++  +N  + Y+ +    P  YG  DCV  +   +G W    C+   ++IC   K  PP
Sbjct:  229 VVYQRNTQSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLT-NILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPDRRQG--CVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSD----PAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWVD--GSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMML-SASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTT--VSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAMLRFNRFK-EPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPKR--NLACVYID--TDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSK--SFWIGMH-RNHEGEWMWIDNMVVDYTNWAPRMPTAYG--DCVE-VRSDSGLWYTTRCSGYRAYICKTEKVIPP 1355          

HSP 3 Score: 196.438 bits (498), Expect = 2.558e-50
Identity = 236/1104 (21.38%), Postives = 427/1104 (38.68%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGR-YWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIV--------------IFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSKDI----LNSNETIKQQQ-----KYYVHEVLVTYE-----EAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI----YEYESTAEKEITIEIM----------------------EGKVNYIKALELCKSKGYDLIRIENE-EINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXG-------------KIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIIST-------------KELEIFKERV----------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEP-------NNYGNE-DCV---HGLYYSNGFWNDIACNSKNSFICSK------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNY-------WIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDT--------GKEVKKTKYYIHRIGVTFQ----------EALDFCKERRCKLIVVDN------IDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWT 3807
            LT+++A+  C+ QG  L+ I   + +   Y   + N +G   WI  N +  E  ++ S+ N  ++  WA G P+     +CV     K + W  + C      IC K   +   T   + ++                 I   K++++ A   C  +G EL  I + E +S I   +        WI  ND +T+N F +SD   +++ KW  GEP++  N  EDCV  +  K+G W D  C+ ++  IC K        S+E I         +Y  H   +  E     +A   C Q    +V++S    N  +           FWI  ++     ++  +    + + ++    P+       ++      G W+  SC TK   I     E  +T ++  T + +                      E K  + +A + C++ G DL    +E E N + Y  ++       WI  + ++    F++SD    +Y N+++GEPNN N+ E C    FY    WND +C S N  +C             +              + + S+Y+++T R++ ++A  FC+ +   LV I        I     +     Y++ G  +  +  +  +DG+ + Y +W+Q EPN   N++  +  Y + G WND +C      I     N  ++              E   F  +           ++ +A+  CI +G +LV I      Q      + +     WI  ND   E +F+ ++   + ++ + +G P        +YG + DCV          G W    C+ K  FIC +             S    F   + SYK+   K+++ EA  +C        K +++D++ ++ T++    ++ +       WI    +   G++ + D   L +  W        K N  C+Y      G W    C +    +C + S+   T          E K+ K +I   G  +            A   C      ++ V++      I  N+ + +   K     +W+ G  +++EG W+  D   + + NW 
Sbjct:  239 LTWHQARKSCQQQGADLLSI--VELHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPDRRQGCVAMQTG-TSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSI-RSHAEQAFLTTMMLSASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQC--------KADDADLASVLDTVTEALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGE---PKRNLACVYID--TDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSK----SFWI-GMHRNHEGEWMWIDNMVVDYTNWA 1314          

HSP 4 Score: 149.828 bits (377), Expect = 6.014e-36
Identity = 195/900 (21.67%), Postives = 334/900 (37.11%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYKETEPKISAEIELQSK-------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYK------------NTQPKT--SHVIKLLNRELIIL-----QEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICY--------------KESKIEVLKK--ITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKN------------IGSRG----FTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENE--------DC---VHGLYYKNGLWNDIKCDYKNSVICSKDI---LNSNETIKQQQKYY--------VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRF----WINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI----YEYESTAEKEITIEIMEGKV--------------------NYIKALELCKSKGYDLIRIENE-EINKIVYDVAT-KNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            W D  CE     IC K+   K +   E+ S              Y I  + K  F +A   CQ    +L+++     N  + +L        FWI  ++ +    F++ N + + +  F  G P+  R + CV        G W+  SCD     IC K             TQP +  S  IK  +   I +     ++K T+  A  +C++ G  L     +D+ N++ Y  +        WI  + +     F+ SD     Y  ++ GEPNNY   EHC    +Y    WND +C   N  IC                ++K  +     I     +  I  +RL+   A+  CK     LV I  +     ++    +    +Y+I    V ++ +F   D + + ++ W   EPN   N++    +Y     WNDI C      IC ++            I   G    +T F     + V  + +  +  A+  C + G  L+ I S    + +    +  +    WI  ND+  E  F+++D K +++  W  G P +  +         DC   V       G+W    C  K   IC ++I   +    T    + Y+        +    ++++EA   C   +  +  + +  T  +       ++  RF    WI  N  +T G  +WVD+    L Y  WA  EP    N  C+  +   +G W    C    + +     E   T   ++     E K                     N+  A   C   G  ++ +E+  E   I  ++   ++    +WI  +  N EG++++ D   + Y N+A   P      DCV  +   +GLW    C+   + +C
Sbjct:  472 WADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKK-FNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAM-----LRFNRFKEPVWIGLNSNLTSGRYRWVDNW--LLRYTKWAPGEPK--RNLACVYIDT--DGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMHR-NHEGEWMWIDNMVVDYTNWAPRMPTAYG--DCVE-VRSDSGLWYTTRCSGYRAYIC 1347          

HSP 5 Score: 116.701 bits (291), Expect = 1.039e-25
Identity = 167/802 (20.82%), Postives = 303/802 (37.78%), Query Frame = 1
Query: 1702 EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKEIT--------------------IEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXX-------XXGKIDTSK--YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCSTKNSFIYYYI-ENIISTKE---------------------LEIFK----ERVTFEEAQNTCIKKGWSLVRIDNE-ETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN-EDCVHGLYYSNGFWNDIACNSKNSFIC------SKYSPPIIFIDEHM-------------SYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK----------PSKTIDTGKEVKKTKYY---IHRIG----VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNG 3813
            + ++T+ +A   C Q    ++ I  +     I   + N+     WI  N +  E  W  S GN   YLNWA   P+     +C+  N     +W  ++C  K  Y+  +  ST+    +                      I   K+ +  AL  C   G +L  I N E +  +   +      + WI  ND   +  F +SD  ++++  +  GEP++  N  EDCV  +   +G W D  C   +  +C K                   G I  S   Y +      + +A   CQ  +  LV +     +  +++L        +W+  ++ ++   +   +   + + ++N G P+    + C+ +    + G W+  SC TK  +I   + E + +TKE                     + ++K    ++ T+ EA++ C   G  L    +E ETN     L         WI  +       FV S+     Y  +  GEPNNY + E C    +Y    WND AC S N +IC      +  +PP                      Y I  ++++  +A   C+     L+ +   ++  FI   +S R     Y+I G     D  +++ DG  + + +W          + NC+   +++ G W   +C      IC +          P+     G   + T ++      +G     ++ +A  +C  +   L+ + +     +L  +    S +  W+  ND + E  ++ +D K +TF NW  G
Sbjct:  236 QSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLT-NILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPDR--RQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNA----LPYGGSSDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQIS-RGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSM-GFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKG 1025          

HSP 6 Score: 115.931 bits (289), Expect = 1.643e-25
Identity = 146/688 (21.22%), Postives = 264/688 (38.37%), Query Frame = 1
Query: 2077 VNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ-YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSK-------------YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN--EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFK-------------------ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCV-HGLYYSNGFWNDIACNSKNSFICSKYS--------PPI----------IFIDEHMSYKIFI----NKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVN--YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVIC---------YKPSK--------TIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGN-DKDNEGAWIDSDKKKLTFFNWTNGKVNIQKT-QNCLQ-GNPDGKWRDVSCDDKNP 3900
            + + +A + C+ +G DL+ I   E+++  Y     N +G   WI  N ++ E  + +S+G    Y N+A G P+ +   +CV         W  ++CN     +C K            G  D                Y +   ++ + +AL  C      L +I N E    I++ +        W+  ND K +  +   D   + +  W  GEP++  N  EDC+L     +GKW D  C  ++ FI     +I      EI                     E   F +A+ TC +   SLV++     N  +  L        +WI  ++     +F  +N   + ++ F  G P+    + CV      S G W+  +C++K  +IC K +        PP           I  D     +++     +K T+ EA D C++ G  L    + D      T +L Y   +   WI  +    +  + +SD     + NW      +  +  +C  +S     +W   +C S N  IC           P++        T D   +   ++YYI+   ++  +A  FCK+    L+V+       ++W+   + + ++Y++      D   +W+D     + + +W   + N     +NC+      G W D++C    P
Sbjct:  239 LTWHQARKSCQQQGADLLSIV--ELHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRK--GNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMK-GKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPDR--RQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSED-----ETNALPYGGSSDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWVDG--SPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLP 912          

HSP 7 Score: 108.612 bits (270), Expect = 2.574e-23
Identity = 123/614 (20.03%), Postives = 233/614 (37.95%), Query Frame = 1
Query:   10 EHCVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTY----------------ENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-------NNYQKNEHC---VHGLYYSNALWNDISCADSNAVICYK--ESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRY-------WIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKN--IGSRGFTKFEISNKEIVIFEEKVVFK---------------HAQLLCKNNGYELLKIDSDEINSMIYD--FAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            EHC    +Y    WND +CE  +  IC     T PK       Q+K+ I              I  ++ +  +A   C+    +L+ I        ++    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C  +   IC ++    TS        +     E T++                 +A  +C S+G  L+ I      + +  + +       WI  ND+  E  F+ +DGK + +  +A G P        +Y  +  C   V        +W    C++    IC +  +S+I+V +  TV +K            + + +   +  +  K DD    S++        + R+       WI  N     G +   D   ++++KWA GEP   +N  CV+     +  W    C +    +C ++  I      +   +  E    +  + F+               HA + C   G  ++ ++     + I      ++ +  ++WI  +    E  +++ D+  + Y  W P  P  Y   DCV  +   +GLW   +C    + IC
Sbjct:  745 EHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQV-QPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPK--RNLACVY--IDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMHR-NHEGEWMWIDNMVVDYTNWAPRMPTAY--GDCVE-VRSDSGLWYTTRCSGYRAYIC 1347          

HSP 8 Score: 79.337 bits (194), Expect = 2.482e-14
Identity = 94/403 (23.33%), Postives = 154/403 (38.21%), Query Frame = 1
Query: 2839 VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ-YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK-----------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKEN--NNCLYSSETLSGKWLGTSCVSKNSVIC-----YKPSKT---IDTGKEVKKTKYYIHRIGVT-----FQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYW---LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ-KTQNCLQ---GNPDGKWRDVSCDDKNPFFFEFIDEN 3927
            +T+ +A+ +C ++G  L+ I   E ++  Y   + N +G   WI  N    E  +  SN +  +Y  +  G P+     +CV         W  +ACN K  +IC K                 + P          Y I  NK+ +R+A+  C  +G  L  + N +    + + S        WI   D K    + +SD   +TF  W     PS   N   +C+   +   GKW    C  ++  IC      KP+ +   I  G      +Y  H   +      F +A   C++    L+ V     N +L  L   L  EKY+   L+  ++ +   W + +    T FN     V +  + Q C+    G   G W   SCD K  +  + + E 
Sbjct:  239 LTWHQARKSCQQQGADLLSI--VELHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGE-PSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSL-IGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFN-----VGLPDRRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEG 631          
BLAST of Mannose-binding protein C vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 196.052 bits (497), Expect = 4.457e-50
Identity = 250/1158 (21.59%), Postives = 436/1158 (37.65%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--------------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN--EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEI------------SNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV-HGLYYKNGLWNDIKCDYKNSVICSK---DILNSNETIKQQ---------QKYYVHEVLV---------TYEEAINFCNQHNCRIVKI-SNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYEYE-STAEKEITIEIMEGKVN--------------YI--------KALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP--FXXXXXXXXXXGKIDTS-----------KYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEP-------NNYGNE-------------------------DCLL---GNYFANGKWNDFSCSTKNSFI--------YYYIENIISTK--------ELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS------PPIIF--IDEHMSYKIFI------------NKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLS-LRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVIC 3531
            Q   T+  A   C+ +G  L+ I   +L+   Y   +   +G   WI  N +  E  +  S+G    Y  +APG P+  +   +CV       + W  ++C      IC K +    +    V ++                 I + ++ +  A   C   G +L  I + + +S + + +        WI  ND + +  FE SD+  + F+KW  GEP++  N  EDCV  +  K+  W D  CE  +  IC K    +     EI            S+    I  E   F  A+  C+ +   L+++     N+ +           +WI  ++ +  + F +++ + +++  +  G P+    + CV        GLW+   CD K   IC K    +  + E    Q         +K     + V         T+ EA ++C      +    S  ETN + Y  S +      WI  + + T   +V S      Y NW+  EPNNYN+ E C E +FY    WND +C++ N  I +    T  K    +  + K N              YI         A   CK    DL+ I  +   + ++   ++    QY+I    + ++  F + DG  + Y ++   EPN  NN++    ++ + G WNDI+C      +C +   F           K   +           K+       ++ +A ++C      LV+I  S  +   L           W+  ND+  E  ++  DG  + + NW +G P        +YG +                         DC++         G W    CS K  FI               +S+K          ++  E+++++EA+  C      L  + +  T + +  L         WI  N     G++   +N  L+Y+K+  GEP    N  CV+    ++G W    C++    +C + S      PP +     E   +K +I                +  A  +C   G S++ VE+  + +FI   L  L+    ++WI G    ++G+W + D   + + NW    +P+     +C+    + SG W  T C    + IC
Sbjct:  236 QSVLTWHQARKSCQQQGADLLSIV--ELHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPS-LEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIR-SHAEQAFLTTMMLSASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVT-EALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPKR--NLACVY--IDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWI-GMHRNHEGEWMWIDNMVVDYTNW-APRMPT--AYGDCV-EVRSDSGLWYTTRCSGYRAYIC 1371          

HSP 2 Score: 193.356 bits (490), Expect = 2.909e-49
Identity = 238/1175 (20.26%), Postives = 447/1175 (38.04%), Query Frame = 1
Query:  148 IIFQEKT----TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI--------------ILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQK-NEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV------------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA-LWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIF-------------------EEKVVFKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQ------------------QKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEG-KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYE----YESTAEKEITIE---------IMEGKV----------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN---------QNNEDCVHGLF--------------------------YTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYF--------VHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI---------FKERVTFE---------------EAQNTCIKKGWSLVRIDN----EETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC--SKYSPP 3168
            +++Q  T    T+ +A K CQ +G +L+ I +    T +  L         WI  N +  E  +++ NG   +Y  +A G P+     +CV     K   W  ++C+     IC K     T     + ++                 I + K  + +A++ C   G +L  I + + +S + + +        WI  ND + +  F  SD   + + K+  GEP++     E CV  +   +  W D  C   +  IC K++ I+      +++                I  E   +  A+  C+     LV++     N+ + +         +WI  ++      F+ ++K  + F+ +  G P+  Q   CV      +A LW+   C+     IC K       TK   + + +                      E+K  +  A+  C+  G +L    S DE N++ Y  +        WI  + + T   FV+SD    +Y  W  GEPNNY + E C    +Y    WND  C+  N  IC   +  + +    Q                   +YY++   ++ ++A  FC +++  +V I+     + I++        +++I     + +   WVD  G+ +VY +W +NEPN  NN++     +   G WNDI+C      I +    + ++     TI             GK           ++  A + C S+G +L+ I +      +  +   +     WI  ND+N E +F+++DG+ +++ N+A G P +          +++D    ++                             G+W    C+     +C +        +     + +  YF        + T +++++EA R C+     L ++ ++  + L +    + K    W+  N     G +  +D   L+Y  W  GEP    N  C+  +   +G W    CS     +      I  T+  ++          K  + F                 A   C++ G S+V +++        +N+  L   +K   +WI  + +  EG+++  +N  + Y+ +    P  YG  DCV  +   +G W    C+   ++IC   K  PP
Sbjct:  229 VVYQRNTQSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLT-NILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPDRRQG--CVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSD----PAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWVD--GSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMML-SASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTT--VSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAMLRFNRFK-EPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPKR--NLACVYID--TDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSK--SFWIGMH-RNHEGEWMWIDNMVVDYTNWAPRMPTAYG--DCVE-VRSDSGLWYTTRCSGYRAYICKTEKVIPP 1379          

HSP 3 Score: 140.198 bits (352), Expect = 6.631e-33
Identity = 195/924 (21.10%), Postives = 334/924 (36.15%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYKETEPKISAEIELQSK-------------YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMF-YKDGFWNDISCDDTNSVICYK------------NTQPKT--SHVIKLLNRELIIL-----QEKTTYENAIAHCKSKGFQLIKI-DDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICY--------------KESKIEVLKK--ITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKN------------IGSRG----FTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENE--------------------------------DC---VHGLYYKNGLWNDIKCDYKNSVICSKDI---LNSNETIKQQQKYY--------VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRF----WINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI----YEYESTAEKEITIEIMEGKV--------------------NYIKALELCKSKGYDLIRIENE-EINKIVYDVAT-KNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            W D  CE     IC K+   K +   E+ S              Y I  + K  F +A   CQ    +L+++     N  + +L        FWI  ++ +    F++ N + + +  F  G P+  R + CV        G W+  SCD     IC K             TQP +  S  IK  +   I +     ++K T+  A  +C++ G  L     +D+ N++ Y  +        WI  + +     F+ SD     Y  ++ GEPNNY   EHC    +Y    WND +C   N  IC                ++K  +     I     +  I  +RL+   A+  CK     LV I  +     ++    +    +Y+I    V ++ +F   D + + ++ W   EPN   N++    +Y     WNDI C      IC ++            I   G    +T F     + V  + +  +  A+  C + G  L+ I S    + +    +  +    WI  ND+  E  F+++D K +++  W  G P +  +                                 DC   V       G+W    C  K   IC ++I   +    T    + Y+        +    ++++EA   C   +  +  + +  T  +       ++  RF    WI  N  +T G  +WVD+    L Y  WA  EP    N  C+  +   +G W    C    + +     E   T   ++     E K                     N+  A   C   G  ++ +E+  E   I  ++   ++    +WI  +  N EG++++ D   + Y N+A   P      DCV  +   +GLW    C+   + +C
Sbjct:  472 WADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKK-FNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA----WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAM-----LRFNRFKEPVWIGLNSNLTSGRYRWVDNW--LLRYTKWAPGEPK--RNLACVYIDT--DGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMHR-NHEGEWMWIDNMVVDYTNWAPRMPTAYG--DCVE-VRSDSGLWYTTRCSGYRAYIC 1371          

HSP 4 Score: 119.783 bits (299), Expect = 1.095e-26
Identity = 182/859 (21.19%), Postives = 326/859 (37.95%), Query Frame = 1
Query: 1702 EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKEIT--------------------IEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN--EDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXX-------XXGKIDTSK--YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL-LGNYFANGKWNDFSCSTKNSFIYYYI-ENIISTKE---------------------LEIFK----ERVTFEEAQNTCIKKGWSLVRIDNE-ETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN-EDCVHGLYYSNGFWNDIACNSKNSFIC------SKYSPPIIFIDEHM-------------SYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK----------PSKTIDTGKEVKKTKYY---IHRIG----VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNG-KVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDENEQCKE*LLNSLYKNNIKF 3981
            + ++T+ +A   C Q    ++ I  +     I   + N+     WI  N +  E  W  S GN   YLNWA   P+     +C+  N     +W  ++C  K  Y+  +  ST+    +                      I   K+ +  AL  C   G +L  I N E +  +   +      + WI  ND   +  F +SD  ++++  +  GEP++  N  EDCV  +   +G W D  C   +  +C K                   G I  S   Y +      + +A   CQ  +  LV +     +  +++L        +W+  ++ ++   +   +   + + ++N G P+    + C+ +    + G W+  SC TK  +I   + E + +TKE                     + ++K    ++ T+ EA++ C   G  L    +E ETN     L         WI  +       FV S+     Y  +  GEPNNY + E C    +Y    WND AC S N +IC      +  +PP                      Y I  ++++  +A   C+     L+ +   ++  FI   +S R     Y+I G     D  +++ DG  + + +W          + NC+   +++ G W   +C      IC +          P+     G   + T ++      +G     ++ +A  +C  +   L+ + +     +L  +    S +  W+  ND + E  ++ +D K +TF NW  G  V+I          PDG+ R    D  +  FF  + E+ + K     S++   IKF
Sbjct:  236 QSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLT-NILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPDR--RQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNA----LPYGGSSDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQIS-RGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSM-GFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSI----------PDGR-RSYGADSDD--FFRPMWEHSRAKR----SMWIEEIKF 1065          

HSP 5 Score: 97.8265 bits (242), Expect = 5.212e-20
Identity = 123/638 (19.28%), Postives = 232/638 (36.36%), Query Frame = 1
Query:   10 EHCVHGLYYPNALWNDFSCEDPSAVICYKE--TEPKISAEIELQSKYVI--------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTY----------------ENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN----------------EHC------------------VHGLYYSNALWNDISCADSNAVICYK--ESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRY-------WIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKN--IGSRGFTKFEISNKEIVIFEEKVVFK---------------HAQLLCKNNGYELLKIDSDEINSMIYD--FAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            EHC    +Y    WND +CE  +  IC     T PK       Q+K+ I              I  ++ +  +A   C+    +L+ I        ++    +    +++I    + ++ +F +V+G  + Y  + + EPN   N++    ++   GFWNDI+C  +   IC ++    TS        +     E T++                 +A  +C S+G  L+ I      + +  + +       WI  ND+  E  F+ +DGK + +  +A G P +                    EH                   V        +W    C++    IC +  +S+I+V +  TV +K            + + +   +  +  K DD    S++        + R+       WI  N     G +   D   ++++KWA GEP   +N  CV+     +  W    C +    +C ++  I      +   +  E    +  + F+               HA + C   G  ++ ++     + I      ++ +  ++WI  +    E  +++ D+  + Y  W P  P  Y   DCV  +   +GLW   +C    + IC
Sbjct:  745 EHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMT-VGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQV-QPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPK--RNLACVY--IDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMHR-NHEGEWMWIDNMVVDYTNWAPRMPTAY--GDCVE-VRSDSGLWYTTRCSGYRAYIC 1371          
BLAST of Mannose-binding protein C vs. Ensembl Cavefish
Match: ENSAMXT00000045912.1 (macrophage mannose receptor 1-like [Source:NCBI gene;Acc:103025801])

HSP 1 Score: 183.341 bits (464), Expect = 4.446e-46
Identity = 244/1017 (23.99%), Postives = 404/1017 (39.72%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMI--YDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE--NEDCVHGLYYKNGLWNDIKCDYKNSVICSK-----DILNSNETIKQQQK---------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMK-----IGRFWINGNDIITEGKWVD---SKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPN-GEWNDISCKTKNYLIYEYESTAEK----------------------------EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ-NNEDCVHGLFYTNG--LWNDISCNSINSVLCY---------KPFXXXXXXXXXXGKIDTSK-------YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIK-KEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFE--------EAQNTC-----------IKKGWSLVRIDNEETNQNIYDLAV--------------KNKIGQYWIDANDKAVEGKFVDSNN-HALKYSKFPRGEPNNY-GNEDCV-----HGLYYSNGFWNDIACNSKNSFICSK------YSPPII---FIDEHMS-----YKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLY---SSETLSGKWLGTSCVSKNSVICY----KPSKTIDTG--------KEVKKTKYYIH--RIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY---WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ----KTQNCLQGNPDGKWRDVSCDDKNPF 3903
            F+ K  +  A+  C+  G +L+ I S    S +  Y +    ++   WI  ND++    F++S++ ++++  W PGEPNN+   NEDCV  +Y  NG WND+ C   N+ IC        + +   T+    +         Y++ E  +T  EA  FC   +    K S++     +YE +          G +WI G     E   VD     G+ +VY +W +N+P +     C+     P  G W + +C   +  I E                                    +  E    K ++  A E C ++G DL+ I N E  +I     TK K    WI  +   +EG +++SDG  +S+ N+  GEPN+    E+CV  +   NG   WNDI C++    +C           P         + G     +       Y+  T  V +  AL  C      L +I + E    I+++    +I+  W+         GE++ +D + + Y++W  GEPNN  G E C+  N +  G WND +C    +    Y+   +  +          +E           N C           IK  WS  R D   + Q   DLAV              ++ I   WI  +D   E KF  S+    + ++ +   EPNN  G E CV     H L    G WND  CN +  ++C +       +PP        +++S     YK+      + +A   C  EG  L  V+ S D +FI  + +++ +  + WI    ++    + ++DG  + + +W     P+  +   C+     S  + G W  T+C      IC     KP  T   G            +  Y+++  + G ++ EA  +C+  +   +   +    +   E  + ++  KY   WL G  +D    W  +D   L F NW  G+ N        ++C++  PDG W D +C  K  F
Sbjct: 1039 FDVKKTWYDARSECRKLGADLVSIMSITEQSWLESYLYLATSDV---WIGLNDLEFSGYFLWSNNHEVTFTYWAPGEPNNHLGFNEDCVE-MYQGNGRWNDVTCTELNTFICKMTKGHYPLPSIKPTVYGCPQGWDAFEYSCYWLEETAMTRAEAKTFCETKD----KDSSLLHIGDLYEQAHFTARLASYSGHWWI-GLRAKGESAGVDYYWDNGDFMVYSHWDRNQPES-GAGPCVTMTTKPTAGFWVNRNCDQSHPFICEIPRDGISPPTKAPTPPPATGCATGWTSLPHFRQCYRLYTEEYTNKKSWAGAHEDCVARGADLVSIHNAE-EEIFMAEYTKGKT--QWIGLSRNALEGDYLWSDGSALSHTNWGPGEPNDHAGRENCVELVTTQNGSSYWNDIFCDAHQDWVCMIAKGKTPTEPPVPPSAIPAPDCGSNPGWRKNNGICYYYNDTEAVDFFTALERCFHEKALLASILSPEEQTYIVSMVGTGQIAAAWIGMQMFGVAGGEYIWVDLSPITYVHWAPGEPNNANGEEQCVQMNRYP-GTWNDANCGRATAG---YVCKKLPGEHHTPPPPTQPWEGNCPEGWMRFHNKCYLFKGNHYNNEIKANWSYAR-DWCRSQQG--DLAVIDDINENDFVASYLRDMIHPVWIGLSDVLHEDKFAWSDGVSPVLFTNWAEKEPNNNDGKEHCVSINHNHLL---TGRWNDENCNEERGWVCYRKKDSHLPAPPTTKSPCPSDYVSWYKNCYKLVSEHKNWADAEAACVKEGGHLASVDMSYDQAFI--SGAIQQERTDAWIGLKRNEETSTYQWTDGWPVFYTHWGPGE-PTIHKGEGCVSMHGRSHFIQGTWNDTACDVAKPYICKITFEKPPVTPAPGDGECMPGFSHYGRYCYFVYNGKTGFSWPEARHYCQLIKGGDLASVHSRAEV---EFIRNINYTKYHNVWL-GLTRDGSLGWGWTDLTALAFTNWAPGEPNEAYHDLGMEDCVEMYPDGTWNDNNCFQKRGF 2025          

HSP 2 Score: 176.792 bits (447), Expect = 4.695e-44
Identity = 225/970 (23.20%), Postives = 376/970 (38.76%), Query Frame = 1
Query:  931 FKERLTYYKAQDLCKSQGYKLVKIDD--EQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ--NEDCVHGLYYKNALWNDIKCEDLNAVICYKNIG--------------SRGFTKFEISNKEIVIFEEKVVFK-HAQLLC--KNNGYELLKIDSDEINSMIYDFAVKHNIGTYWID--ANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC--SKDILN-------------------SNETIKQQQKYYVHEVL--VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY-NNEDCLEGNFYPNGE--WNDISCKTKN---YLIYEYESTAEKEITIEIMEGK-----------------------VNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEG-QFIYSDGQNISYRNFAHGEPNNQNNED-CVHGLFYTNGLWNDISCNSINS-VLCYKPFXXXXXXXXXXGKIDTS----------KYFVHTG-------RVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDG-NKLKYLNWNQGEPNNY-GNEDCLL--GNYFANGKWNDFSCSTKNSFIYY-----YIENIISTKE-------------LEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCV--HGL-YYSNGFWNDIACNSKNSFIC--SKYSPPIIF----------IDEHMSYKIFI----NKVTYREAVDKCQS-EGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTA 3426
            F  + T+Y A+  C+  G  LV I    EQ     Y Y   +++   WI  ND+   G F  S+ +++ F+ WA GEPNN+   NEDCV  +Y  N  WND+ C +LN  IC    G               +G+  FE S       EE  + +  A+  C  K+    LL I  D      +   +    G +WI   A        + + +   + Y  W   +P +              G W +  CD  +  IC   +D ++                   S    +Q  + Y  E     ++  A   C      +V I N E    + E++K       WI  +    EG ++ S G+ L + NW   EPN++   E+C+E     NG   WNDI C        +I + ++  E  +    +                          V++  ALE C  +   L  I + E    +  +    ++   WI      V G ++I+ D   I+Y ++A GEPNN N E+ CV    Y  G WND +C    +  +C K   E           + +          K ++  G       +  +  A  +C+     L  I++   +  + +  R   I   W+  +D+  E ++   DG + + + NW + EPNN  G E C+    N+   G+WND +C+ +  ++ Y     ++    +TK               ++  E   + +A+  C+K+G  L  +D    +Q     A++ +    WI          +  ++   + Y+ +  GEP  +  E CV  HG  ++  G WND AC+    +IC  +   PP+               +  Y  F+       ++ EA   CQ  +G  L  V + +++ FI +    +Y   N W+  T   + G W ++D   L F NW   
Sbjct: 1039 FDVKKTWYDARSECRKLGADLVSIMSITEQSWLESYLYLATSDV---WIGLNDLEFSGYFLWSNNHEVTFTYWAPGEPNNHLGFNEDCVE-MYQGNGRWNDVTCTELNTFICKMTKGHYPLPSIKPTVYGCPQGWDAFEYS---CYWLEETAMTRAEAKTFCETKDKDSSLLHI-GDLYEQAHFTARLASYSGHWWIGLRAKGESAGVDYYWDNGDFMVYSHWDRNQPESGAGPCVTMTTKPTAGFWVNRNCDQSHPFICEIPRDGISPPTKAPTPPPATGCATGWTSLPHFRQCYRLYTEEYTNKKSWAGAHEDCVARGADLVSIHNAEEEIFMAEYTKGKTQ---WIGLSRNALEGDYLWSDGSALSHTNWGPGEPNDHAGRENCVELVTTQNGSSYWNDIFCDAHQDWVCMIAKGKTPTEPPVPPSAIPAPDCGSNPGWRKNNGICYYYNDTEAVDFFTALERCFHEKALLASILSPEEQTYIVSMVGTGQIAAAWIGMQMFGVAGGEYIWVDLSPITYVHWAPGEPNNANGEEQCVQMNRYP-GTWNDANCGRATAGYVCKKLPGEHHTPPPPTQPWEGNCPEGWMRFHNKCYLFKGNHYNNEIKANWSYARDWCRSQQGDLAVIDDINENDFVASYLRD-MIHPVWIGLSDVLHEDKFAWSDGVSPVLFTNWAEKEPNNNDGKEHCVSINHNHLLTGRWNDENCNEERGWVCYRKKDSHLPAPPTTKSPCPSDYVSWYKNCYKLVSEHKNWADAEAACVKEGGHLASVD-MSYDQAFISGAIQQERTDAWIGLKRNEETSTYQWTDGWPVFYTHWGPGEPTIHKGEGCVSMHGRSHFIQGTWNDTACDVAKPYICKITFEKPPVTPAPGDGECMPGFSHYGRYCYFVYNGKTGFSWPEARHYCQLIKGGDLASVHSRAEVEFIRNINYTKYH--NVWLGLTRDGSLG-WGWTDLTALAFTNWAPG 1991          

HSP 3 Score: 174.866 bits (442), Expect = 1.783e-43
Identity = 225/1008 (22.32%), Postives = 374/1008 (37.10%), Query Frame = 1
Query:  154 FQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHA-GRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR--NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ-----PKTSHVIKLLNRELIILQEKTTY--ENAIAHCKSKGFQLIKIDDDQL-------NSMVYNLAVQYQIGRYWID--ANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNA-LWNDISCADSNAVIC-----------------YKESKIEVLKKITVLNKELVIFKERLT----YYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKN--ALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFE----------------------EKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENT-FVYSDSKKISYQKWYPGEPNNYENED-CVHGLYYKNGLWNDIKCDYKNSVICSKDILNS-----------------------NETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKG-NKLVYLNWAKNEPNNYNN-EDCLE--GNFYPNGEWNDISC-KTKNYLIYEYESTAEKEITI-----------------EIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCV--HGL-FYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTY-----------EEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGE--WVNIDGNKLKYLNWNQGEPN----NYGNEDCLLGNYFANGKWNDFSCSTKNSF 2778
            F  K T+ +A   C+  G +L+ I       Q +  +  Y A    WI  ND++  G F + N   + +  +A GEPNN+   NEDCV  M+  +G WND++C + N+ IC K T+     P     +    +     +    +  E A+   ++K F   K  D  L           +   +    G +WI   A       ++   +G  +VY  +   +P +      CV       A  W + +C  S+  IC                            +    +   ++ E  T    +  A + C ++G  LV I + +    +  Y         WI  +   +EG +  SD + +  + W  GEPN++   E+CV  +  +N  + WNDI C+     +C   + ++G T  E       I                        E V F  A   C +    L  I S E  + I        I   WI           +++ D   I+Y  W PGEPNN   E+ CV    Y  G WND  C    +    K +                          N+    +  +Y +E+   +  A ++C      +  I ++  N  +  + ++M I   WI  +D++ E K+  S G + +++ NWA+ EPNN +  E C+    N    G WND +C + + ++ Y  + +                        +++    N+  A   C  +G  L  ++    ++     A + +    WI          + ++DG  + Y ++  GEP     E CV  HG   +  G WND +C+     +C   F E        G  +    F H GR  Y            EA  +CQ+     +   +S  ++  +      K    WL    + ++G   W   D   L + NW  GEPN    + G EDC+    + +G WND +C  K  F
Sbjct: 1039 FDVKKTWYDARSECRKLGADLVSIM--SITEQSWLESYLYLATSDVWIGLNDLEFSGYFLWSNNHEVTFTYWAPGEPNNHLGFNEDCVE-MYQGNGRWNDVTCTELNTFIC-KMTKGHYPLPSIKPTVYGCPQGWDAFEYSCYWLEETAMTRAEAKTFCETKDKDSSLLHIGDLYEQAHFTARLASYSGHWWIGLRAKGESAGVDYYWDNGDFMVYSHWDRNQPES--GAGPCVTMTTKPTAGFWVNRNCDQSHPFICEIPRDGISPPTKAPTPPPATGCATGWTSLPHFRQCYRLYTEEYTNKKSWAGAHEDCVARGADLVSIHNAEEEIFMAEYTKGKT---QWIGLSRNALEGDYLWSDGSALSHTNWGPGEPNDHAGRENCVELVTTQNGSSYWNDIFCDAHQDWVC---MIAKGKTPTEPPVPPSAIPAPDCGSNPGWRKNNGICYYYNDTEAVDFFTALERCFHEKALLASILSPEEQTYIVSMVGTGQIAAAWIGMQMFGVAGGEYIWVDLSPITYVHWAPGEPNNANGEEQCVQMNRYP-GTWNDANCGRATAGYVCKKLPGEHHTPPPPTQPWEGNCPEGWMRFHNKCYLFKGNHYNNEIKANWSYARDWCRSQQGDLAVIDDINENDFVASYLRDM-IHPVWIGLSDVLHEDKFAWSDGVSPVLFTNWAEKEPNNNDGKEHCVSINHNHLLTGRWNDENCNEERGWVCYRKKDSHLPAPPTTKSPCPSDYVSWYKNCYKLVSEHKNWADAEAACVKEGGHLASVD-MSYDQAFISGAIQQERTDAWIGLKRNEETSTYQWTDGWPVFYTHWGPGEPTIHKGEGCVSMHGRSHFIQGTWNDTACDVAKPYICKITF-EKPPVTPAPGDGECMPGFSHYGRYCYFVYNGKTGFSWPEARHYCQLIKGGDLASVHSRAEVEFIRNINYTKYHNVWL---GLTRDGSLGWGWTDLTALAFTNWAPGEPNEAYHDLGMEDCV--EMYPDGTWNDNNCFQKRGF 2025          

HSP 4 Score: 160.229 bits (404), Expect = 6.266e-39
Identity = 170/704 (24.15%), Postives = 281/704 (39.91%), Query Frame = 1
Query:  142 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRF-WIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDG--FWNDISCDDTNSVICY--KNTQPKTSHVIKLL--------------NRELIIL---QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGN-FISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITV--------------LNKELVIFKE-------RLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDK-NKIKFSKWAAGEPNNYQNEDCVHGLYYKNAL---WNDIKCEDLNAVICYK----NIGSRGFTKFEISNKEIVIFEE--KVVFKH-----AQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV--HGL-YYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQ-------KYYVHEVLVTYEEAINFC---NQHNCRIVKISNVET--NKIIYEWSKNMKIGRF---WINGNDIITEGKWVDSKGNKLVYLNWAKNEPN----NYNNEDCLEGNFYPNGEWNDISCKTK 2007
            Y   +  K ++  A++ C A+G +L+ I     N +      +Y  G+  WI  +   +EG + + +G  + +  +  GEPN++   E+CV  +  ++G  +WNDI CD     +C   K   P    V                  N  +       E   +  A+  C  +   L  I   +  + + ++    QI   WI        G  +I  D   I Y  +APGEPNN    E CV    Y    WND +C  + A    K+   E                      + +  +FK        +  +  A+D C+SQ   L  IDD   N  V +Y +++ I   WI  +DV  E  F  SD  + + F+ WA  EPNN   ++    + + + L   WND  C +    +CY+    ++ +   TK    +  +  ++   K+V +H     A+  C   G  L  +D     + I   A++      WI     +  +T+ ++D   + Y  W PGEP  ++ E CV  HG  ++  G WND  CD     IC         T             +Y       Y     F     +H C+++K  ++ +  ++   E+ +N+   ++   W+      + G W  +    L + NWA  EPN    +   EDC+E   YP+G WND +C  K
Sbjct: 1329 YTEEYTNKKSWAGAHEDCVARGADLVSIH----NAEEEIFMAEYTKGKTQWIGLSRNALEGDYLWSDGSALSHTNWGPGEPNDHAGRENCVELVTTQNGSSYWNDIFCDAHQDWVCMIAKGKTPTEPPVPPSAIPAPDCGSNPGWRKNNGICYYYNDTEAVDFFTALERCFHEKALLASILSPEEQTYIVSMVGTGQIAAAWIGMQMFGVAGGEYIWVDLSPITYVHWAPGEPNNANGEEQCVQMNRYP-GTWNDANCGRATAGYVCKKLPGEHHTPPPPTQPWEGNCPEGWMRFHNKCYLFKGNHYNNEIKANWSYARDWCRSQQGDLAVIDDINENDFVASY-LRDMIHPVWIGLSDVLHEDKFAWSDGVSPVLFTNWAEKEPNNNDGKEHCVSINHNHLLTGRWNDENCNEERGWVCYRKKDSHLPAPPTTKSPCPSDYVSWYKNCYKLVSEHKNWADAEAACVKEGGHLASVDMSYDQAFI-SGAIQQERTDAWIGLKRNEETSTYQWTDGWPVFYTHWGPGEPTIHKGEGCVSMHGRSHFIQGTWNDTACDVAKPYICKITFEKPPVTPAPGDGECMPGFSHYGRYCYFVYNGKTGFSWPEARHYCQLIKGGDLASVHSRAEVEFIRNINYTKYHNVWLGLTRDGSLG-WGWTDLTALAFTNWAPGEPNEAYHDLGMEDCVE--MYPDGTWNDNNCFQK 2022          

HSP 5 Score: 123.25 bits (308), Expect = 1.024e-27
Identity = 159/719 (22.11%), Postives = 290/719 (40.33%), Query Frame = 1
Query: 2047 EITIEIMEGKVNYIKALELCKSKGYDLIRI----ENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ--NNEDCVHGLFYTNGLWNDISCNSINSVLC-----YKPFXXXXXXXXXXGK----IDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNID-----GNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIIST-----------------KELEIFKE--RVTFEE---------AQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNG--FWNDIACNSKNSFIC------SKYSPPI----IFIDEHMS------------YKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWID-GTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNS-VICYK-PSKTIDTGKE--------------------VKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGND--KDNEGAWIDSDKKKLTFFNWTNGKV-NIQKTQNCLQGNPD----GKWRDVSCDDK 3894
            E      + K  +  A   C+  G DL+ I    E   +   +Y +AT +     WI  ND+   G F++S+   +++  +A GEPNN    NEDCV  ++  NG WND++C  +N+ +C     + P    K       +     + S Y++    +T  EA  FC+        +   +L       AR    SG+W  G  ++ +GE   +D     G+ + Y +W++ +P +       +      G W + +C   + FI     + IS                    L  F++  R+  EE         A   C+ +G  LV I N E  + I+ +A   K    WI  +  A+EG ++ S+  AL ++ +  GEPN++ G E+CV  +   NG  +WNDI C++   ++C      +   PP+    I   +  S            Y      V +  A+++C  E   L  + + +    + ++    ++   WI         G++ + D   +T+ +W     P++              G W   +C    +  +C K P +                           + K  +Y + I   +  A D+C+ ++  L V+D+I+ N ++    + + I   W+  +D   +++ AW D     L F NW   +  N    ++C+  N +    G+W D +C+++
Sbjct: 1033 EFCYRPFDVKKTWYDARSECRKLGADLVSIMSITEQSWLESYLY-LATSD----VWIGLNDLEFSGYFLWSNNHEVTFTYWAPGEPNNHLGFNEDCVE-MYQGNGRWNDVTCTELNTFICKMTKGHYPLPSIKPTVYGCPQGWDAFEYSCYWLEETAMTRAEAKTFCETKDKDSSLLHIGDLYEQAHFTARLASYSGHWWIG--LRAKGESAGVDYYWDNGDFMVYSHWDRNQPESGAGPCVTMTTKPTAGFWVNRNCDQSHPFICEIPRDGISPPTKAPTPPPATGCATGWTSLPHFRQCYRLYTEEYTNKKSWAGAHEDCVARGADLVSIHNAE--EEIF-MAEYTKGKTQWIGLSRNALEGDYLWSDGSALSHTNWGPGEPNDHAGRENCVELVTTQNGSSYWNDIFCDAHQDWVCMIAKGKTPTEPPVPPSAIPAPDCGSNPGWRKNNGICYYYNDTEAVDFFTALERCFHEKALLASILSPEEQTYIVSMVGTGQIAAAWIGMQMFGVAGGEYIWVDLSPITYVHWAPGE-PNNANGEEQCVQMNRYPGTWNDANCGRATAGYVCKKLPGEHHTPPPPTQPWEGNCPEGWMRFHNKCYLFKGNHYNNEIKANWSYARDWCRSQQGDLAVIDDINENDFVASYLRDM-IHPVWIGLSDVLHEDKFAWSDGVSPVL-FTNWAEKEPNNNDGKEHCVSINHNHLLTGRWNDENCNEE 1737          

HSP 6 Score: 120.168 bits (300), Expect = 9.546e-27
Identity = 158/663 (23.83%), Postives = 268/663 (40.42%), Query Frame = 1
Query: 1831 FWINGNDIITEGKWVDSKGNKL-VYLN-WAKNEPNNY-NNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEG---------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWIN---------ANDINVEGQ-FIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN-----GLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGR---VTYEEALRFCQIHSCRLVTIENSELDILI-LNLARKHK--ISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNN----YGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYI--ENIISTKELEI---------------FKERV--TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVH---GLYYSNGFWNDIACNSKNSFICSKYSPPII------------------FIDEHMSYKIFINKVTYR---EAVDKCQSEGYSLIKV-ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTID 3555
            FWI  NDI++EG W  S G+    YL  W + +P+NY +NEDC + +   NG+WND  C +K   I   ++        +   G               + ++I A   C  +G DL+ I++    + V      + +   WI          +  I V+G  F +SD  + SY N+ +G+P+  + ++ V      +     G W    C      LC +       E         + Y V +      ++ +A   C   + +L+TI + +    I   L   H+  I   W+  +D+ ++G +  +D   +++ NWN G P N    +       GNY   GKW   +C    ++I      +NI  T   +                F+  +  T++EA+  C+ +   L  I N+ET   I     ++     W+  ND   EG++  ++  A+   ++  G+P+N+  NEDCVH     ++  G  ND+ C S   FIC K                          D    Y    N ++ R   EA   C ++G  L+ + E  +  FI   +      V+ W+ G DS  +G W ++D     + NW + + P D    +CL +    SG W   +C  K   +C +   T +
Sbjct:   21 FWIGLNDIVSEGNWEWSDGSVYYPYLAYWREGQPDNYLDNEDCGQVDGNNNGQWNDEHCTSKRPYICRRDN-PNPTPQCDTANGWEQYGSNCYKLNSQLRKSWIAARTDCVMEGGDLVSIQSAAEQQYVISRLDHSPL-DMWIGYSTLKCTTLSCQIQVDGTTFSWSDSSSSSYTNWPNGQPDLTDKQNGVCASMIKDAGDEYGKWKTHVCRYERPYLCKRGLNTICPEGWL--SFGGNCYLVVSNNYLLTSWHQAFSRCNSMNGKLLTITSEDEQFFINAQLPDLHQVDIPDVWIGISDMAQDGAFKWVDNTDIQFSNWNSGFPKNTEVYWDCGQIFTGNY--AGKWETTNCFKNMAYICKMTGGQNIQPTAAPDFHCDEGYLLYGNYCYHFEAEMSKTWQEAEAYCVSQSGHLASIPNQETTSFITAHMPRSS----WVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVHIRGTEHWETGKLNDLPCTSTFPFICQKAKGQGPPPVPPTSGPGWNEKCGSWVADPFNDYCYLFNSLSLRKWAEARADCVNQGGDLLSITEPFEQGFIQAQIQSIPNGVSLWMGGHDSVTEGGWEWTDRAPFRYINWASGN-PDDYYGEDCL-TIYINSGYWNDDNCDYKRGYVCKRRGNTPE 671          

HSP 7 Score: 117.087 bits (292), Expect = 8.893e-26
Identity = 156/671 (23.25%), Postives = 264/671 (39.34%), Query Frame = 1
Query:  646 LAVQYQIGR--YWIDANDMQNEGNFISSDGKKIVYRKFA---PGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITV------------LNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWID---------ANDVRIEGT-FEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA-----LWNDIKCEDLNAVICYKNIGS---RGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGY--ELLKIDSDE----INSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENE-DCVHGLYYKN--GLWNDIKCDYKNSVIC-----------SKDILNSNETIKQQQKYYVH---EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY-NNEDCLE---GNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVN-------------------------YIKALELCKSKGYDLIRI-ENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK 2394
            L V  QIG   +WI  ND+ +EGN+  SDG  + Y   A    G+P+NY  NE C      +N  WND  C      IC +++     +  T             LN +L     R ++  A+  C  +G  LV I        V +    + +   WI          +  ++++GT F  SD +   ++ W  G+P+    ++ V     K+A      W    C      +C + + +    G+  F   N  +V+    ++    Q   + N    +LL I S++    IN+ + D   + +I   WI  +D+  +  F + D+  I +  W  G P N E   DC   ++  N  G W    C    + IC           +    + +E       Y  H   E+  T++EA  +C   +  +  I N ET   I   + +M     W+  NDI  EG+W  + G+ +  L W   +P+N+ +NEDC+       +  G+ ND+ C +    I +                  N                         + +A   C ++G DL+ I E  E   I   + +       W+  +D   EG + ++D     Y N+A G P++   EDC+  ++  +G WND +C+     +C +
Sbjct:   10 LWVSTQIGTTIFWIGLNDIVSEGNWEWSDGS-VYYPYLAYWREGQPDNYLDNEDCGQVDGNNNGQWNDEHCTSKRPYICRRDNPNPTPQCDTANGWEQYGSNCYKLNSQL-----RKSWIAARTDCVMEGGDLVSIQSAAEQQYVISRLDHSPL-DMWIGYSTLKCTTLSCQIQVDGTTFSWSDSSSSSYTNWPNGQPDLTDKQNGVCASMIKDAGDEYGKWKTHVCRYERPYLCKRGLNTICPEGWLSFG-GNCYLVVSNNYLLTSWHQAFSRCNSMNGKLLTITSEDEQFFINAQLPDLH-QVDIPDVWIGISDMAQDGAFKWVDNTDIQFSNWNSGFPKNTEVYWDCGQ-IFTGNYAGKWETTNCFKNMAYICKMTGGQNIQPTAAPDFHCDEGYLLYGNYCYHFEAEMSKTWQEAEAYCVSQSGHLASIPNQETTSFI---TAHMPRSS-WVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVHIRGTEHWETGKLNDLPCTSTFPFICQKAKGQGPPPVPPTSGPGWNEKCGSWVADPFNDYCYLFNSLSLRKWAEARADCVNQGGDLLSITEPFEQGFIQAQIQSIPNGVSLWMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDCLT-IYINSGYWNDDNCDYKRGYVCKR 665          

HSP 8 Score: 115.161 bits (287), Expect = 3.187e-25
Identity = 136/603 (22.55%), Postives = 238/603 (39.47%), Query Frame = 1
Query:   40 NALWNDFSCEDPSAVICYKETEPKISAEIELQSK--------YVIIFQEKTTFTEANKLCQAKGYNLIKIED--------DQFNTQVYNLAIQYHAGRFWIDANDIKVEG-TFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKD-----GFWNDISCDDTNSVICYK--NTQPKTSHVIKLLNRELIILQE--KTTYENAIAHCKSKGFQLIKI--DDDQ--LNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSN--ALWNDISCADSNAVICYKESKIEVLKKIT----------VLNKELVIFKERL--TYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ-NEDCVH---GLYYKNALWNDIKCEDLNAVICYKNIGSR----------------GFTKFEISNKEIVIFEEKVVFKHAQLL--CKNNGYELLKIDSD-EINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSK 1647
            N  WND  C      IC ++  P  + + +  +         Y +  Q + ++  A   C  +G +L+ I+          + +    ++ I Y   +    +  I+V+G TF + +     Y  +  G+P+    ++ V     KD     G W    C      +C +  NT      +    N  L++      T++  A + C S   +L+ I  +D+Q  +N+ + +L  Q  I   WI  +DM  +G F   D   I +  +  G P N +    C   ++  N    W   +C  + A IC       +               +       F+  +  T+ +A+  C SQ   L  I +++  S +  +  +++    W+  ND+  EG ++ +D + I   +W  G+P+N+Q NEDCVH     +++    ND+ C      IC K  G                  G    +  N    +F    + K A+    C N G +LL I    E   +        N  + W+  +D  TE  + ++D     Y  W  G P++Y  EDC+  +Y  +G WND  CDYK   +C +
Sbjct:   71 NGQWNDEHCTSKRPYICRRDN-PNPTPQCDTANGWEQYGSNCYKLNSQLRKSWIAARTDCVMEGGDLVSIQSAAEQQYVISRLDHSPLDMWIGYSTLKCTTLSCQIQVDGTTFSWSDSSSSSYTNWPNGQPDLTDKQNGVCASMIKDAGDEYGKWKTHVCRYERPYLCKRGLNTICPEGWLSFGGNCYLVVSNNYLLTSWHQAFSRCNSMNGKLLTITSEDEQFFINAQLPDLH-QVDIPDVWIGISDMAQDGAFKWVDNTDIQFSNWNSGFPKNTEVYWDCGQ-IFTGNYAGKWETTNCFKNMAYICKMTGGQNIQPTAAPDFHCDEGYLLYGNYCYHFEAEMSKTWQEAEAYCVSQSGHLASIPNQETTSFITAHMPRSS----WVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVHIRGTEHWETGKLNDLPCTSTFPFICQKAKGQGPPPVPPTSGPGWNEKCGSWVADPFNDYCYLFNSLSLRKWAEARADCVNQGGDLLSITEPFEQGFIQAQIQSIPNGVSLWMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDCLT-IYINSGYWNDDNCDYKRGYVCKR 665          

HSP 9 Score: 88.9669 bits (219), Expect = 3.052e-17
Identity = 143/664 (21.54%), Postives = 249/664 (37.50%), Query Frame = 1
Query: 2170 VATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAH---GEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTG----------RVTYEEALRFCQIHSCRLVTIENS-ELDILILNLARKHKISGYWLDGNDIK--KEGEWVNIDGNKLK--------YLNWNQGEPNNYGNEDCLLGNYFAN-----GKWNDFSCSTKNSFIYYYIENIISTKELEIFKER-----------VTFEEAQNTCIKKGWSLVRIDNEE----TNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNE-DCVHGLYYSN--GFWNDIACNSKNSFIC--------SKYSPPIIFIDEHMSYKIFIN---------KVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSET---LSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEAL-DFC-----------KERRCK--------LIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPD-GKWRDVSCDDK 3894
            V+T+     +WI  NDI  EG + +SDG ++ Y   A+   G+P+N  +NEDC       NG WND  C S    +C +      D      + DT+  +   G          R ++  A   C +    LV+I+++ E   +I  L   H     W+  + +K       + +DG            Y NW  G+P+    ++ +  +   +     GKW    C  +  ++     N I  +    F               ++ +A + C      L+ I +E+     N  + DL  +  I   WI  +D A +G F   +N  +++S +  G P N     DC   ++  N  G W    C    ++IC           + P    DE   Y ++ N           T++EA   C S+   L  + N + +  +     R    + W+   D   +G+W ++DG  +T   W+T    + ++N +C++   T    +GK     C S    IC K                +  + G    +   D+C            E R          L + +  +      ++    +    W+ G+D   EG W  +D+    + NW +G  +    ++CL    + G W D +CD K
Sbjct:   12 VSTQIGTTIFWIGLNDIVSEGNWEWSDG-SVYYPYLAYWREGQPDNYLDNEDCGQVDGNNNGQWNDEHCTSKRPYICRR------DNPNPTPQCDTANGWEQYGSNCYKLNSQLRKSWIAARTDCVMEGGDLVSIQSAAEQQYVISRL--DHSPLDMWIGYSTLKCTTLSCQIQVDGTTFSWSDSSSSSYTNWPNGQPDLTDKQNGVCASMIKDAGDEYGKWKTHVCRYERPYLCKRGLNTICPEGWLSFGGNCYLVVSNNYLLTSWHQAFSRCNSMNGKLLTITSEDEQFFINAQLPDLH-QVDIPDVWIGISDMAQDGAFKWVDNTDIQFSNWNSGFPKNTEVYWDCGQ-IFTGNYAGKWETTNCFKNMAYICKMTGGQNIQPTAAPDFHCDE--GYLLYGNYCYHFEAEMSKTWQEAEAYCVSQSGHLASIPNQETTSFITAHMPR----SSWVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVHIRGTEHWETGKLNDLPCTSTFPFICQKAKGQGPPPVPPTSGPGWNEKCGSWVADPFNDYCYLFNSLSLRKWAEARADCVNQGGDLLSITEPFEQGFIQAQIQSIPNGVSLWMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDCLTIYINSGYWNDDNCDYK 658          

HSP 10 Score: 88.1965 bits (217), Expect = 5.509e-17
Identity = 112/508 (22.05%), Postives = 202/508 (39.76%), Query Frame = 1
Query: 2593 YWLDGNDIKKEGEWVNIDGNKL-KYLN-WNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIF---------------KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWID---------ANDKAVEGK-FVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSN-----GFWNDIACNSKNSFICSK----YSPPIIFIDEHMSYKIFINK---VTYREAVDKCQSEGYSLIKVENSDISFIVHTLSL---RYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKE---NNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTK------------------YYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKV-NIQKTQNC--LQGN---PDGKWRDVSCDDKNPFF 3906
            +W+  NDI  EG W   DG+    YL  W +G+P+NY  NEDC   +   NG+WND  C++K  +I    +N   T + +                 + R ++  A+  C+ +G  LV I +    Q +      + +   WI          +    V+G  F  S++ +  Y+ +P G+P+    ++ V      +     G W    C  +  ++C +      P          Y +  N     ++ +A  +C S    L+ + + D  F ++       +  + + WI  +D   DG + + D   + F NW +   P + E   +   +++    +GKW  T+C    + IC      +  G+ ++ T                   ++   +  T+QEA  +C  +   L  + N +T  ++     + S    W+  ND D EG W  +D   +T   W  G+  N Q  ++C  ++G      GK  D+ C    PF 
Sbjct:   21 FWIGLNDIVSEGNWEWSDGSVYYPYLAYWREGQPDNYLDNEDCGQVDGNNNGQWNDEHCTSKRPYICRR-DNPNPTPQCDTANGWEQYGSNCYKLNSQLRKSWIAARTDCVMEGGDLVSIQSAAEQQYVISRLDHSPL-DMWIGYSTLKCTTLSCQIQVDGTTFSWSDSSSSSYTNWPNGQPDLTDKQNGVCASMIKDAGDEYGKWKTHVCRYERPYLCKRGLNTICPEGWLSFGGNCYLVVSNNYLLTSWHQAFSRCNSMNGKLLTITSEDEQFFINAQLPDLHQVDIPDVWIGISDMAQDGAFKWVDNTDIQFSNWNSG-FPKNTEVYWDCGQIFTG-NYAGKWETTNCFKNMAYIC-----KMTGGQNIQPTAAPDFHCDEGYLLYGNYCYHFEAEMSKTWQEAEAYCVSQSGHLASIPNQETTSFITAHMPRSS----WVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVHIRGTEHWETGKLNDLPCTSTFPFI 515          

HSP 11 Score: 64.3142 bits (155), Expect = 9.703e-10
Identity = 79/331 (23.87%), Postives = 126/331 (38.07%), Query Frame = 1
Query:   10 EHCV-----HGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSK----YVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV--HGM-FYKDGFWNDISCDDTNSVICY--------------KNTQPKTSHVIKLLNRELIILQEKT--TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQY-------QIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN---EHCVHGLYYSNALWNDISCADSNAVIC 867
            EHCV     H L      WND +C +    +CY++ +  + A    +S     YV        +  E   + +A   C  +G +L  + D  ++    + AIQ      WI     +   T+++ +G  + Y  +  GEP  ++ E CV  HG   +  G WND +CD     IC                   P  SH  +       +   KT  ++  A  +C     QLIK  D  L S+     V++       +    W+      + G +  +D   + +  +APGEPN    +   E CV    Y +  WND +C       C
Sbjct: 1714 EHCVSINHNHLL---TGRWNDENCNEERGWVCYRKKDSHLPAPPTTKSPCPSDYVSWYKNCYKLVSEHKNWADAEAACVKEGGHLASV-DMSYDQAFISGAIQQERTDAWIGLKRNEETSTYQWTDGWPVFYTHWGPGEPTIHKGEGCVSMHGRSHFIQGTWNDTACDVAKPYICKITFEKPPVTPAPGDGECMPGFSHYGRYC---YFVYNGKTGFSWPEARHYC-----QLIKGGD--LASVHSRAEVEFIRNINYTKYHNVWLGLTRDGSLG-WGWTDLTALAFTNWAPGEPNEAYHDLGMEDCVE--MYPDGTWNDNNCFQKRGFAC 2027          

HSP 12 Score: 52.7582 bits (125), Expect = 2.963e-6
Identity = 50/215 (23.26%), Postives = 83/215 (38.60%), Query Frame = 1
Query:    1 QKNEHCVH---GLYYPNALWNDFSCEDPSAVICYKE----------------TEPKISAEIELQSKYVIIFQEKTT--FTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQY--HAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK---NTQPKTSH----VIKLLNRELIILQEKT 555
            Q NE CVH     ++     ND  C      IC K                  E   S   +  + Y  +F   +   + EA   C  +G +L+ I +  F        IQ   +    W+  +D   EG +E+ +    +Y  +A G P++Y  EDC+  ++   G+WND +CD     +C +     +P   H     +      L++L  +T
Sbjct:  484 QDNEDCVHIRGTEHWETGKLNDLPCTSTFPFICQKAKGQGPPPVPPTSGPGWNEKCGSWVADPFNDYCYLFNSLSLRKWAEARADCVNQGGDLLSITE-PFEQGFIQAQIQSIPNGVSLWMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDCLT-IYINSGYWNDDNCDYKRGYVCKRRGNTPEPPPPHDGFLTVYTCQDSLLVLHCET 696          
BLAST of Mannose-binding protein C vs. Ensembl Cavefish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 171.014 bits (432), Expect = 2.077e-42
Identity = 207/975 (21.23%), Postives = 372/975 (38.15%), Query Frame = 1
Query:  142 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN----TQPKTSHV-------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-NNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE-------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA-LWNDIKCEDLNAVICYKNIGSRGFTKF--------------EISNKEI------VIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKH---NIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYY----KNGLWNDIKCDYKNSVIC-------------SKDILNSNE---TIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGN-DIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEG----------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDC--VHGLFYTN-GLWNDISCNSINSVLCYKPF-----XXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKIS-GYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSC 2760
            Y +  Q   T+ +A K CQ +G +L+ I +    T +  L IQ     FW   N +     + +VN Q ++Y  +  G+P++     C       D  W+   C + +  IC +     T P   H        I       ++ + K T+  A   C+ +G  L+ I + +  S   +     +    WI  ND++    F  SD   + +  +   EP +N    E+CV  +      W D  C      IC K+S ++     T +                 +   E  T+ +A+ +C+  G  LV I +   N+ + +         +WI  ++++ + TFE ++  K++F+ + AG P   Q   CV       A LW+ + C +    IC +       T                 I N++       V   ++  +  A   C++ G +LL I           F+++    +  T WI  +       F +SD    SY+ W  GEPNN  N E CV  L++        WND+ C  K + +C             ++   N+ E    I +  +YY  +   + E A  FC   +  +V I++ E    ++  +K +     +I    D+     W+D  G+ +V+  WA+ +P   N ++      +  G W  I+C      I +   +     T+   E                       K  ++ A   CK  G +L  + N  +   +     ++     W+  +  N+ G F ++DG + ++  +        +   C  + G   +  G W    CN  N  +C +           +  K   K+  S Y +    +T++EA   CQ     LV+I++      I    + HK+    W+  N ++ +G ++ ID  +L   NW+ GEP    +  C+  +   +G W    C
Sbjct:  226 YQVNGQSALTWYQARKSCQQQGGDLLSITEPHEQTFISGL-IQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVL-MKEEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGGRQG--CVAMTTGVLAGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHG--------TFSIEAEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMRIDMDKSLTWMD--GSPVVFQAWARQQPAFLNEDEHCVKMTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLS--NLAGYFKWTDGSSFTFIAWRQEYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYI--HLQAHKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEPKK--DHPCVYVD--TDGNWKSAKC 1178          

HSP 2 Score: 157.532 bits (397), Expect = 3.222e-38
Identity = 242/1171 (20.67%), Postives = 451/1171 (38.51%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKK-----------ITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKI---DDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEP--NNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK--------------NIGSR-GFTKFE----ISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLY-YKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQ---------------KYYVHEVLV-------TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFY----PNGEWNDISCKTK-NYLIYEYESTAEKEITIEIMEGKVNYIK----------------------ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSK------------YFVHTGRVTYEEALRFCQIHSCRLVTIENSELD-ILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNED--CLLGNYFAN--GKWNDFSCSTKNSFI-YYYIENIISTKELEIFKERV--------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ-YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS-----PPIIFI--------DEHM---------SYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVN----YWIDGTDSKNDGKWTFSDGQQLTFKNWQTA-------SLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHR 3597
            Q   T+  A   C+ +G  L+ I +    + +  L +Q     +W   N +     +   + + + Y  +  G+P++   +   V    + +  W+   C++ +  IC +      +             I       ++ + + T+ +A+D C+ +G  L+ I   +++ F      YA  + +   WI  ND++    FE SD + ++F+ W   EP  N    E+CV  +  +   W D  C+     IC K              N G + G+ ++     ++  E   FEE      A+ +C+  G  L+ I +   N+ +           +WI  ++++ ++TF ++++ K+ +  +  G P     + CV        GLW+ + C      IC +       T+                   + + +++         T+ EA+++C      ++ I    + +     ++ +     WI  +       +  S G+   Y NW + EPNN NN E C+   F+       EWND+ C+ K N+L    +    K  T+EI E   N  +                      A   CK +  DL+ I +EE    V+           +I    I+++    + DG  + ++ +A  +P   N ++    + ++ GLW  I+C  +   +C +      +      +  T              Y ++  + T+ +A   C+     L ++ NS L   L L +A  +     WL  +++    +W   DG+   ++ W Q E   Y +E     +G   ++  GKW    C+  N +I    ++++I     E+ K  +              T++EAQ+ C   G +LV I +  T   I+  A  +K+G+  WI  N    +G F+  +N  L    +  GEP    +  CV+    ++G W    CN     +C K S     PP  F         DE            Y    N  ++  A + C  +G SL  ++++ +  FI + +SL   L N    +WI G      G W + D   + + NW+ +             E  NC + S   S +W    CV   ++   K +K + +     +T    HR
Sbjct:  231 QSALTWYQARKSCQQQGGDLLSITEPHEQTFISGL-IQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSG-WSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDEL---WIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVL-MKEEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEE------ARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGG--RQGCVAMTTGVLAGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHGTFSIE-----AEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPK--TVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQPAFLNEDEHCVKMTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNS-PDLWLGLSNLAGYFKWT--DGSSFTFIAWRQ-EYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQA--HKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEPKK--DHPCVY--VDTDGNWKSAKCNQTYYSVCKKSSEIAPTPPAQFPGMCPEETEDEPTMTWLPFRGHCYAFVTNFHSWVAASNVCNRKGGSLASIQDTKEAKFIENYISL---LGNNQEKFWI-GLFKTFAGHWLWVDKSVVDYTNWEQSNNDEEEEEEDDGYEGKNCAFISAE-SKQWKQNHCVYSYAMSICKIAKVMHSTTAPNQTGPDTHR 1364          

HSP 3 Score: 145.206 bits (365), Expect = 2.012e-34
Identity = 194/904 (21.46%), Postives = 351/904 (38.83%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYK----ETEPKISAEIELQSKYV-------IIFQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEP--NNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT--QPKTSHV-----------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYK--ESKIEVLKKIT------------VLNKEL------VIFKERLTYYKAQDLCKSQGYKLVKI------DDEQFNSIVY--NYAVQN-NIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYY----KNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEI-------VIF--------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY-ENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD---ILNSN-------------ETIKQQQK-YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAK-------------------NEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEI------TIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ-YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK 2394
            W+   C +    IC +     T P +       S ++       ++ + K T+ EA   C+ +G +L+ I   E+  F       A        WI  ND+K    FE+ +   +++  +   EP  N    E+CV  M  ++G W D  C      IC K +  QP T+             ++      +   E  T+E A   C+  G  L+ I +   N+ + +L        +WI  ++M+++  F  ++  K+ +  F  G P   Q       G+     LW+ +SC ++   IC +  E  I  +   T            + N++       V   +R T+Y+A D C+  G  L+ I      + E  +S      Y++Q+ ++G  W              SD +   +  W  GEPNN  N E CV  L++        WND+ C+D    +C    G    T  EI+ K         +IF        +E    + A+  CK+   +L+ I+ +E    ++      +    +I    I  + +  + D   + +Q W   +P    E+E CV  + +  GLW  I C      IC +     +NS              E +K Q K Y ++    T+ +A + C Q    +  ++N      +            W+  +++    KW D  G+   ++ W +                   ++P  +   DC + N Y       I  +  ++LI    +   K        +  +++  + + +A   C+S G +L+ I++      ++  A  +KVG+  WI  N +  +G F++ D   ++ +N+ +GEP  + +  CV+    T+G W    CN     +C K
Sbjct:  323 WSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYA---KTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVL-MKEEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGGRQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHGTFSIEAEGLSSSTAWIGYSIQDPSVGFTW--------------SDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPKT-VEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQPAFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNLAGYFKWTD--GSSFTFIAWRQEYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGY-------ICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQA--HKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEP--KKDHPCVY--VDTDGNWKSAKCNQTYYSVCKK 1188          

HSP 4 Score: 141.739 bits (356), Expect = 2.269e-33
Identity = 206/977 (21.08%), Postives = 375/977 (38.38%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSK--------DILNSNETIKQQQKYYVHEVLV-----TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEP--NNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYES---TAEKEITIEIMEGKVNYIK-----------------ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVH---GLFYTNGLWNDISCNSINSVLCYK-----------PFXXXXXXXXXXGKIDTSKY------FVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDC--LLGNYFANG--KWNDFSCSTKNSFIYYYIENIISTKELE--------------IFK--------ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDAN---DKAVEGKFVDSNNHALKYSKFPRGEPNNYGNED--CVHGLYYSNGFWNDIACNSKNSFICSKYS------------PP--------IIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVN---YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLS--GKWLGTSCVSKNSVICYK---------PSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCD 3888
            +  + +  A+  C+  G +LL I      + I    ++     +W   N +     + + +++ + Y  W  G+P++     C       +  W+   C  K+  IC +         ++++         Y  H  L+     T+ EA + C +    ++ I NVE            K    WI  ND+ T   +  S  + + +  W  NEP  N    E+C+       G+W D  C+ K   I + +S    +  +  +     K  +++                 A ++C+  G  L+ I N   N  +  +        +WI  +++  +  F +++   + + +F  G P  +  + CV    G+    GLW+ +SC +    +C +           P        +    I    +         + R T+ EAL +C+     L++I  +   I    L+      GY +   D      W   DG+   Y NW +GEPNN  N E C  +L +++ +   +WND  C  K +++   I   ++ K +E              IFK        E  + E A+  C  +   LV I++EE    ++           +I      DK++   ++D +   + +  + R +P  + NED  CV  + +S G W  I C     FIC +              PP        + F D+   YK+ + K T+ +A   C+  G +L  V N   S +  TL+L+    N    W+  ++     KWT  DG   TF  W+        E        +  S  GKWL   C   N  IC +         P++   T  ++  + Y + +  +T++EA   C+     L+ + ++ T  Y+   + K+     W+  N  + +G ++  D  +L   NW  G+   +K   C+  + DG W+   C+
Sbjct:  231 QSALTWYQARKSCQQQGGDLLSITEPHEQTFISGL-IQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVLMK-EEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGGR--QGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHGT-FSIEAEGLSSSTAWIGYSI--QDPSVGFTWS--DGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWL-CEIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMRIDMDKSL--TWMDGS--PVVFQAWARQQP-AFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDK--CYKLNLEKKTWLDARSSCKQLGGNLASVTN---SLLQATLTLKMAEDNSPDLWLGLSNLAGYFKWT--DGSSFTFIAWRQEYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQAHKVG-RPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEP--KKDHPCVYVDTDGNWKSAKCN 1179          

HSP 5 Score: 130.183 bits (326), Expect = 6.718e-30
Identity = 192/870 (22.07%), Postives = 324/870 (37.24%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYKE------------TEPKISAEIELQSKYVIIFQEKT-TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVI-------KLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ-YQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYY----SNALWNDISCADSNAVICYKESKIEVLKKITVLNKEL------------VIFKERLTYY--------KAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNED--CVHGLYYKNALWNDIKCEDLNAVICYKN---------------IGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKW------YPGEPNNYENEDCVHG-LYYKNGLWNDIKCDYKNSVICSKDI-----LNSNETIKQ-----QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR-FWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEY------------------ESTAEKEITIEIMEGKV--------NYIKALELCKSKGYDLIRIENEEINKIV--YDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNF 2277
            W D  C+     IC K+            T P   A       Y  +   +T TF EA K+C+  G  L+ I +   N  + +L        FWI  +++K + TFE+ N  ++++  F  G P     + CV    G+    G W+ +SC +T   IC +  +       P T+           + NR+           Q KT YE A+ +C+  G  L+ I         +++  +       WI  +       F  SDG    Y  +  GEPNN    E CV  L++    +   WND+ C D    +C      E+ K +T    E+            +IFK+   Y+         A+  CK +   LV I+DE+    V++     +    +I    + ++ +    D + + F  WA  +P  + NED  CV  + +   LW  I C DL   IC ++                G       +  +K   +  EK  +  A+  CK  G  L  + +  + + +     + N    W+  +++     F ++D    ++  W      Y  EP        + G    K G W    C+  N  ICS+ +         E  K         Y + +  +T++EA + C      +V I +V T   I+   +  K+GR  WI  N + T+G   W+D+   +L   NW   EP    +  C+  +   +G W    C    Y + +                   E+  E  +T     G          +++ A  +C  KG  L  I++ +  K +  Y     N   ++WI        G +++ D   + Y N+
Sbjct:  464 WADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGG--RQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYE-ALDYCRDLGGDLLSIHG------TFSIEAEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLC------EIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQP-AFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNL--AGYFKWTDGSSFTFIAWRQEYYYYSSEPRCAT----IGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIH--LQAHKVGRPLWIGLNSMETDGYFLWIDNW--QLNIQNWDYGEPK--KDHPCVYVD--TDGNWKSAKCNQTYYSVCKKSSEIAPTPPAQFPGMCPEETEDEPTMTWLPFRGHCYAFVTNFHSWVAASNVCNRKGGSLASIQDTKEAKFIENYISLLGNNQEKFWIGLFK-TFAGHWLWVDKSVVDYTNW 1298          

HSP 6 Score: 104.76 bits (260), Expect = 3.960e-22
Identity = 144/695 (20.72%), Postives = 266/695 (38.27%), Query Frame = 1
Query: 2068 EGKVNYIKALELCKSKGYDLIRI-ENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDC-VHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTG--------RVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEP--NNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI-ISTKELEIF-------------------KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVH---GLYYSNGFWNDIACNSKNSFIC--------SKYSPPII-----------FIDEHMSYKIF----INKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCL------YSSETLSGKWLGTSCVSKNSVIC-----YKP------SKTIDTGKE----VKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGN-DKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNCLQGN-PDGKWRDVSCDDKNPFF 3906
            +  + + +A + C+ +G DL+ I E  E   I   +     V  +W   N ++    + + + Q + Y N+  G+P++     C V    + +G W+   C+  +  +C +                 S +  ++G        + T+ EA   C+     L++I N E     ++     K    W+  ND+K    +   D + +++  W+  EP  N    E+C+L      GKW D  C  K  +I     ++  ST +  +                     E  TFEEA+  C K G  LV I N   N  +  L        +WI  ++   +  F  +N   ++++ F  G P   G + CV    G+    G W+ ++C +   +IC        +  +PP               +    YK+F      + T+ EA+D C+  G  L+ +     +F +    L       WI  +       +T+SDG   +++NWQ     +      C+      + S  L  +W    C  K + +C       P       KT +T ++     K  +YY      + + A  FCK R   L+ +++ +  +++W  +K L     ++    D D    W+D     + F  W   +   + + ++C++     G W  ++C D   F 
Sbjct:  231 QSALTWYQARKSCQQQGGDLLSITEPHEQTFISGLIQQAGSV--FWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSG-WSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVLMKE-EEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPG--GRQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHG---TFSIEAEGLSSSTA--WIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTEL--EWNDLHCQDKCNWLCEIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMRIDMDKSLTWMDGS--PVVFQAWARQQPAFLNEDEHCVKMTWSQGLWESINCGDLEKFI 908          

HSP 7 Score: 72.4034 bits (176), Expect = 3.117e-12
Identity = 87/382 (22.77%), Postives = 146/382 (38.22%), Query Frame = 1
Query: 2758 CSTKNSFIYYYIENIISTKELEI-FKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK-----YSPPIIFIDEHMS---------YKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKE--NNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKT-----------KYYIHRIGV---TFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLN-GNDKDNEG-AWIDSDKKKLTFFN 3801
            C T+     ++ +N ++    ++  +  +T+ +A+ +C ++G  L+ I  E   Q      ++     +W   N       +   N   L+Y  +  G+P++     C       +  W+   C+ K+ +IC +       PP++      S         Y +   K T+ EA D C+ EG  L+ + N  + SF +  L    K    WI   D K    + +SD   + F  W     PS       NC+   E   GKW    C  K   IC K S    +  +   T            YY    G    TF+EA   C++    L+ + N   N +L  L      + +W+   N KD     W ++ K + T FN
Sbjct:  206 CPTREKVDDFWKKNPLTNVYYQVNGQSALTWYQARKSCQQQGGDLLSI-TEPHEQTFISGLIQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYA-KTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNE-PSHNAALKENCVLMKEE-EGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFN 583          
BLAST of Mannose-binding protein C vs. Ensembl Cavefish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 170.629 bits (431), Expect = 3.074e-42
Identity = 207/975 (21.23%), Postives = 372/975 (38.15%), Query Frame = 1
Query:  142 YVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN----TQPKTSHV-------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-NNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKE-------------LVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNA-LWNDIKCEDLNAVICYKNIGSRGFTKF--------------EISNKEI------VIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKH---NIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYY----KNGLWNDIKCDYKNSVIC-------------SKDILNSNE---TIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGN-DIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEG----------------------KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDC--VHGLFYTN-GLWNDISCNSINSVLCYKPF-----XXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKIS-GYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSC 2760
            Y +  Q   T+ +A K CQ +G +L+ I +    T +  L IQ     FW   N +     + +VN Q ++Y  +  G+P++     C       D  W+   C + +  IC +     T P   H        I       ++ + K T+  A   C+ +G  L+ I + +  S   +     +    WI  ND++    F  SD   + +  +   EP +N    E+CV  +      W D  C      IC K+S ++     T +                 +   E  T+ +A+ +C+  G  LV I +   N+ + +         +WI  ++++ + TFE ++  K++F+ + AG P   Q   CV       A LW+ + C +    IC +       T                 I N++       V   ++  +  A   C++ G +LL I           F+++    +  T WI  +       F +SD    SY+ W  GEPNN  N E CV  L++        WND+ C  K + +C             ++   N+ E    I +  +YY  +   + E A  FC   +  +V I++ E    ++  +K +     +I    D+     W+D  G+ +V+  WA+ +P   N ++      +  G W  I+C      I +   +     T+   E                       K  ++ A   CK  G +L  + N  +   +     ++     W+  +  N+ G F ++DG + ++  +        +   C  + G   +  G W    CN  N  +C +           +  K   K+  S Y +    +T++EA   CQ     LV+I++      I    + HK+    W+  N ++ +G ++ ID  +L   NW+ GEP    +  C+  +   +G W    C
Sbjct:  226 YQVNGQSALTWYQARKSCQQQGGDLLSITEPHEQTFISGL-IQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVL-MKEEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGGRQG--CVAMTTGVLAGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHG--------TFSIEAEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMRIDMDKSLTWMD--GSPVVFQAWARQQPAFLNEDEHCVKMTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLS--NLAGYFKWTDGSSFTFIAWRQEYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYI--HLQAHKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEPKK--DHPCVYVD--TDGNWKSAKC 1178          

HSP 2 Score: 155.606 bits (392), Expect = 1.118e-37
Identity = 241/1160 (20.78%), Postives = 448/1160 (38.62%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKK-----------ITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKI---DDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEP--NNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK--------------NIGSR-GFTKFE----ISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLY-YKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQ---------------KYYVHEVLV-------TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFY----PNGEWNDISCKTK-NYLIYEYESTAEKEITIEIMEGKVNYIK----------------------ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSK------------YFVHTGRVTYEEALRFCQIHSCRLVTIENSELD-ILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNED--CLLGNYFAN--GKWNDFSCSTKNSFI-YYYIENIISTKELEIFKERV--------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ-YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS-----PPIIFI--------DEHM---------SYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVN----YWIDGTDSKNDGKWTFSDGQQLTFKNWQTA-------SLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGK 3564
            Q   T+  A   C+ +G  L+ I +    + +  L +Q     +W   N +     +   + + + Y  +  G+P++   +   V    + +  W+   C++ +  IC +      +             I       ++ + + T+ +A+D C+ +G  L+ I   +++ F      YA  + +   WI  ND++    FE SD + ++F+ W   EP  N    E+CV  +  +   W D  C+     IC K              N G + G+ ++     ++  E   FEE      A+ +C+  G  L+ I +   N+ +           +WI  ++++ ++TF ++++ K+ +  +  G P     + CV        GLW+ + C      IC +       T+                   + + +++         T+ EA+++C      ++ I    + +     ++ +     WI  +       +  S G+   Y NW + EPNN NN E C+   F+       EWND+ C+ K N+L    +    K  T+EI E   N  +                      A   CK +  DL+ I +EE    V+           +I    I+++    + DG  + ++ +A  +P   N ++    + ++ GLW  I+C  +   +C +      +      +  T              Y ++  + T+ +A   C+     L ++ NS L   L L +A  +     WL  +++    +W   DG+   ++ W Q E   Y +E     +G   ++  GKW    C+  N +I    ++++I     E+ K  +              T++EAQ+ C   G +LV I +  T   I+  A  +K+G+  WI  N    +G F+  +N  L    +  GEP    +  CV+    ++G W    CN     +C K S     PP  F         DE            Y    N  ++  A + C  +G SL  ++++ +  FI + +SL   L N    +WI G      G W + D   + + NW+ +             E  NC + S   S +W    CV   ++   K +K  DT +
Sbjct:  231 QSALTWYQARKSCQQQGGDLLSITEPHEQTFISGL-IQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSG-WSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDEL---WIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVL-MKEEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEE------ARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGG--RQGCVAMTTGVLAGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHGTFSIE-----AEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPK--TVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQPAFLNEDEHCVKMTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNS-PDLWLGLSNLAGYFKWT--DGSSFTFIAWRQ-EYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQA--HKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEPKK--DHPCVY--VDTDGNWKSAKCNQTYYSVCKKSSEIAPTPPAQFPGMCPEETEDEPTMTWLPFRGHCYAFVTNFHSWVAASNVCNRKGGSLASIQDTKEAKFIENYISL---LGNNQEKFWI-GLFKTFAGHWLWVDKSVVDYTNWEQSNNDEEEEEEDDGYEGKNCAFISAE-SKQWKQNHCVYSYAMSICKIAKGPDTHR 1353          

HSP 3 Score: 144.436 bits (363), Expect = 2.715e-34
Identity = 194/904 (21.46%), Postives = 351/904 (38.83%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYK----ETEPKISAEIELQSKYV-------IIFQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEP--NNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT--QPKTSHV-----------IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYK--ESKIEVLKKIT------------VLNKEL------VIFKERLTYYKAQDLCKSQGYKLVKI------DDEQFNSIVY--NYAVQN-NIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYY----KNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEI-------VIF--------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY-ENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD---ILNSN-------------ETIKQQQK-YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAK-------------------NEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEI------TIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ-YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK 2394
            W+   C +    IC +     T P +       S ++       ++ + K T+ EA   C+ +G +L+ I   E+  F       A        WI  ND+K    FE+ +   +++  +   EP  N    E+CV  M  ++G W D  C      IC K +  QP T+             ++      +   E  T+E A   C+  G  L+ I +   N+ + +L        +WI  ++M+++  F  ++  K+ +  F  G P   Q       G+     LW+ +SC ++   IC +  E  I  +   T            + N++       V   +R T+Y+A D C+  G  L+ I      + E  +S      Y++Q+ ++G  W              SD +   +  W  GEPNN  N E CV  L++        WND+ C+D    +C    G    T  EI+ K         +IF        +E    + A+  CK+   +L+ I+ +E    ++      +    +I    I  + +  + D   + +Q W   +P    E+E CV  + +  GLW  I C      IC +     +NS              E +K Q K Y ++    T+ +A + C Q    +  ++N      +            W+  +++    KW D  G+   ++ W +                   ++P  +   DC + N Y       I  +  ++LI    +   K        +  +++  + + +A   C+S G +L+ I++      ++  A  +KVG+  WI  N +  +G F++ D   ++ +N+ +GEP  + +  CV+    T+G W    CN     +C K
Sbjct:  323 WSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYA---KTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVL-MKEEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGGRQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHGTFSIEAEGLSSSTAWIGYSIQDPSVGFTW--------------SDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGVTPKT-VEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQPAFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNLAGYFKWTD--GSSFTFIAWRQEYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGY-------ICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQA--HKVGRPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEP--KKDHPCVY--VDTDGNWKSAKCNQTYYSVCKK 1188          

HSP 4 Score: 140.969 bits (354), Expect = 3.692e-33
Identity = 206/977 (21.08%), Postives = 375/977 (38.38%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSK--------DILNSNETIKQQQKYYVHEVLV-----TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEP--NNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYES---TAEKEITIEIMEGKVNYIK-----------------ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVH---GLFYTNGLWNDISCNSINSVLCYK-----------PFXXXXXXXXXXGKIDTSKY------FVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDC--LLGNYFANG--KWNDFSCSTKNSFIYYYIENIISTKELE--------------IFK--------ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDAN---DKAVEGKFVDSNNHALKYSKFPRGEPNNYGNED--CVHGLYYSNGFWNDIACNSKNSFICSKYS------------PP--------IIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVN---YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLS--GKWLGTSCVSKNSVICYK---------PSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCD 3888
            +  + +  A+  C+  G +LL I      + I    ++     +W   N +     + + +++ + Y  W  G+P++     C       +  W+   C  K+  IC +         ++++         Y  H  L+     T+ EA + C +    ++ I NVE            K    WI  ND+ T   +  S  + + +  W  NEP  N    E+C+       G+W D  C+ K   I + +S    +  +  +     K  +++                 A ++C+  G  L+ I N   N  +  +        +WI  +++  +  F +++   + + +F  G P  +  + CV    G+    GLW+ +SC +    +C +           P        +    I    +         + R T+ EAL +C+     L++I  +   I    L+      GY +   D      W   DG+   Y NW +GEPNN  N E C  +L +++ +   +WND  C  K +++   I   ++ K +E              IFK        E  + E A+  C  +   LV I++EE    ++           +I      DK++   ++D +   + +  + R +P  + NED  CV  + +S G W  I C     FIC +              PP        + F D+   YK+ + K T+ +A   C+  G +L  V N   S +  TL+L+    N    W+  ++     KWT  DG   TF  W+        E        +  S  GKWL   C   N  IC +         P++   T  ++  + Y + +  +T++EA   C+     L+ + ++ T  Y+   + K+     W+  N  + +G ++  D  +L   NW  G+   +K   C+  + DG W+   C+
Sbjct:  231 QSALTWYQARKSCQQQGGDLLSITEPHEQTFISGL-IQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVLMK-EEEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGGR--QGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHGT-FSIEAEGLSSSTAWIGYSI--QDPSVGFTWS--DGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWL-CEIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMRIDMDKSL--TWMDGS--PVVFQAWARQQP-AFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDK--CYKLNLEKKTWLDARSSCKQLGGNLASVTN---SLLQATLTLKMAEDNSPDLWLGLSNLAGYFKWT--DGSSFTFIAWRQEYYYYSSEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIHLQAHKVG-RPLWIGLNSMETDGYFLWIDNWQLNIQNWDYGEP--KKDHPCVYVDTDGNWKSAKCN 1179          

HSP 5 Score: 129.798 bits (325), Expect = 8.404e-30
Identity = 192/870 (22.07%), Postives = 324/870 (37.24%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYKE------------TEPKISAEIELQSKYVIIFQEKT-TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYKNTQ-------PKTSHVI-------KLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQ-YQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYY----SNALWNDISCADSNAVICYKESKIEVLKKITVLNKEL------------VIFKERLTYY--------KAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNED--CVHGLYYKNALWNDIKCEDLNAVICYKN---------------IGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKW------YPGEPNNYENEDCVHG-LYYKNGLWNDIKCDYKNSVICSKDI-----LNSNETIKQ-----QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR-FWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEY------------------ESTAEKEITIEIMEGKV--------NYIKALELCKSKGYDLIRIENEEINKIV--YDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNF 2277
            W D  C+     IC K+            T P   A       Y  +   +T TF EA K+C+  G  L+ I +   N  + +L        FWI  +++K + TFE+ N  ++++  F  G P     + CV    G+    G W+ +SC +T   IC +  +       P T+           + NR+           Q KT YE A+ +C+  G  L+ I         +++  +       WI  +       F  SDG    Y  +  GEPNN    E CV  L++    +   WND+ C D    +C      E+ K +T    E+            +IFK+   Y+         A+  CK +   LV I+DE+    V++     +    +I    + ++ +    D + + F  WA  +P  + NED  CV  + +   LW  I C DL   IC ++                G       +  +K   +  EK  +  A+  CK  G  L  + +  + + +     + N    W+  +++     F ++D    ++  W      Y  EP        + G    K G W    C+  N  ICS+ +         E  K         Y + +  +T++EA + C      +V I +V T   I+   +  K+GR  WI  N + T+G   W+D+   +L   NW   EP    +  C+  +   +G W    C    Y + +                   E+  E  +T     G          +++ A  +C  KG  L  I++ +  K +  Y     N   ++WI        G +++ D   + Y N+
Sbjct:  464 WADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGG--RQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYE-ALDYCRDLGGDLLSIHG------TFSIEAEGLSSSTAWIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLC------EIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMR-IDMDKSLTWMDGSPVVFQAWARQQP-AFLNEDEHCVK-MTWSQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKTWLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNL--AGYFKWTDGSSFTFIAWRQEYYYYSSEPRCAT----IGGKQSSKPGKWLQNDCNDTNGYICSRALDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIH--LQAHKVGRPLWIGLNSMETDGYFLWIDNW--QLNIQNWDYGEPK--KDHPCVYVD--TDGNWKSAKCNQTYYSVCKKSSEIAPTPPAQFPGMCPEETEDEPTMTWLPFRGHCYAFVTNFHSWVAASNVCNRKGGSLASIQDTKEAKFIENYISLLGNNQEKFWIGLFK-TFAGHWLWVDKSVVDYTNW 1298          

HSP 6 Score: 104.375 bits (259), Expect = 5.131e-22
Identity = 144/695 (20.72%), Postives = 266/695 (38.27%), Query Frame = 1
Query: 2068 EGKVNYIKALELCKSKGYDLIRI-ENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDC-VHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTG--------RVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEP--NNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENI-ISTKELEIF-------------------KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVH---GLYYSNGFWNDIACNSKNSFIC--------SKYSPPII-----------FIDEHMSYKIF----INKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCL------YSSETLSGKWLGTSCVSKNSVIC-----YKP------SKTIDTGKE----VKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGN-DKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNCLQGN-PDGKWRDVSCDDKNPFF 3906
            +  + + +A + C+ +G DL+ I E  E   I   +     V  +W   N ++    + + + Q + Y N+  G+P++     C V    + +G W+   C+  +  +C +                 S +  ++G        + T+ EA   C+     L++I N E     ++     K    W+  ND+K    +   D + +++  W+  EP  N    E+C+L      GKW D  C  K  +I     ++  ST +  +                     E  TFEEA+  C K G  LV I N   N  +  L        +WI  ++   +  F  +N   ++++ F  G P   G + CV    G+    G W+ ++C +   +IC        +  +PP               +    YK+F      + T+ EA+D C+  G  L+ +     +F +    L       WI  +       +T+SDG   +++NWQ     +      C+      + S  L  +W    C  K + +C       P       KT +T ++     K  +YY      + + A  FCK R   L+ +++ +  +++W  +K L     ++    D D    W+D     + F  W   +   + + ++C++     G W  ++C D   F 
Sbjct:  231 QSALTWYQARKSCQQQGGDLLSITEPHEQTFISGLIQQAGSV--FWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSG-WSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNEPSHNAALKENCVLMKE-EEGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPG--GRQGCVAMTTGVL--AGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYKLFSVEQSQRKTWYEALDYCRDLGGDLLSIHG---TFSIEAEGLSSSTA--WIGYSIQDPSVGFTWSDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTEL--EWNDLHCQDKCNWLCEIRKGVTPKTVEITEKTYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEERVFVWHQTKTLHYADPYIGMRIDMDKSLTWMDGS--PVVFQAWARQQPAFLNEDEHCVKMTWSQGLWESINCGDLEKFI 908          

HSP 7 Score: 72.4034 bits (176), Expect = 3.591e-12
Identity = 87/382 (22.77%), Postives = 146/382 (38.22%), Query Frame = 1
Query: 2758 CSTKNSFIYYYIENIISTKELEI-FKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK-----YSPPIIFIDEHMS---------YKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKE--NNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKT-----------KYYIHRIGV---TFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLN-GNDKDNEG-AWIDSDKKKLTFFN 3801
            C T+     ++ +N ++    ++  +  +T+ +A+ +C ++G  L+ I  E   Q      ++     +W   N       +   N   L+Y  +  G+P++     C       +  W+   C+ K+ +IC +       PP++      S         Y +   K T+ EA D C+ EG  L+ + N  + SF +  L    K    WI   D K    + +SD   + F  W     PS       NC+   E   GKW    C  K   IC K S    +  +   T            YY    G    TF+EA   C++    L+ + N   N +L  L      + +W+   N KD     W ++ K + T FN
Sbjct:  206 CPTREKVDDFWKKNPLTNVYYQVNGQSALTWYQARKSCQQQGGDLLSI-TEPHEQTFISGLIQQAGSVFWTGLNSLDASRGWHWVNAQPLRYLNWISGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLPTPTVPPVVHTGSCHSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYA-KTDELWIGLNDLKTSMLFEWSDHSNVQFALWDVNE-PSHNAALKENCVLMKEE-EGKWADQICQKKYGYICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVDITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFN 583          
BLAST of Mannose-binding protein C vs. Ensembl Sea Lamprey
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 112.079 bits (279), Expect = 3.965e-25
Identity = 171/930 (18.39%), Postives = 335/930 (36.02%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISN-----------KEIVIF--------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIG---TYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK-----------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFW--INGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYP--NGEWNDISCKTKNYLIYEYESTAEKEITIEI---MEGKVNYIKALE-----------------------LCKSKGYDLIRIENEEINKIVYDVATKNKVGQ--------YWINANDIN--VEGQFIYSDGQNISYRNFAHGEP-NNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP----FXXXXXXXXXXGKIDT-SKYFVHTG--------RVTYEEALRFCQIHSCRLVTIENSELDILILNLAR---KHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFI--YYYIENIISTKEL--------------EIFKERV-----------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKF------PRGE-PNNY--GNEDCV-----HGLYYSNGFWNDIACN-SKNSFICSKYSPPI----------IFID----EHMSYKIFINKVTYREAVDKCQSEGYSLIKV 3276
            L++++A+  C  QG  L+ I +    + +  + +       WI  ND+  +G ++ SD + +K   W  G P+    ++C        + W   +C      +C K +     T  +I N           +  V F         EK  ++ A   C+  G +LL +          DF V+H +      W+  ND++T+  F +SD   +++  W+P  PN+   E CV  L+ K G W D  CD K + +C      S      Q+                  Y + E L  ++ A   C+Q    +V +++      +           FW  +     +   +W+   G  + + NW +NEP  +     L G+     +  W+ I+    +  IY         I   +   + G V  + +L                         C+  G  L+ + +    + V  +  +  +G+         WI  N  N  +   + +SDG  +S+ +F  G   +++   DC   L      W  + C++    +C  P             + G++   +++  H G         +++  A   C +    L ++ +    + +L+  +   K  +  +W+  + +  + E    DG+ L ++ W +  PN        +      G W D  C  K   +   + +   +    L               +F ++            T+  A+  C  +  +L  I N    Q    L +      YW+  + +A  G F     H + ++ +      PRG+ P  +      CV       L+++ G W+   C   +++FIC KY  P           + +D    ++++Y + +  +++ EA   C+     L  +
Sbjct:  213 LSWHEARTSCLQQGSDLLSITEMHEQTYIAGF-LSGFGAIMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSKWQTKECAAALPYVCKKRLN---ITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLH----GLADVDFLVQHVLSDGEEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCV-SLWGKEGRWKDGPCDAKKASVCRAPGSLSEAQPDSQEGGTPTECPKGWDLHNGFCYLIGEELTDFQNAWTRCSQQQATLVSVTSRFEQAFVSSLVGPRVGDSFWTSLRNTGGLDSFRWLG--GEHVTFTNWNRNEP-GWKPGSLLVGSLTRCLSVLWSYITESQYSSEIYPLMPRCSACILKWMGGCLHGSVMEVASLSYFCLQLLHFADAGNMKSWEEADGYCRELGATLLSLRDPAEGRAVSTL-IRGLLGESGEQNERWLWIGLNSRNPGLIKSWKWSDGTALSFSDFEEGHAEDDEAVRDCA-ALGSRGKQWRKLRCDTRLEWICKIPRVDKMSGVSIRHSDVGRVSGDTQWLHHQGDEYLFVQQPLSWIHARLSCTLMGGELASVRDRAEFLYLLHTMQKLSKASLQQWWIGLSMLDGDSELQWSDGSLLTFMAWAESRPNAARKFQTCVYMSANKGTWGDMRCGMKLPAVCKRWNVTMPVPITPLHPATSGWGNCPDGWHVFGDKCLGFVDGPGQARTWMGAKEYCESQDATLATIAN-HLEQAFIILKLAPGQDSYWVGLHVRASVGAFTWLEEHNVTFTNWMHPAWAPRGQRPRLWLVMQVSCVLVWNGPPLHFT-GKWDSRNCVLEEHNFICQKYKDPALPSPSPIPDPLAVDTLRMDNVTYTMVLYSLSWPEAAWLCERRDTVLASI 1126          

HSP 2 Score: 98.5969 bits (244), Expect = 5.418e-21
Identity = 156/828 (18.84%), Postives = 311/828 (37.56%), Query Frame = 1
Query: 1687 KYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDC--LEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKEITIEIMEG----------------------KVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXX-XXXGKIDTSK-----------YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYF--ANGKWNDFSCSTKNSFIYYYIE----------------NIISTKELEIFKERV----------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ--------YWIDANDK--AVEGKFVDSNNHALKYSKFPRGEP-NNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC------------------SKYSPPIIFIDEHMSYKIFINK-VTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYK--LVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDT-----------------GKEV--KKTKYYIHRIG--VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTN 3810
            ++ VH VL ++ EA   C Q    ++ I+ +     I  +         WI  ND+ ++G W  S G+ L  LNW +  P+  + ++C  L   F+   +W    C     Y+  +  +    +I  E  E                       K  +  AL  C+  G DL+ +    +++ +V  V +  +  + W+  ND+  +  F +SD   +++  +    PN++  E CV  L+   G W D  C++  + +C  P    + +   +EG   T             Y +      ++ A   C      LV++ +      + +L        +W    +      +  + G  + + NWN+ EP  +     L+G+     +  W+  + S  +S IY  +                 +++    L  F  ++          ++EEA   C + G +L+ + +    + +  L ++  +G+         WI  N +   +   +  S+  AL +S F  G   ++    DC   L      W  + C+++  +IC                   + S    ++       +F+ + +++  A   C   G  L  V + ++  +++HT+    K  L  +WI  +    D +  +SDG  LTF  W  +   + ++   C+Y S    G W    C  K   +C + + T+                   G  V   K   ++   G   T+  A ++C+ +   L  + N     ++  L      + YW+  + + + GA+   ++  +TF NW +
Sbjct:  206 QFNVHAVL-SWHEARTSCLQQGSDLLSITEMHEQTYIAGFLSGFG-AIMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFF--SKWQTKECAAALPYVCKKRLNITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLHGLADVDFLVQHVLSDGE--EVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCV-SLWGKEGRWKDGPCDAKKASVCRAPGSLSEAQPDSQEGGTPTECPKGWDLHNGFCYLIGEELTDFQNAWTRCSQQQATLVSVTSRFEQAFVSSLVGPRVGDSFWTSLRNTGGLDSFRWLGGEHVTFTNWNRNEPG-WKPGSLLVGSLTRCLSVLWSYITESQYSSEIYPLMPRCSACILKWMGGCLHGSVMEVASLSYFCLQLLHFADAGNMKSWEEADGYCRELGATLLSLRDPAEGRAVSTL-IRGLLGESGEQNERWLWIGLNSRNPGLIKSWKWSDGTALSFSDFEEGHAEDDEAVRDCA-ALGSRGKQWRKLRCDTRLEWICKIPRVDKMSGVSIRHSDVGRVSGDTQWLHHQGDEYLFVQQPLSWIHARLSCTLMGGELASVRDRAEFLYLLHTMQKLSKASLQQWWIGLSMLDGDSELQWSDGSLLTFMAWAESRPNAARKFQTCVYMSAN-KGTWGDMRCGMKLPAVCKRWNVTMPVPITPLHPATSGWGNCPDGWHVFGDKCLGFVDGPGQARTWMGAKEYCESQDATLATIANHLEQAFI-ILKLAPGQDSYWVGLHVRASVGAFTWLEEHNVTFTNWMH 1021          

HSP 3 Score: 88.1965 bits (217), Expect = 1.005e-17
Identity = 155/822 (18.86%), Postives = 293/822 (35.64%), Query Frame = 1
Query:  556 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGR-YWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQ-KNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLK--------KITVLNKELVIF--------KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGS---------RGFTKFEISNKE-------IVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYY-KNGLWNDIKCDYKNSVI------CSKDI-------LNSNETIKQQQKYYVHEVL--------VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR--------FWINGND----IITEGKWVDSKGNKLVYLNWAKNEP-NNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKE-ITIE----------------------IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVG-----QYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFYTNGLWNDISCNSINSVLCYK-------PFXXXXXXXXXXGKI--------DTSKYFV-HTGRV-TYEEALRFCQIHSCRLVTIENS-ELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNW 2673
            ++  A   C  +G  L+ I   +++   Y        G   WI  ND+ ++G +  SDG  +    +  G P+    +N   +   ++S   W    CA +   +C K   I  ++        + TV  +  V F         E+ T+  A   C+  G  L+ +        +  + + +     W+  ND++ +  FE SD   + F+ W    PN+   E CV  L+ K   W D  C+   A +C +  GS          G T  E             +I EE   F++A   C      L+ + S    + +          ++W    +    ++F +   + +++  W   EP        V  L    + LW+ I     +S I      CS  I       L+ +        Y+  ++L         ++EEA  +C +    ++ + +    + +    + + +G          WI  N     +I   KW D  G  L + ++ +    ++    DC         +W  + C T+   I +     +   ++I                        ++  +++I A   C   G +L  + +    + +Y + T  K+      Q+WI  + ++ + +  +SDG  +++  +A   PN     + CV+ +    G W D+ C      +C +       P           G          D    FV   G+  T+  A  +C+     L TI N  E   +IL LA       YW+  +     G +  ++ + + + NW
Sbjct:  214 SWHEARTSCLQQGSDLLSIT--EMHEQTYIAGFLSGFGAIMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSK--WQTKECAAALPYVCKKRLNITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLHGLADVDFLVQHVLSDG-EEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCV-SLWGKEGRWKDGPCDAKKASVC-RAPGSLSEAQPDSQEGGTPTECPKGWDLHNGFCYLIGEELTDFQNAWTRCSQQQATLVSVTSRFEQAFVSSLVGPRVGDSFWTSLRNTGGLDSFRWLGGEHVTFTNWNRNEPGWKPGSLLVGSLTRCLSVLWSYITESQYSSEIYPLMPRCSACILKWMGGCLHGSVMEVASLSYFCLQLLHFADAGNMKSWEEADGYCRELGATLLSLRDPAEGRAVSTLIRGL-LGESGEQNERWLWIGLNSRNPGLIKSWKWSD--GTALSFSDFEEGHAEDDEAVRDCAALGSR-GKQWRKLRCDTRLEWICKIPRVDKMSGVSIRHSDVGRVSGDTQWLHHQGDEYLFVQQPLSWIHARLSCTLMGGELASVRDRA--EFLYLLHTMQKLSKASLQQWWIGLSMLDGDSELQWSDGSLLTFMAWAESRPNAARKFQTCVY-MSANKGTWGDMRCGMKLPAVCKRWNVTMPVPITPLHPATSGWGNCPDGWHVFGDKCLGFVDGPGQARTWMGAKEYCESQDATLATIANHLEQAFIILKLAPGQD--SYWVGLHVRASVGAFTWLEEHNVTFTNW 1019          

HSP 4 Score: 84.3445 bits (207), Expect = 1.515e-16
Identity = 143/709 (20.17%), Postives = 275/709 (38.79%), Query Frame = 1
Query: 2077 VNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ-YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDC--VHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXG-------------KIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIEN-SELDILILNLARKHKISG---YWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE----------------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIG-QYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYS-NGFWNDIACNSKNSFI---CSKYSPPII-------------------FIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVN--------YWIDGTDSKNDG---KWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKT--------KYYIHRIG---VTFQEALDFCKER-RCKLI-----VVDNIDTNIYLWELSKKLS---IEKYW--LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNCLQGNPD-GKWRDVSCDDKNP 3900
            +++ +A   C  +G DL+ I   E+++  Y     +  G   WI  ND++ +G + +SDG  +   N+  G P+  + ++C  +   F++   W    C +    +C K       +   E                + S ++    + T+++AL  C++    L+++   +++D L+     +H +S     WL  ND+K +  +   D   + +  W+   PN+   E C+   +   G+W D  C  K + +     ++   +                         I +E   F+ A   C ++  +LV + +      +  L V  ++G  +W    +      F       + ++ + R EP        V  L    +  W+ I  +  +S I     + S  I+                   F  + + +    N  ++ EA   C+  G +L+ + +      V TL +R  L           WI G +S+N G    W +SDG  L+F +++      D+   +C  +  +   +W    C ++   IC  P     +G  ++ +          ++H  G   +  Q+ L +   R  C L+      V +    +YL    +KLS   ++++W  L+  D D+E  W  SD   LTF  W   + N  +K Q C+  + + G W D+ C  K P
Sbjct:  213 LSWHEARTSCLQQGSDLLSIT--EMHEQTYIAGFLSGFGAIMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSK--WQTKECAAALPYVCKKRLNITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLHGLADVDFLV-----QHVLSDGEEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCV-SLWGKEGRWKDGPCDAKKASVCRAPGSLSEAQPDSQEGGTPTECPKGWDLHNGFCYLIGEELTDFQNAWTRCSQQQATLVSVTSRFEQAFVSSL-VGPRVGDSFWTSLRNTGGLDSFRWLGGEHVTFTNWNRNEPGWKPGSLLVGSLTRCLSVLWSYITESQYSSEIYPLMPRCSACILKWMGGCLHGSVMEVASLSYFCLQLLHFADAGNMKSWEEADGYCRELGATLLSLRDPAEGRAVSTL-IRGLLGESGEQNERWLWI-GLNSRNPGLIKSWKWSDGTALSFSDFEEGHAEDDEAVRDC-AALGSRGKQWRKLRCDTRLEWICKIPRVDKMSGVSIRHSDVGRVSGDTQWLHHQGDEYLFVQQPLSWIHARLSCTLMGGELASVRDRAEFLYLLHTMQKLSKASLQQWWIGLSMLDGDSELQW--SDGSLLTFMAWAESRPNAARKFQTCVYMSANKGTWGDMRCGMKLP 905          
BLAST of Mannose-binding protein C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003237.1 (pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 gene:ENSPMAG00000002956.1 transcript:ENSPMAT00000003237.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.073e-11
Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 1
Query: 1324 EKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY--ENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            E++ +  A+  C++ G  L  I S + N+ I      +     WI  ND  +E  F +SD  ++S++ W P +P+++    EDCV  ++++ G WND+ C Y     C
Sbjct:   19 ERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCC 122          

HSP 2 Score: 57.3806 bits (137), Expect = 1.949e-9
Identity = 31/100 (31.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  937 ERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNY--QNEDCVHGLYYKNALWNDIKC 1230
            ERL + +A++ C+S G  L  I     N    N+ +       WI  ND   EG F  SD +++ F  W   +P+++    EDCV  ++++   WND+ C
Sbjct:   19 ERLPWAEAEEACRSVGGHLASIASRDEN----NFILALGSDYQWIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPC 114          

HSP 3 Score: 56.6102 bits (135), Expect = 3.439e-9
Identity = 30/100 (30.00%), Postives = 49/100 (49.00%), Query Frame = 1
Query:  547 EKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNN-YQKNEHCVHGLYYSNALWNDISC 843
            E+  +  A   C+S G  L  I     N+ +  L   YQ    WI  ND  +EG+F  SDG ++ +  + P +P++ +   E CV  +++    WND+ C
Sbjct:   19 ERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPC 114          

HSP 4 Score: 55.8398 bits (133), Expect = 5.897e-9
Identity = 35/121 (28.93%), Postives = 54/121 (44.63%), Query Frame = 1
Query: 2833 ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY--GNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS-----PPII 3174
            ER+ + EA+  C   G  L  I + + N  I  L    +    WI  ND+  EG F  S+   L +  +   +P+++    EDCV  +++  G WND+ C     F C         PPI+
Sbjct:   19 ERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCCETQPGRCGHPPIV 135          

HSP 5 Score: 54.6842 bits (130), Expect = 1.546e-8
Identity = 29/99 (29.29%), Postives = 53/99 (53.54%), Query Frame = 1
Query: 2074 KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN--QNNEDCVHGLFYTNGLWNDISC 2364
            ++ + +A E C+S G  L  I + + N  +  + +  +    WI  ND   EG F +SDG  +S+ ++   +P++   + EDCV  +++  G WND+ C
Sbjct:   20 RLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPC 114          

HSP 6 Score: 54.6842 bits (130), Expect = 1.867e-8
Identity = 32/114 (28.07%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  160 EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY--RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQP 495
            E+  + EA + C++ G +L  I     N  +  L   Y     WI  ND   EG F + +G ++ +  +   +P+++    EDCV  +++++G WND+ C       C   TQP
Sbjct:   19 ERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCC--ETQP 126          

HSP 7 Score: 49.6766 bits (117), Expect = 7.701e-7
Identity = 30/104 (28.85%), Postives = 52/104 (50.00%), Query Frame = 1
Query: 1693 YVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY--NNEDCLEGNFYPNGEWNDISC 1998
            YV E L  + EA   C      +  I++ + N  I     + +    WI  ND  +EG +  S G++L + +W   +P+++  + EDC+   ++  GEWND+ C
Sbjct:   16 YVAERL-PWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPC 114          

HSP 8 Score: 48.9062 bits (115), Expect = 1.647e-6
Identity = 27/100 (27.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query: 2470 RVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY--GNEDCLLGNYFANGKWNDFSCS 2763
            R+ + EA   C+     L +I + + +  IL L   ++    W+  ND   EG++   DG++L + +W   +P+++    EDC++  +   G+WND  C+
Sbjct:   20 RLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCT 115          
BLAST of Mannose-binding protein C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005222.1 (pep scaffold:Pmarinus_7.0:GL492592:1201:2726:-1 gene:ENSPMAG00000004753.1 transcript:ENSPMAT00000005222.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.551e-11
Identity = 41/124 (33.06%), Postives = 62/124 (50.00%), Query Frame = 1
Query:  505 HVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQI--GRYWIDANDMQNEGNFISSDGKKI-VYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVIC 867
            H+ K  N+   +    + Y +A   C + G  L         + + N  +Q  +   R +I  ND+Q+E NF+ SDG ++ +YR FA GEPN++  +E CV+   Y N  WNDI C      IC
Sbjct:   18 HLSKNSNKIYQLFTNPSNYHSARQQCANHGGVLA-----MPKNAIQNAGIQQVVRGDRAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFIC 134          

HSP 2 Score: 62.003 bits (149), Expect = 1.810e-11
Identity = 41/108 (37.96%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 2080 NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNIS-YRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP 2397
            NY  A + C + G  L   +N   N  +  V   ++    +I  NDI  E  F++SDG  +  YRNFA GEPN+   +EDCV+   Y NG WNDI C++    +C  P
Sbjct:   35 NYHSARQQCANHGGVLAMPKNAIQNAGIQQVVRGDRA---FIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFICEFP 137          

HSP 3 Score: 57.3806 bits (137), Expect = 6.958e-10
Identity = 32/69 (46.38%), Postives = 46/69 (66.67%), Query Frame = 1
Query: 1828 RFWINGNDIITEGKWVDSKGNKL-VYLNWAKNEPNNYN-NEDCLEGNFYPNGEWNDISCKTKNYLIYEY 2028
            R +I  NDI  E  +V S G++L +Y N+A  EPN++  +EDC+  N YPNG+WNDI C T+ + I E+
Sbjct:   70 RAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCV--NIYPNGKWNDIGCHTQLHFICEF 136          

HSP 4 Score: 56.6102 bits (135), Expect = 1.241e-9
Identity = 40/117 (34.19%), Postives = 56/117 (47.86%), Query Frame = 1
Query: 2806 STKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALK-YSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            S K  ++F     +  A+  C   G  L    N   N  I  +   ++    +I  ND   E  FV S+   L  Y  F  GEPN++G +EDCV+   Y NG WNDI C+++  FIC
Sbjct:   23 SNKIYQLFTNPSNYHSARQQCANHGGVLAMPKNAIQNAGIQQVVRGDRA---FIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFIC 134          

HSP 5 Score: 56.225 bits (134), Expect = 2.050e-9
Identity = 41/117 (35.04%), Postives = 62/117 (52.99%), Query Frame = 1
Query: 1297 SNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKIS-YQKWYPGEPNNY-ENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            SNK   +F     +  A+  C N+G  +L +  + I +      V+ +    +I  NDIQ EN FV+SD  ++  Y+ +  GEPN++  +EDCV+   Y NG WNDI C  +   IC
Sbjct:   23 SNKIYQLFTNPSNYHSARQQCANHG-GVLAMPKNAIQNAGIQQVVRGDRA--FIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFIC 134          

HSP 6 Score: 55.4546 bits (132), Expect = 3.727e-9
Identity = 39/112 (34.82%), Postives = 59/112 (52.68%), Query Frame = 1
Query: 2452 YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLK-YLNWNQGEPNNYG-NEDCLLGNYFANGKWNDFSCSTKNSFI 2781
            Y + T    Y  A + C  H   L   +N+  +  I  + R  +    ++  NDI+ E  +V  DG++L  Y N+  GEPN++G +EDC+  N + NGKWND  C T+  FI
Sbjct:   27 YQLFTNPSNYHSARQQCANHGGVLAMPKNAIQNAGIQQVVRGDRA---FIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCV--NIYPNGKWNDIGCHTQLHFI 133          

HSP 7 Score: 50.0618 bits (118), Expect = 2.150e-7
Identity = 29/67 (43.28%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  283 RFWIDANDIKVEGTFEYVNGQRIK-YHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVIC 477
            R +I  NDI+ E  F + +G R+  Y  FA GEPN++  +EDCV+   Y +G WNDI C      IC
Sbjct:   70 RAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFIC 134          

HSP 8 Score: 45.8246 bits (107), Expect = 8.363e-6
Identity = 36/118 (30.51%), Postives = 56/118 (47.46%), Query Frame = 1
Query:  913 NKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNI--GRYWIDANDVRIEGTFEDSDKNKIK-FSKWAAGEPNNYQ-NEDCVHGLYYKNALWNDIKCEDLNAVIC 1254
            NK   +F     Y+ A+  C + G  L    +      + N  +Q  +   R +I  ND++ E  F  SD +++  +  +A GEPN++  +EDCV+   Y N  WNDI C      IC
Sbjct:   24 NKIYQLFTNPSNYHSARQQCANHGGVLAMPKNA-----IQNAGIQQVVRGDRAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKWNDIGCHTQLHFIC 134          
BLAST of Mannose-binding protein C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009130.1 (pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 gene:ENSPMAG00000008249.1 transcript:ENSPMAT00000009130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 1.607e-11
Identity = 34/114 (29.82%), Postives = 56/114 (49.12%), Query Frame = 1
Query:  535 IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKI---VYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVIC 867
            ++++E+  Y  A  HC+S+G  L    D+  N+++        + R +I  +D   EG F   DG  +    + ++ PGEPNN    E CV     S   WND+SC ++   +C
Sbjct:  159 LLVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 2 Score: 58.5362 bits (140), Expect = 2.407e-9
Identity = 35/117 (29.91%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  916 KELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKI---KFSKWAAGEPNN-YQNEDCVHGLYYKNALWNDIKCEDLNAVIC 1254
            K  ++ +E   Y +A   C+S+G  L    DE  N+++  Y     + R +I  +D   EG F   D   +    F++W  GEPNN +  EDCV         WND+ C +    +C
Sbjct:  156 KMYLLVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 3 Score: 57.7658 bits (138), Expect = 4.988e-9
Identity = 40/123 (32.52%), Postives = 61/123 (49.59%), Query Frame = 1
Query:  127 ELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG--RFWIDANDIKVEGTFEYVNGQRIKYHKFAK---GEPNN-YRNEDCVHGMFYKDGFWNDISCDDTNSVIC 477
            E + K  ++ +E+  ++EA   C+++G  L    D+  N  +   A   HAG  R +I  +D   EG F Y +G  +    F +   GEPNN +  EDCV       G WND+SC +T   +C
Sbjct:  152 ETERKMYLLVREERAYSEAALHCRSRGGLLAMPRDETTNALL--AAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 4 Score: 56.9954 bits (136), Expect = 7.442e-9
Identity = 35/122 (28.69%), Postives = 56/122 (45.90%), Query Frame = 1
Query: 1291 EISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEI-NSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKI---SYQKWYPGEPNN-YENEDCVHGLYYKNGLWNDIKCDYKNSVIC 1641
            E   K  ++  E+  +  A L C++ G  LL +  DE  N+++  +     +   +I  +D   E  F Y D   +   ++ +W PGEPNN +  EDCV       G WND+ C      +C
Sbjct:  152 ETERKMYLLVREERAYSEAALHCRSRG-GLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 5 Score: 55.8398 bits (133), Expect = 2.003e-8
Identity = 35/113 (30.97%), Postives = 53/113 (46.90%), Query Frame = 1
Query: 2824 IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPR---GEPNN-YGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            + +E   + EA   C  +G  L    +E TN  +        + + +I  +D   EG F   +  +L  + F R   GEPNN +G EDCV     S G WND++C +   F+C
Sbjct:  160 LVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 6 Score: 51.9878 bits (123), Expect = 3.785e-7
Identity = 34/120 (28.33%), Postives = 60/120 (50.00%), Query Frame = 1
Query: 2041 EKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNI---SYRNFAHGEPNNQ-NNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            E+++ + + E +  Y +A   C+S+G  L    +E  N ++    +   + + +I  +D   EG F Y DG ++   ++  +  GEPNN    EDCV     + G WND+SC +    +C
Sbjct:  154 ERKMYLLVREERA-YSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVC 270          

HSP 7 Score: 51.6026 bits (122), Expect = 5.331e-7
Identity = 30/108 (27.78%), Postives = 47/108 (43.52%), Query Frame = 1
Query: 1717 YEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKL---VYLNWAKNEPNN-YNNEDCLEGNFYPNGEWNDISCKTKNYLIYEY 2028
            Y EA   C      +    +  TN ++  +  +  + R +I  +D + EG +    G  L    +  W   EPNN +  EDC+E      G WND+SC    Y + E+
Sbjct:  167 YSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGGEDCVE--MESGGGWNDVSCTNTMYFVCEF 272          
BLAST of Mannose-binding protein C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001836.1 (pep scaffold:Pmarinus_7.0:GL478684:172:28670:1 gene:ENSPMAG00000001649.1 transcript:ENSPMAT00000001836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 5.915e-10
Identity = 42/153 (27.45%), Postives = 73/153 (47.71%), Query Frame = 1
Query: 1318 FEEKVVFKHAQLLCKNNGYELLKIDSDE----INSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY--ENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCR 1758
            F ++  ++ A+  C+ +G  L  I S E    IN M  D+         WI  ND   E+ F +SD   + Y+ W P +P+++  + EDCV  ++++NG WND+ C+Y     C +  ++       +       +   YE  IN   +++CR
Sbjct: 1637 FPQRRNWEDAERDCRLHGSHLASILSSEEQRFINRMAQDY--------QWIGLNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPCNYYLPYTCKRGAVSCGPPPIVENAMTFGRLKSRYE--INAIVRYHCR 1779          

HSP 2 Score: 56.6102 bits (135), Expect = 4.632e-8
Identity = 38/129 (29.46%), Postives = 67/129 (51.94%), Query Frame = 1
Query: 2470 RVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY--GNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIE-NIISTKELEIFKERVTF 2847
            R  +E+A R C++H   L +I +SE    I  +A+ ++    W+  ND   E ++   DG+ L+Y NW   +P+++    EDC++  +  NG+WND  C   N ++ Y  +   +S     I +  +TF
Sbjct: 1640 RRNWEDAERDCRLHGSHLASILSSEEQRFINRMAQDYQ----WIGLNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPC---NYYLPYTCKRGAVSCGPPPIVENAMTF 1761          

HSP 3 Score: 56.225 bits (134), Expect = 5.865e-8
Identity = 39/125 (31.20%), Postives = 62/125 (49.60%), Query Frame = 1
Query: 2827 FKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ--YWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY--GNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS-----PPII 3174
            F +R  +E+A+  C   G  L  I + E  + I      N++ Q   WI  NDK  E  F  S+ H L+Y  +   +P+++    EDCV  +++ NG WND+ CN    + C + +     PPI+
Sbjct: 1637 FPQRRNWEDAERDCRLHGSHLASILSSEEQRFI------NRMAQDYQWIGLNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPCNYYLPYTCKRGAVSCGPPPIV 1755          

HSP 4 Score: 49.2914 bits (116), Expect = 8.208e-6
Identity = 30/92 (32.61%), Postives = 47/92 (51.09%), Query Frame = 1
Query: 2104 CKSKGYDLIRIENEEINKIVYDVATKNKVGQ--YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ--NNEDCVHGLFYTNGLWNDISCN 2367
            C+  G  L  I + E  + +      N++ Q   WI  ND   E  F +SDG  + Y N+   +P++   + EDCV  +++ NG WND+ CN
Sbjct: 1650 CRLHGSHLASILSSEEQRFI------NRMAQDYQWIGLNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPCN 1735          
BLAST of Mannose-binding protein C vs. Ensembl Nematostella
Match: EDO49512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE1])

HSP 1 Score: 188.734 bits (478), Expect = 4.738e-48
Identity = 227/988 (22.98%), Postives = 389/988 (39.37%), Query Frame = 1
Query:  547 EKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY-WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL--WNDISCADSNAVIC-YKESKIEVLKKITVLNKELV-------------------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQN-NIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ-NEDCVHGLYYKNA----LWNDIKC-EDLNAVIC---------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDAND----IQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIY-EWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKEITI-------------------------EIMEGKVNYIKALELCKSKGYD------LIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTN---GLWNDISCNSINSVLC----------YKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIEN-SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYG-NEDCLLGN--YFANGKWNDFSCSTKNSFI--YYYIENIISTKEL-----------------EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            EK ++  A   C++ G  L+ I      + +     Q+ +  Y WI  +D   E  +  SDG  + +  +   +P+N+   E C H  +  +A+  WND+ C   N+ IC  K++ +     +      +V                   +  ++ T+  A+D C++QG +L  I     +++V +  V + + G  WI   D    G +  +D + + ++ W  GEPN+      CV      ++     W D  C E+ +A +C                   G   F      +    +F     +  A+  C+  G     +   +    ++  ++ +N  T WI  ND      +  T     +   S     PG         C  G  Y  GL     C Y            SN T            L T+ EA +FC +    +V +     N  ++ E          WI  ND+ TEG    S G+ + Y+NW   EPNN+N  EDC E + + +G WND +C  K  ++  ++ +T     T+                          + + + N++ A  +C S+G +      L+ I N      +  +   N+ G  WI  ND++ EG F + D  +++Y N+  G+P      DCV G+  ++   G W+   C+     +C            P     D      K   S Y ++  ++ ++EA   CQ    +L++I    E   +I NL  K  +   W     +     +   D +  +Y NW +G+P   G ++ C+  N    +NG+W+   C  KNSF+   Y  E  ++   L                       VT+ +A++TC ++G  LV I N+E  Q+      K+     WI  ND+ +EG +  S+   L Y  +  GEPN+  G E+C   +   N  WND +C+ +  +IC
Sbjct:  951 EKKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYAWIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDCTENSHAYVCKMFRRNYTPPPPSPTTAATGPCPFGWKVYRSACYRVFMSPTTWTGARDACRATGDNTDLVSMHDSGESLFVQSLTNNSLTLWIGLNDRGSISASRATPSRPPTSTPSPTTQAPGV--------CDAGWVYWGGL-----CYYF-----------SNATTAD---------LKTWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGEMSRF-DGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVC-SQGLNSTNSGHLVVINNLYEQAFLTTMLASNR-GNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPGWSYWADCV-GMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHGVKEQAYMIKNL--KDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQE-EQDFLIYQSKSSYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGE-MVAGNRLWNDYSCSQQRGYIC 1897          

HSP 2 Score: 181.8 bits (460), Expect = 5.038e-46
Identity = 233/992 (23.49%), Postives = 385/992 (38.81%), Query Frame = 1
Query:  160 EKTTFTEANKLCQAKGYNLIKI----EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMF--YKDGFWNDISCDDTNSVICYK---------NTQPKTSHVIKLL-----------NRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAV-QYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNA----LWNDISCAD-SNAVIC--YKESKIEVLKKITVLNKELV-------------IFKERLTYYKAQDLCKSQG--YKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIY-DFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVICSK---DILNSNETIKQQQKY------------------YVHEVLVTYEEAINFCNQ-----HNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGK--WVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPN--GEWNDISCKTKNYLIYEYESTAEK--------------------EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVA-TKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQN-NEDCVH--GLFYTNGLWNDISCNSINSVLC--YKP---FXXXXXXXXXXGKIDTSKY-FVHTG---RVTYEEALRFCQIHSCRLVTIENSE-LDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGK-WNDFSCSTKNSFI 2781
            EK +++ A + CQA G +L+ I    E      +V    ++ +A   WI  +D  VE  +E+ +G  +++  +   +P+N+   EDC H     +  G WND+ C   NS IC           +  P T  V+              N    ++ +K T+ +A   C+++G +L  I     +++V +L V  +  G  WI   D    G +  +DG  + +  +  GEPN+      CV      ++     W D  C + S+A +C  ++ +        T                    +F    T+  A+D C++ G    LV + D      ++  ++ NN    WI  ND    G+   S     +                C  G  Y   L             CY             SN      +    +  A+  C+ +  +L+ + +   N+ ++ +   ++   T WI  ND+ TE    +SD   +SY  W   EPNN+   EDC   +   +G WND  C+ K + +C K    I      I                        +V +    +  A + C+Q     ++  +V I+N+     +     + + G  WI  ND+ TEG   WVD   + + Y NW   +P      DC+  +   +  GEW+   C      + E ++                        E    +   K+N+ +A E+C+  G  LI I    + +  Y +   K+ VG  W     +     F +SD     Y N+A G+P     ++ CV       +NG W+ + C   NS +C  YK           + + G +   K+ ++ +G    VT+ +A   C      LV+I N E  D LI     K      W+  ND   EG W   DG+ L Y+ WN GEPN+  G E+C  G   A  + WND+SCS +  +I
Sbjct:  951 EKKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYA---WIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDCTENSHAYVCKMFRRNYTPPPPSPTTAATGPCPFGWKVYRSACYRVFMSPTTWTGARDACRATGDNTDLVSMHDS--GESLFVQSLTNNSLTLWIGLND---RGSISASRATPSRPPTSTPSPTTQAPGV-CDAGWVYWGGL-------------CYY-----------FSNATTADLK---TWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGE-MSRFDGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVCSQGLNSTNSGHLVVINNLYEQAFLTTMLASNR-GNVWIGLNDLHTEGTFGWVDY--SSVAYTNWIAGKPGWSYWADCVGMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHG--VKEQAYMIKNLKDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQ--SKSSYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENC--GEMVAGNRLWNDYSCSQQRGYI 1896          

HSP 3 Score: 150.599 bits (379), Expect = 1.878e-36
Identity = 204/924 (22.08%), Postives = 332/924 (35.93%), Query Frame = 1
Query:   10 EHCVHGLYYPNAL--WNDFSCEDPSAVIC-YKETEPKISAEIELQSKYVI-------------------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAI-QYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDG----FWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELI---------------------------ILQEKTTYENAIAHCKSKG--FQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRY-----WIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKNALWNDIKCEDLNAVICYK--NIGSRGFTKFEISNKEIV-----------------IFEEKVVFKHAQLLCK------NNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKN---GLWNDIKCDYKNSVICSKDILN---------------SNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMK--IGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYN-NEDCLEGN--FYPNGEWNDISCKTKNYL---IYEYESTAEKEITIEIMEGKVNYIK----------------ALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            E C H  + P+A+  WND  C   ++ IC  K+        +   +  V+                   +  +K T+ +A   C+A+G  L  I     +  V +L +  + AG  WI   D    G + + +G  + +  +  GEPN+      CV            +W D  C           T+   ++V K+  R                              +    TT+  A   C++ G    L+ + D   +  V +L         WI  ND    G+  +S  +    R          Q    C  G  Y   L             CY  S           N      K   T+ +A+D C+     LV +     N+ V++        RY     WI  ND+  EG    SD + + +  W   EPNN+   EDC   +   +  WND  C      +C K  N     FT    S    V                 +F+++  + +A+ +C       N+G+  L + ++          +  N G  WI  ND+ TE TF + D   ++Y  W  G+P      DCV G+   +   G W+   C      +C  D L                S  +   +  Y ++   + ++EA   C +   +++ I  V+    +    KN+K  +G  W     +     +  S  +   Y NWA+ +P     ++ C++ N     NG W+ + C  KN     IY+ E      +  E   G V + K                A   C  +G DL+ I N EE + ++Y   +K+     WI  ND N+EG + +SDG  ++Y  +  GEPN+    +    +   N LWND SC+     +C
Sbjct: 1032 EDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDC-----------TENSHAYVCKMFRRNYTPPPPSPTTAATGPCPFGWKVYRSACYRVFMSPTTWTGARDACRATGDNTDLVSMHDSGESLFVQSLTNNSLT--LWIGLND---RGSISAS--RATPSRPPTSTPSPTTQAPGVCDAGWVYWGGL-------------CYYFS-----------NATTADLK---TWMEARDFCRKSRGDLVSLRTANENAFVFSEIKT----RYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGE-MSRFDGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVCSQGLNSTNSGH--LVVINNLYEQAFLTTMLASNRGNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPGWSYWADCV-GMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHGVKEQAYMI---KNLKDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQ--SKSSYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMVAGNRLWNDYSCSQQRGYIC 1897          

HSP 4 Score: 134.035 bits (336), Expect = 2.363e-31
Identity = 115/389 (29.56%), Postives = 181/389 (46.53%), Query Frame = 1
Query:  958 AQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKF-SKWAAGEPNNYQ-NEDCVHGLYYKNALWNDIKCEDLNAVIC------------YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKID-SDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVY-SDSKKIS--YQKWYPGEPNNYEN-EDCVHGLYYKN--GLWNDIKCDYKNSVICSK----DILNSNETIKQQQKYY--VHEV-LVTYEEAINFCN--QHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNE--DC---LEGNFYPNGEWNDISCKTKNYLI 2019
            A++LC+S G  L  I D+   + +     Q     +W+  ND   E ++  +D     F + W  GEPNN+Q NEDC   L Y++ LWND  C    + IC            +   G+  + KF  S+K  +I         AQ  C  +G  L+K+D SDE + + Y           WI  ND   E T+V+  D+ K+   Y  WY GEPN++ + EDC+  +Y  +  G WND  CD   + +C K     +   N    +   Y+   H+  LVT+E+A N C        ++ I   +  + I +   + K G  W+  ND ++EG +V S  + + Y NW + EP+ Y ++  DC   +    + +G+W  +SC T N  +
Sbjct:   54 AENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCY-KFSTSSKTWLI---------AQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAA-WIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCIS-MYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYV 429          

HSP 5 Score: 127.102 bits (318), Expect = 3.209e-29
Identity = 159/721 (22.05%), Postives = 266/721 (36.89%), Query Frame = 1
Query:  151 IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDI-KVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYN-LAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKEL--------------------VIFKERLTYYKAQDLCKSQGY------KLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNAL--WNDIKCEDLNAVICYKNI---------------GSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDS-DEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWY---PGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC---------SKDILNSNET--IKQQQKYYVHEVL---VTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY-NNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGY 2121
            +F   TT+T A   C+A G N   +        ++  ++  ++   WI  ND   +  +    +             P       C  G  Y  G             +CY  +   T+ +               T+  A   C+     L+ +     N+ V++ +  +Y     WI  ND+  EG    SDG  + Y  +   EPNN+   E C   +   +  WND +C      +C K +   +    T++                         +F +R  +  A+ +C SQG        LV I++  +        + +N G  WI  ND+  EGTF   D + + ++ W AG+P      DCV      ++L  W+   C      +C  +                   G++K+  S    +++  K+ +K A  +C+ +G +L+ I    E   MI +  +K  +G  W     +     F +SD     Y  W    PG+P   +    V+     NG W+ + C  KNS +C         +  +L   +   +K  +  Y+   +   VT+ +A + C +    +V I N E    +   SK+      WI  ND   EG W  S G+ L Y+ W   EPN+    E+C E     N  WND SC  +   I   +S  E    + +  G +   +        GY
Sbjct: 1252 VFMSPTTWTGARDACRATGDNTDLVSMHDSGESLFVQSLTNNSLTLWIGLNDRGSISASRATPSRPPTSTPSPTTQAPGV-----CDAGWVYWGG-------------LCYYFSNATTADL--------------KTWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGE-MSRFDGRWNDQNCNLKRTFVCRKHNNT-IFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVC-SQGLNSTNSGHLVVINN-LYEQAFLTTMLASNRGNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPGWSYWADCVGMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESC--YLMYYNKLNWKEAGEVCQKDGAQLISIHGVKEQAYMIKN--LKDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQSKS-SYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGE-MVAGNRLWNDYSCSQQRGYI--CKSKLECSFALGMSSGGITNTQLTSSLSQPGY 1928          

HSP 6 Score: 122.094 bits (305), Expect = 8.882e-28
Identity = 110/400 (27.50%), Postives = 178/400 (44.50%), Query Frame = 1
Query: 1687 KYYVHEVLV---TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGK--WVDSKGNKLVYLNWAKNEPNNY-NNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE------------IMEGKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAH---GEPNNQNN-EDCVHGLFYTN---GLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYF-VHTGR-VTYEEALRFCQ--IHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNE--DC---LLGNYFANGKWNDFSCSTKNSFI 2781
            K+ V  + V   ++E A N C  +   +  IS+      I    K      FW+  ND   E    W D    K  Y NW + EPNN+ +NEDC E   Y +G WND  C  +   I +   T +  ++ +                   ++ A + C   G  L++++N +E + + Y + T  K    WI  ND  +EG +++        +N++H   GEPN+  + EDC+    Y+    G WND  C+++ + +C KP  +           D+  +F  H  + VT+E+A   CQ  +    L++I   +    I  +    K    WL  ND   EG +V  D + + Y NW Q EP+ YG++  DC   +    F +G W   SC+T N+++
Sbjct:   38 KFIVSSLTVRGQSWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTA-KPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFICK---TLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAA-WIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCIS--MYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYV 429          

HSP 7 Score: 120.553 bits (301), Expect = 2.664e-27
Identity = 106/386 (27.46%), Postives = 176/386 (45.60%), Query Frame = 1
Query: 1336 FKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSD-SKKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICS--KDILNSNETIKQ--QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLV---YLNWAKNEPNNYNN-EDCL---EGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGK-------------VNYIKALELCKS--KGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPN--NQNNEDCVHGLFYT---NGLWNDISCNSINSVLCYK 2394
            +++A+ LC++ G  L  I      + I     ++    +W+  ND   E+++ ++D + K  Y  W  GEPNN++ NEDC   L Y++GLWND  C  + S IC   K  L+ +    Q     Y       T+  A   C+Q    +VK+ N +    +    K +     WI  ND   EG +V    N  +   Y +W   EPN++ + EDC+    G+    G WND  C T    + E +   +    +  +  K             V + KA  +C++   G DL+ I  ++  + +  V +  K G  W+  ND   EG F++SD   ++Y N+   EP+    ++ DCV  + +T   +G W  +SC + N+ +C K
Sbjct:   51 WENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSL--GGFWNDDYCDTLRAYVCE-KPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCKK 432          

HSP 8 Score: 119.783 bits (299), Expect = 5.062e-27
Identity = 106/398 (26.63%), Postives = 169/398 (42.46%), Query Frame = 1
Query:  181 ANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNG-QRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQP-----------KTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFI-SSDGKKIV--YRKFAPGEPNNYQKNEHCVHGLYYSNAL---WNDISCADSNAVICYKESKIEVLKKITVLNKELVIF-----KERLTYYKAQDLCKS--QGYKLVKI---DDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNE--DCVHGL---YYKNALWNDIKCEDLNAVICYKNIGS 1272
            A  LCQ+ G +L  I D      +     QY    FW+  ND   E ++ + +G  +  Y  + +GEPNN++ NEDC   + Y+DG WND  C    S IC     P            + +     ++  +I Q+          C   G  L+K+D+      +  +         WI  ND   EG ++   D  K+   Y  +  GEPN++   E C+    YS +L   WND  C    A +C K +   +     V  K+          + +T+ KA ++C++   G  L+ I   D++QF   V +       G  W+  ND   EGTF  SD++ + ++ W   EP+ Y ++  DCV  +    + +  W  + C   NA +C K   S
Sbjct:   54 AENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQD---------CHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCIS--MYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLS---DRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCKKTRAS 436          

HSP 9 Score: 117.472 bits (293), Expect = 2.540e-26
Identity = 112/388 (28.87%), Postives = 179/388 (46.13%), Query Frame = 1
Query: 2476 TYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGN-KLKYLNWNQGEPNNY-GNEDC--LLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKE---------LEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ-YWIDANDKAVEGKFV---DSNNHALKYSKFPRGEPNNYGN-EDCVHGLYYS-NGFWNDIACNSKNSFICSKYSP----PIIFIDEHMSYKIF----INKVTYREAVDKCQS--EGYSLIKV-ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNW---QTASLPSDKENNNCLYSSETL-SGKWLGTSCVSKNSVICYK 3537
            ++E A   CQ +   L +I +      I    +++    +W+  ND   E  +   DG  K  Y NW +GEPNN+  NEDC  LL   + +G WND  CS + SFI   ++  +S             +      T+  AQ  C + G  LV++DN +  Q+     +K  + Q  WI  ND+A+EG +V   D+      YS +  GEPN++ + EDC+     S  GFWND  C++  +++C K +     P+ ++    S   F       VT+ +A + CQ+   G  L+ + E  +  FI   LS R K  + W+   D  ++G + +SD   + + NW   + +   SD  +   L       SG W   SC + N+ +C K
Sbjct:   50 SWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTELL---YQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSD-EQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDR-KSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCKK 432          

HSP 10 Score: 112.079 bits (279), Expect = 1.267e-24
Identity = 133/549 (24.23%), Postives = 222/549 (40.44%), Query Frame = 1
Query: 2476 TYEEALRFCQIHSCRLVTIENSELDILILN-LARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEI--------------------------FKERVTFEEAQNTCIKK-----GWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSN---GFWNDIACNSKNSFICSKYS----------------PPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVEN-SDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLY--SSETLSGKWLGTSCVSKNSVIC--YK--PSKTIDTGKEVK-------KTKYYIHRIG--VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNC---LQGNPDGKWRDVSCDDKNPFF 3906
            T+ EA  FC+     LV++  +  +  + + +  ++     W+  ND+  EG     DG+ + Y+NW   EPNN+ G EDC   + F +G+WND +C+ K +F+     N I      I                          F +R  +  A++ C +         LV I+N      +  +   N+ G  WI  ND   EG F   +  ++ Y+ +  G+P      DCV G+  S+   G W+   C+    ++C   +                P          Y ++ NK+ ++EA + CQ +G  LI +    + ++++   +L+  + N W       N   +T+SD     + NW          +  C+   +S T +G+W    C  KNS +C  YK  P  T     E +       K  Y    I   VT+ +A   C  +   L+ + N +   +L   SK  S    W+  ND++ EG W  SD   L +  W  G+ N +   +NC   + GN    W D SC  +  + 
Sbjct: 1356 TWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGEMSRF-DGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVCSQGLNSTNSGHLVVINNLYEQAFLTTMLASNR-GNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPGWSYWADCV-GMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHGVKEQAYMIK--NLKDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQSKS-SYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMVAGNR--LWNDYSCSQQRGYI 1896          

HSP 11 Score: 98.2117 bits (243), Expect = 1.945e-20
Identity = 130/580 (22.41%), Postives = 226/580 (38.97%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKT---TFTEANKLCQAKGYNLIKIE--DDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIK----YHKFAKGEPNNYRN-EDCVHGMFYKD--GFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELII-----LQEKTTYENAIAHCKS--KGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEH-CVHGLYYS---NALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYW-ID------ANDVRIEGTFEDSDKNKI----------KFSKWAAGEPNNY------QNEDCVHGLYYKNAL-----------WNDIKCEDLNAVICYKNIGSR----GFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDF--AVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNN 1551
            Q NE C   L Y + LWND  C    + IC K  +  +S +          ++  T   T+  A + C   G  L+K++  D+Q         +   A   WI  ND  +EGT+ +  G   K    Y  +  GEPN++ + EDC+  M+     GFWND  CD   + +C K        V  +  ++          +  T+E A   C++   G  L+ I +      +  +    + G  W+  ND  +EG F+ SD   + Y  +   EP+ Y  +   CV  + ++   +  W  +SC  +NA +C K            L    +   + L    + D      +  +++  +  +S  +  A +N +G Y  +D         + I+G  + +D  K            F+ + A    NY       + D V  +  K+ +           W++  C  +    C     SR    G+ +   S       + + ++  A+  C   G +LL I ++   + I     A+  + G  WI  ND +T   F +SD   ++  +W  G PN+
Sbjct:  125 QDNEDCTE-LLYQDGLWNDDDCSKEYSFIC-KTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAA--WIGLNDRAIEGTYVW-EGDNTKLGQNYSHWYSGEPNDHASVEDCIS-MYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCKKTRASSKCDAPFGLADYTI--DDSLLTASSSDRTSVPAFARLRLQSKPGSSGAWCSA-KNTLGEYLQVDLGLRRQVTHIAIQGRPKSTDFVKTFYLKYGNDGSTFNYYGANATENYLVLNGSSDSDTVANIMLKDPINARFVRIYPSSWSNNICLRIEIYGCASQAYSRKCGTGWEEGPDSTCYQFNTDSRKIWADARATCLGQGGDLLSIVTNNEKAYIETRVKALDSSAGNMWIGLNDRETSRLFSWSDQSPLAIIRWDAGFPND 695          

HSP 12 Score: 91.2781 bits (225), Expect = 2.485e-18
Identity = 102/403 (25.31%), Postives = 174/403 (43.18%), Query Frame = 1
Query: 2842 TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQ-YWIDANDKAVEGKFVDSNNHALK-YSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMS------YKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLV---NYWIDGTDSKNDGKWTF-SDGQQLT--FKNWQTASLPSDKENNNCLYS-SETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIG-----------VTFQEALDFCKERR--CKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQK----TQNCLQGNP-----DGKWRDVSCDDKNPFFFEFIDENEQC 3936
            ++E A+N C   G  L  I ++++ QN     +K    + +W+  ND+A E  +  ++  A   Y+ + RGEPNN+  NEDC   L Y +G WND  C+ + SFIC     P+   D   S      YK   +  T+  A   C   G  L+KV+NSD     H LS   K V     WI   D   +G + +  D  +L   + +W +          +C+   S +L G W    C +  + +C KP+     G+ +    +  ++             VT+++A + C+       L+ +   D   ++ ++         WL  ND+ +EG ++ SD+  + + NW  G+    K    +++C+   P      G W  VSC   N +  +    + +C
Sbjct:   50 SWENAENLCQSYGGHLASI-SDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFICKTLKAPLS-CDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQ---HFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSLGGFWNDDYCDTLRAYVCEKPN-----GQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNW--GQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCKKTRASSKC 439          

HSP 13 Score: 77.0258 bits (188), Expect = 5.204e-14
Identity = 59/259 (22.78%), Postives = 121/259 (46.72%), Query Frame = 1
Query: 2833 ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQY-WIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLY--YSNGFWNDIACNSKNSFIC---SKYSP-----------------PIIF---IDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKE-NNNCLYSSETLSGK----WLGTSCV 3510
            E+ ++  A+  C   G  LV I +     +I     +  + +Y WI  +D++VE  +  S+   ++++ +   +P+N+   EDC H  +  ++ G WND+ C S NS+IC     Y P                 P+ +    D ++ Y + ++K T+ +A D C+++G  L  +    + + +   L   +   + WI  TD+   G + ++DG  + + +W     P+D+    +C+ ++ T+S +    W+ + C 
Sbjct:  951 EKKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYAWIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGE-PNDRGITGSCVRATMTVSSRDWMYWVDSDCT 1208          

HSP 14 Score: 71.2478 bits (173), Expect = 3.346e-12
Identity = 106/453 (23.40%), Postives = 172/453 (37.97%), Query Frame = 1
Query: 2785 YYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIY-DLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS----PPIIFIDEHMSYKI------FIN--KVTYREAVDKCQ---------SEGYS------LIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLS--GKWLGTSCVSKNSVICYK------------------PSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKT-QNCLQGN----PDGKWRDVSCDDKNPFFFEFIDENEQCKE*LLNSLYKNNIKF 3981
            YY  N  +T +L+      T+ EA++ C K    LV +     N  ++ ++  +      WI  ND   EG    S+   + Y  +   EPNN+ G EDC   +   +G WND  CN K +F+C K++    PP   I       +      +IN  K  Y+   D+ Q         S+G +      L+ + N      + T+ L     N WI   D   +G + + D   + + NW  A  P      +C+  S + S  G+W    C      +C                    PS     G+      Y ++   + ++EA + C++   +LI +  +    Y+ +  K L +   W       N   +  SD+    + NW  G+     T Q C+Q N     +G+W  V C  KN F  +           LL       +KF
Sbjct: 1344 YYFSNA-TTADLK------TWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGE-MSRFDGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVCSQGLNSTNSGHLVVINNLYEQAFLTTM-LASNRGNVWIGLNDLHTEGTFGWVDYSSVAYTNW-IAGKPGWSYWADCVGMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESC----YLMYYNKLNWKEAGEVCQKDGAQLISIHGVKEQAYMIKNLKDL-VGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKF 1781          

HSP 15 Score: 67.781 bits (164), Expect = 3.255e-11
Identity = 71/338 (21.01%), Postives = 137/338 (40.53%), Query Frame = 1
Query: 2476 TYEEALRFCQIHSCRLVTIENS-ELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNY--FANGKWNDFSCSTKNSFI----YYYIE---------NIISTKELEIFKERV--------------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKN-KIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNG----FWNDIACN-SKNSFICSKY---------------SPPIIF---IDEHMSYKIFINKVTYREAVDKCQSEG--YSLIKVENSDISFIVHTLS 3315
            ++  A + CQ +   LV+I++  E   + L + +       W+  +D   E  W   DG+ +++ NW   +P+N+   EDC    +   A G+WND  C + NS+I      Y+            + T    +  +R               T+ +A+++C  +G  L  I     +  +  L V +   G  WI   D    G +  ++   + ++ +  GEPN+ G    CV      +     +W D  C  + ++++C  +               + P  F   +     Y++F++  T+  A D C++ G    L+ + +S  S  V +L+
Sbjct:  954 SWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYAWIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDCTENSHAYVCKMFRRNYTPPPPSPTTAATGPCPFGWKVYRSACYRVFMSPTTWTGARDACRATGDNTDLVSMHDSGESLFVQSLT 1291          
BLAST of Mannose-binding protein C vs. Ensembl Nematostella
Match: EDO49509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGD7])

HSP 1 Score: 155.221 bits (391), Expect = 7.206e-38
Identity = 207/986 (20.99%), Postives = 384/986 (38.95%), Query Frame = 1
Query:  547 EKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRY------WIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL--WNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRG----FTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKH-NIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVHGLYYKNG----LWNDIKCDYKN-SVICSK-----------------------DILNSNETIKQQQKY-YVHEVLV---TYEEAINFCNQHNCRIVKISNVETNKIIYE-WSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE-------------------------IMEGKVNYIKALELC-----KSKGYDLIRIENEE----INKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCV--HGLFYTNGLWNDISCNSINSVLC-YKPFXXXXXXXXXXGKIDTSKYFVHTG---------RVTYEEALRFCQIHSCRLVTIENS-ELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFAN--GKWNDFSCSTKNSFIY------YYIENIISTKELEIFKE------------RVTFEEAQNTCIKKGWSLVRI-DNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNN-YGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            +K  +++A   C+++G +L+ I      S V    +  ++G +      WI  +D   E  +  SDG  + +  +   +P+N+  +E C H  + ++A+  WNDISC  + A IC ++ +      ++             T  + Q++C+     L        +    NY   +           + + G   D      K      G P  Y + +  + L+ K+      K  D+  V     + ++G    + +    N    +  +K  +  A+  C+  G EL  I +   ++++    V   + G  WI   D      + ++D   + +  W+ GEPN+      CV      +      W D  C     + +C K                          +   T  +   Y +  + LV   T+++A   C Q    ++ I +   N  +Y  +    +    WI  ND+  E  +  S G+ L Y N+   EPN++   EDCLE   + NG+WND  C  KN  I + ++ +   I+                           +   + N+  A   C      S   DL+ I+N+     I+ ++    +K +   +WI  NDI+ EG F ++D   + Y N+   +P N+ N DCV      +  G W    C+     +C                  D  +++   G         ++ + EA   C+     LV+I ++ E   L+ N+   + +   W     +    E+   D +  ++ +W++G+P   G  + C+     AN   +W+   C  +N F+        +I   +  K L  FK             R+T+ +A+  C ++G  LV I   +E +  IY +   N I   W   ND++VE  +  S+   + ++ +  G+PN+ +G ++CV  +    G WND+ C  +  +IC
Sbjct:  960 DKRNWQSARLMCQNRGGELVSI-----LSPVEQAHITLEVGFFGLSTFAWIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDKEYNPSAPVSPT-----------TAPRQQNICEWTSDALSCPSSTVISVQKANYGRTDRQ-----PCGPISVTGCVFDVTA---KLQAMCDGNP--YCSVNPTNQLFGKDPCPTVRKYLDVTFVCKRGAVVTQGCPAGWQRSPDGNACYGLTLDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPR---FWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSAFEQAFLLRNMI--NFVGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMCKINKGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGI-WIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCV-AVQTRMGSWNDVNCMQRRGYIC 1911          

HSP 2 Score: 151.754 bits (382), Expect = 8.181e-37
Identity = 139/559 (24.87%), Postives = 225/559 (40.25%), Query Frame = 1
Query:  160 EKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYN-LAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICYK--NTQPKTSHVIKLLNREL----------------IILQEKTTYENAIAHC-----KSKGFQLIKIDDDQLNSMVYNLAVQYQI-GRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCV--HGLYYSNALWNDISCADSNAVICYKES-KIEVLKKITVLNKELVIFKE-------RLTYYK-----AQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNY-QNEDCVHGLYYKN--ALWNDIKCEDLNAVICYKNIGSRGFTK---------FEISNKEIVIFE--EKVVFKHAQLLCKNNGYELLKIDSD-EINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNE 1668
             + T+ +A   CQ  G  LI I+    N  VY+    +Y +   WI  ND+  E  +E+ +G  + Y  +   EPN+++  EDC+  M   +G WND  C+  N  IC K  N+ P  S         L                 +  E+  + NA   C      S    L+ ID+    + + ++ + Y    R+WI  ND+  EG F  +D   + Y  +   +P N + N  CV      ++   W    C+     IC   +  I         N +   F         R++Y K     A+++CK +G  LV I    F        + N +G  W     +     F  SD++  +FS W+ G+P      + CV  +   N  A W+ + C   N  +C  N G    T          F+  +K   +F    ++ +  A+L C+  G +L+ I S  E + +IY     + I   W   ND   E  + +SD   +S+  W  G+PN++   D    +  + G WND+ C  +   IC   +  SN 
Sbjct: 1366 SRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLE-MVRWNGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMN-RANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSA-FEQAFLLRNMINFVGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMCKINKGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGIWI-WTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCVAVQTRMGSWNDVNCMQRRGYICKAKLECSNP 1920          

HSP 3 Score: 151.369 bits (381), Expect = 1.336e-36
Identity = 195/911 (21.41%), Postives = 338/911 (37.10%), Query Frame = 1
Query:    7 NEHCVHGLYYPNAL--WNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTN-----SVICYKN---TQ--PKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAV-QYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNA----LWNDISCADSN-AVICYKESKIEVL--------------------KKITVLNKELVIFK-----ERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYN-YAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGS-------------------RGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNG-----YELLKIDSDE----INSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV--HGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK---------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMK--IGRFWINGNDI--ITEGKWVDSKGNKLVYLNWAKNEPNNY-NNEDCLEG--NFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEI-------------------MEGKVNYIKALELCKSKGYDLIRI-ENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            +E C H  +  +A+  WND SC    A IC ++ E   SA +             TT      +C+     L        + Q  N                I V G    V     K      G P  Y + +  + +F KD       C         + +C +    TQ  P         N    +  +K T+ +A   C+++G +L  I     +++V +L V  +  G  WI   D    G +  +DG  + +  +  GEPN+      CV      ++     W D +C  +  A +C K      +                    K  T       +F       R T+  A+  C+  G +L+ I     N+ VY+ +  +      WI  ND+  E  +E SD + + ++ +   EPN++Q  EDC+  + + N  WND +C   N  IC K   S                    G+  ++ S  + V  E +  + +A+L C          +L+ ID+      I+SM+  +  K     +WI  NDI TE  F ++D+  + Y  W   +P N  N DCV      +  G W    C ++   IC    L    T                     Y +  + + + EA   C +    +V I +      +    +NM   +G  W     +    E  W D    +  + +W++ +P      + C++   +   +  W+ + C  +N  + +     E  IT  +                   M  ++ + +A   C+ +G DL+ I   +E + ++Y + T N +   W   ND +VE  + +SDG  +S+ ++ +G+PN+    D    +    G WND++C      +C
Sbjct: 1040 SEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDKEYNPSAPVS-----------PTTAPRQQNICEWTSDALSCPSSTVISVQKANYGRTDRQ-----PCGPISVTGCVFDVTA---KLQAMCDGNP--YCSVNPTNQLFGKD------PCPTVRKYLDVTFVCKRGAVVTQGCPAGWQRSPDGNACYGLTLDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQ-NWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPR---FWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSAFEQAFLL---RNMINFVGNVWTGMTRMPNTVEFTWSDQSVKE--FSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMCKINK-GEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGI-WIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCVAVQTRMGSWNDVNCMQRRGYIC 1911          

HSP 4 Score: 148.673 bits (374), Expect = 7.902e-36
Identity = 116/407 (28.50%), Postives = 185/407 (45.45%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVL---NKELVIF---------------KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFE-DSDKNKIKFSKWAAGEPNNYQN-EDCVHGLY-YKNALWNDIKCEDLNAVICYKNIG---------SRGFTKFEISNKEIVIFEEKVVFKHAQLLCK-NNGYELLKI----DSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNN---YENEDC-VHGLYYKNGLWNDIKCDYKNSVICSK 1647
            Q   ++E+A   C+S G +L  I D    S +    ++Y+  R+WI  ND  +EGNF   DG    ++ +  GEPNN+Q NE C   ++ +   WND  C+++   IC + +      + T++    +  ++                  R T+  A+  C   G  LVK+DD    + + +Y  +      WI A D   EG F  + D   + ++ W  GEPN++   EDCV  +  Y    WND  CE     IC K  G         + G + FE +        +K+ +  AQ  C+ N+G +L  +    + + I S + DF  ++     WI  NDI TE  FV+SD  K+ Y  W P EP +    +++DC V     +NG W+   C  K + +C +
Sbjct:   47 QIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQ-NEDCAEAVW-NTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFL-SYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHP----AQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARN----VWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCRR 442          

HSP 5 Score: 140.969 bits (354), Expect = 1.819e-33
Identity = 124/442 (28.05%), Postives = 190/442 (42.99%), Query Frame = 1
Query:   85 ICYKETEPKIS-----AEIELQSKYVIIF------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQ---PKTSHVIKLLNRELIIL---------------QEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFI-SSDGKKIVYRKFAPGEPNNYQKNEHCVHGLY-YSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFK------ERLTYYKAQDLCK-SQGYKL--VKIDDEQ--FNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNN---YQNEDC-VHGLYYKNALWNDIKCEDLNAVICYKNIG 1269
            +C     P++S     A  E  S Y  +F      Q   ++ +A+  CQ+ G  L  I D    + +    I+Y   RFWI  ND   EG F +V+G    +  + KGEPNN++NEDC   + +  G WND  C +T   IC +      P    ++    +  I+                  + T+  A A C   G  L+K+DD  + N + Y      Q    WI A D   EG+F+   DG  + Y  +  GEPN++   E CV  +  Y    WND  C      IC K    E L  +  +      F+      ++LT+ +AQD C+ + G  L  V+  DEQ    S + ++  +N     WI  ND+  EG F  SD+ K+ ++ W+  EP +     ++DC V     +N  W+   C      +C +  G
Sbjct:   12 LCVLILAPEVSHGACQAGWESYSSYCYLFVVRSQSQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAV-WNTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQ--SMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFG-ENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARN----VWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCRRRRG 445          

HSP 6 Score: 139.813 bits (351), Expect = 4.026e-33
Identity = 163/720 (22.64%), Postives = 273/720 (37.92%), Query Frame = 1
Query: 1714 TYEEAINFCNQHNCRIVKI-----SNVETNKIIYEWSKNMKIGRFWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYN-NEDCLEGNFYPNGE----WNDISCKTKNYLI---------------------------------YEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYD-VATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYK------------PFXXXXXXXXXXGKI--DTSKY-FVHTGRVTYEEALRFCQIHS-----CRLVTIEN----SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDC--LLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKE--------------------RVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN-EDCVHGLYYSN--GFWNDIACNSKNSFIC--------------SKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKV-ENSDISFIVHTLSLRYKLVN---YWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVIC 3531
            T+ +A + C      +  I     S + T+ ++  W      G  WI   D    G  +W D  G+ + + NW   EPN+      C+      +      W D +C +  Y                                   + Y        + + +  +  +  A   C+  G +LI I++   N  VY     K +    WI  ND++ E  + +SDG  +SY N+   EPN+ Q  EDC+  + + NG WND  CN  N  +C K            P       +   G +  D S Y FV T R  +  A   C   +       LVTI+N    + +  ++L+   K +   +W+  NDI  EG +   D + ++Y NWN  +P N  N DC  +    +A GKW    CS +  +I       I    +                         ++ + EA+  C K+G  LV I +    Q      + N +G  W          +F  S+    ++S + RG+P   G  + CV  +  +N    W+ + C  +N F+C               K  P     D+H       +++T+ +A  +CQ EG  L+ +    +  F+++ +    K VN    W    D   +  + +SDG  ++F +W     P+D    +   + +T  G W   +C+ +   IC
Sbjct: 1208 TWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDA----GDVWIGLTDTNQRGIYRWTD--GSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPR---FWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSI-HSAFEQAFLLRNMINFVGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMCKINKGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQM----KTVNGIWIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQ-PNDHWGRDNCVAVQTRMGSWNDVNCMQRRGYIC 1911          

HSP 7 Score: 124.405 bits (311), Expect = 2.007e-28
Identity = 107/397 (26.95%), Postives = 175/397 (44.08%), Query Frame = 1
Query: 2473 VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIEN-----------------IISTKELEIF--------KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFV-DSNNHALKYSKFPRGEPNNY-GNEDCVHGLY-YSNGFWNDIACNSKNSFICSKYSP------PIIFIDEHMSYKIF----INKVTYREAVDKCQ-SEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSD--KENNNC-LYSSETLSGKWLGTSCVSKNSVICYK 3537
            +++E+A   CQ +  RL +I +      I     +++   +W+  ND   EG +  +DG+   + NW +GEPNN+ NEDC     +  G+WND  CS    +I   + +                 I+     E F          R T+  A+  C   G  LV++D + T QN      +      WI A D+A EG FV + +   + Y+ + RGEPN++ G EDCV  +  Y  G+WND  C    +FIC K  P      P+ ++    S   F      K+T+ +A D C+ + G  L  V   D    + +    +   N WI   D   +G + +SD  ++ + NW      S    ++ +C +  + + +G W  T C  K + +C +
Sbjct:   50 LSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEA-VWNTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVD-DATEQNFLSYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEK--PFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCRR 442          

HSP 8 Score: 124.405 bits (311), Expect = 2.297e-28
Identity = 108/387 (27.91%), Postives = 169/387 (43.67%), Query Frame = 1
Query: 2104 CKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK------PFXXXXXXXXXXGKI---------DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWV-NIDGNKLKYLNWNQGEPNNY-GNEDC--LLGNYFANGKWNDFSCSTKNSFI--YYYIENIISTKELEI----------FKERVTFEEAQNTC-IKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNN---YGNEDCVHGLYYS-NGFWNDIACNSKNSFICSK 3156
            C+S G  L  I +      +     + +  ++WI  ND   EG F + DG N S++N+  GEPNN  NEDC   ++ T G WND  C++    +C +      P +        +  I          TS Y  +T R T+  A   C      LV ++++     +   +R    S  W+   D   EG +V   DG  + Y NW +GEPN++ G EDC  ++  YFA G WND  C    +FI    + EN+     + I            +++T+ +AQ++C +  G  L  +   +    I            WI  ND A EG FV S+   + Y+ +   EP +     ++DCV     S NG W+   C  K +++C +
Sbjct:   59 CQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAVWNT-GQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQS-MWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFA-GYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCRR 442          

HSP 9 Score: 121.709 bits (304), Expect = 1.365e-27
Identity = 110/398 (27.64%), Postives = 176/398 (44.22%), Query Frame = 1
Query: 1702 EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCK-TKNYLIYEYES------------TAEKEITIEIM------------EGKVNYIKALELCKSKGYDLIRIENE-EINKIVYDVATKNKVGQYWINANDINVEGQFIY-SDGQNISYRNFAHGEPNNQNN-EDCVHGLF-YTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYF-VHTG-RVTYEEALRFCQIHS-CRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNN---YGNEDC-LLGNYFANGKWNDFSCSTKNSFI 2781
            ++ +++E+A   C  +  R+  I +      I   +   +  RFWI  ND  +EG   WVD  G+   + NW K EPNN+ NEDC E   +  G+WND  C  T  Y+     S            T +  I  +                +  +  A   C   G  L+++++  E N + Y   T ++    WI A D   EG F++  DG  ++Y N+  GEPN+ +  EDCV  +  Y  G WND  C    + +C KPF E+          D+   F  H   ++T+ +A   C+++S   L ++   +    IL+          W+  NDI  EG +V  D  K+ Y NW+  EP +     ++DC +L     NG W+   C+ K +++
Sbjct:   47 QIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVD--GSNSSFKNWRKGEPNNWQNEDCAEA-VWNTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQ--SMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYL 439          

HSP 10 Score: 120.168 bits (300), Expect = 4.057e-27
Identity = 104/391 (26.60%), Postives = 163/391 (41.69%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGF----TKFEISNKEIVIFE---------------EKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVY-SDSKKISYQKWYPGEPNNYEN-EDCVHGLY-YKNGLWNDIKCDYKNSVICSKDI------LNSNETIKQQQKYYVHEVL-VTYEEAINFCNQHN-CRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNN---YNNEDC--LEGNFYPNGEWNDISCKTKN 2010
            L++  A   C+S G +L  I D    S +    ++    R+WI  ND   EG F   D +   F  W  GEPNN+QNEDC   ++     WND  C +    IC K + S  +    T    + +  ++ +                +  +  A+  C   G  L+K+D D        +  +    + WI A D   E  FV+  D   ++Y  W+ GEPN++   EDCV  +  Y  G WND  C+   + IC K        +N         ++  H    +T+ +A + C  ++   +  +  ++    I     +      WI  NDI TEG +V S   K+ Y NW+  EP +    +++DC  LE     NG W+   C  K 
Sbjct:   50 LSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAVW-NTGQWNDELCSNTYGYIC-KRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVD-DATEQNFLSYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQ-NGTWSSTPCALKT 436          

HSP 11 Score: 116.701 bits (291), Expect = 3.999e-26
Identity = 113/473 (23.89%), Postives = 180/473 (38.05%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKE-------TEPKISAEIEL-----------QSKYVIIFQEKTTFTEANKLCQAKGYN------LIKIEDDQFNTQVYNLAIQYHA-GRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCV--HGMFYKDGFWNDISCDDTNSVICYKNTQP-KTSHVIKLLNRELIILQE------------KTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSN--ALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKE------------RLTYYKAQDLCKSQGYKLVKIDDEQFNS-IVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVIC 1254
            Q  E C+  + + N  WND  C   +  IC K+       + P  +    L           +S Y  +  E+  +  A   C  +G N      L+ I++      + ++ + Y +  RFWI  NDI  EG F + +   ++Y  +   +P N  N DCV      +  G W    C      IC     P   + V    N +                  K  +  A   CK +G  L+ I      + +    + + +G  W     M N   F  SD     +  ++ G+P      + CV  +  +N  A W+ + C   N  +C K +K E     TV  K L  FK             RLT+ +A+  C+ +G  LV I  +Q    ++Y     N I   W   ND  +E  +E SD + + F+ W  G+PN++   D    +  +   WND+ C      IC
Sbjct: 1444 QGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCD-RGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSAFEQAFLLRNMINF-VGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMC-KINKGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGI-WIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCVAVQTRMGSWNDVNCMQRRGYIC 1911          

HSP 12 Score: 105.145 bits (261), Expect = 1.486e-22
Identity = 96/394 (24.37%), Postives = 156/394 (39.59%), Query Frame = 1
Query: 1336 FKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLV--------------------TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWV-DSKGNKLVYLNWAKNEPNNYNN-EDCLEGNF-YPNGEWNDISCKTKNYLIYEYESTAEKEITIEIM-------------EGKVNYIKALELCK-SKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN---QNNEDC-VHGLFYTNGLWNDISCNSINSVLCYK 2394
            ++ A + C++ G  L  I      S I    +++    +WI  ND  +E  F + D    S++ W  GEPNN++NEDC   ++   G WND  C      IC +       T            +V                    T+  A   C+     +VK+ +      +   S+ +     WI   D   EG +V +  G  + Y NW + EPN+++  EDC+E    Y  G WND  C+     I E +   E    +  +               K+ + +A + C+ + G DL  +   +    +    T       WI  NDI  EG F++SD   + Y N++  EP +    +++DC V      NG W+   C    + LC +
Sbjct:   52 WEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAVW-NTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTIS-QSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICE-KPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCRR 442          

HSP 13 Score: 99.7525 bits (247), Expect = 7.319e-21
Identity = 125/567 (22.05%), Postives = 213/567 (37.57%), Query Frame = 1
Query: 2476 TYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISG-YWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYG-NEDCLLGNYFANGK----WNDFSC-STKNSFI--------------------------------YYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYD-LAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNSFICSKY--SPPIIFIDEHMS------------------YK-IFINKVTYREAVDKCQSEGYS-----LIKVENSDISFIVHTLSLRYKL-VNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNC--LYSSETLSGKWLGTSCVSKNSVIC-----------YKPSKTIDTGKEVKK---TKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLS-IEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNCLQ----GNPDGKWRDVSCDDKNPFF 3906
            T+ +A   C+     L +I       L+ +L      +G  W+   D  + G +   DG+ + + NW  GEPN+ G    C+      + +    W D +C ST  +F+                                + Y   +      +    R T+++A+  C + G  L+ I +   N  +Y     K +    WI  ND   E  +  S+   L Y+ +   EPN++ G EDC+  + + NG WND  CN KN +IC K   S PII                         YK +   +  +  A  +C     S     L+ ++N      + ++ L Y     +WI   D   +G + ++D   + + NW T   P ++ N +C  +      +GKW    C  +   IC             P+   D  +   K   + Y +  I + + EA + CK+    L+ + +     +L  L   ++ +   W       N   +  SD+    F +W+ G+      TQ C+Q     N D +W  V C  +N F 
Sbjct: 1208 TWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQ-PMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSAFEQAFL--LRNMINFVGNVWTGMTRMPNTVEFTWSDQSVKEFSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFM 1770          

HSP 14 Score: 90.8929 bits (224), Expect = 3.423e-18
Identity = 95/407 (23.34%), Postives = 164/407 (40.29%), Query Frame = 1
Query: 2839 VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKF--VDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS-----------PPI----IFID------EHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVN--YWIDGTDSKNDGKWTF-SDGQQLTFKNWQTASLPSDKENNNCL-YSSETLSGKWLGTSCVSKNSVICYKPSKT-------IDTGKEVKKTKYYIHRIGVTFQEALDFCK-ERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWT---NGKVNIQKTQNCL---QGNPDGKWRDVSCDDKNPFFFEFIDENEQC 3936
            +++E+A   C   G  L  I +      I    ++ +  ++WI  ND+  EG F  VD +N + K   + +GEPNN+ NEDC   ++ + G WND  C++   +IC + +           PP     I  D          YK    + T+  A   C   G  L+KV+++      + LS R + ++   WI  TD   +G + +  DG  + + NW            +C+   +   +G W    C    + IC KP          +  G    +   +  +  +T+ +A D C+      L  V  ID    +            W+  ND   EG ++ SD+ K+ + NW+    G   +  +++C+    G+ +G W    C  K  +        +QC
Sbjct:   50 LSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFK--NWRKGEPNNWQNEDCAEAVW-NTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQ---NFLSYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQ-KLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCRRRRGRDQC 449          

HSP 15 Score: 67.0106 bits (162), Expect = 5.503e-11
Identity = 87/418 (20.81%), Postives = 159/418 (38.04%), Query Frame = 1
Query: 2833 ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKN-KIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNG----FWNDIACNSKN-SFICSKYSPPIIFID------------------------EHMSYKI----FINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK----------PSKTIDTGKEVKKT-KYYIHRIGVTFQ----EALDFCKER-RC----------KLIVVDNIDTNIYLWELSKK-LSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNP----DGKWRDVSC 3885
            ++ T+ +A+++C  +G  L  I     +  +  L V +   G  WI   D    G +  ++   + ++ +  GEPN+ G    CV      +     +W D  C S   +F+C KY P                                M Y       +++ T+++A   CQ  G  LI ++++ + +F+      +Y+    WI   D  ++  + +SDG  L++ N+     P+D +           +GKW    C  KN  IC K          PS T   G  + +    ++H     ++    E  ++   R RC           L+ +DN     ++  +     S  ++W+  ND   EGA+  +D   + + NW   +   +   +C+   P     GKW    C
Sbjct: 1205 DKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKE-PNDWQGQEDCLEMVRWNGKWNDNQCNRKNPYICKKQNNSVPIISTPSPT--PGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPC 1619          

HSP 16 Score: 67.0106 bits (162), Expect = 6.458e-11
Identity = 62/279 (22.22%), Postives = 122/279 (43.73%), Query Frame = 1
Query: 3181 DEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKE-NNNCLYSSETLSGK----WLGTSCVSKN-SVIC--YKPSKTIDTGKEVKKT-----------KYYIHRIGV-------------TFQEALDFCKERRCKLIVVDNIDTNIYLWE-LSKKLSIEKYWLNGNDKDNEGA--WIDSDKKKLTFFNWTNGKVNIQKTQNCLQG-NPDGKWRDVSCDDKNPFF 3906
            D +  Y + ++K T+ +A D C+++G  L  +    + + +   L   +   + WI  TD+   G + ++DG  + + NW     P+D+    +C+ ++ T+S +    W+ ++C S   + +C  Y+P+  + T                  K + +  G+             T+Q+A   C++   +LI + +   N +++     K      W+  ND D+E    W D      T +NW     + Q  ++CL+    +GKW D  C+ KNP+ 
Sbjct: 1195 DGNACYGLTLDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGE-PNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPN-DWQGQEDCLEMVRWNGKWNDNQCNRKNPYI 1471          

HSP 17 Score: 53.5286 bits (127), Expect = 6.641e-7
Identity = 46/161 (28.57%), Postives = 76/161 (47.20%), Query Frame = 1
Query: 1951 LEGNFYPNGE--WNDISCKTKNYLIYEYE----STAEKEI---TIEIMEGKVNYIKALELCKSKGYDLIRIENE-EINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ-NNEDCVHGLFYTN--GLWNDISCNSINSVLCYK 2394
            L G+FY  G   WN +    +   I+  E     T  KE      +    K N+  A  +C+++G +L+ I +  E   I  +V         WI  +D  +E  + +SDG  + + N+ + +P+N  N+EDC H    T+  G WNDISC +  + +C +
Sbjct:  911 LPGSFYMRGLGIWNRVLSSQEVSAIFISEFGVCRTGWKEYGQYCYQFNSDKRNWQSARLMCQNRGGELVSILSPVEQAHITLEVGFFGLSTFAWIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKR 1071          
BLAST of Mannose-binding protein C vs. Ensembl Nematostella
Match: EDO31268 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYE1])

HSP 1 Score: 71.2478 bits (173), Expect = 1.673e-14
Identity = 35/112 (31.25%), Postives = 60/112 (53.57%), Query Frame = 1
Query: 1330 VVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVICSKDILNS 1662
            + +K ++  C   G  L+ + + E N  I     +HN G  W+  +D+ TE  FV++D    ++  W P +PN+Y+N+DCVH L    G  WND++C    +  C + + N+
Sbjct:   20 LSWKQSESACAVLGSGLVSVHNHEENIFIQQ---QHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGYKWNDVQCSACQNYTCKRGVYNT 128          

HSP 2 Score: 66.6254 bits (161), Expect = 7.370e-13
Identity = 35/112 (31.25%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGL----YYKNALWNDIKCEDLNAVICYKNI 1266
            L++ +++  C   G  LV + + + N  +     Q+N G+ W+  +DV  EG F  +D +   F+ WA  +PN+Y+N+DCVH L     YK   WND++C       C + +
Sbjct:   20 LSWKQSESACAVLGSGLVSVHNHEENIFIQQ---QHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGYK---WNDVQCSACQNYTCKRGV 125          

HSP 3 Score: 62.7734 bits (151), Expect = 1.280e-11
Identity = 30/107 (28.04%), Postives = 59/107 (55.14%), Query Frame = 1
Query: 2077 VNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCYK 2394
            +++ ++   C   G  L+ + N E N  +     ++  G+ W+  +D+  EG+F+++DG   ++ N+A  +PN+  N+DCVH L    G  WND+ C++  +  C +
Sbjct:   20 LSWKQSESACAVLGSGLVSVHNHEENIFI---QQQHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGYKWNDVQCSACQNYTCKR 123          

HSP 4 Score: 61.2326 bits (147), Expect = 4.909e-11
Identity = 27/106 (25.47%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  169 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVICYK 483
            ++ ++   C   G  L+ + + + N  +     Q++ G+ W+  +D+  EG F + +G    +  +A  +PN+Y+N+DCVH +    G+ WND+ C    +  C +
Sbjct:   21 SWKQSESACAVLGSGLVSVHNHEENIFIQQ---QHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGYKWNDVQCSACQNYTCKR 123          

HSP 5 Score: 60.8474 bits (146), Expect = 6.192e-11
Identity = 30/107 (28.04%), Postives = 64/107 (59.81%), Query Frame = 1
Query: 2839 VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGF-WNDIACNSKNSFICSK 3156
            ++++++++ C   G  LV + N E  +NI+ +  ++  G+ W+  +D   EG+FV ++     ++ +   +PN+Y N+DCVH L  + G+ WND+ C++  ++ C +
Sbjct:   20 LSWKQSESACAVLGSGLVSVHNHE--ENIF-IQQQHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGYKWNDVQCSACQNYTCKR 123          

HSP 6 Score: 56.225 bits (134), Expect = 2.873e-9
Identity = 32/107 (29.91%), Postives = 55/107 (51.40%), Query Frame = 1
Query: 2452 YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL--LGNYFANGKWNDFSCST 2766
            Y      ++++++   C +    LV++ N E +I I    ++H     W+  +D+  EG +V  DG+   + NW   +PN+Y N+DC+  LG  +   KWND  CS 
Sbjct:   13 YLTSNTCLSWKQSESACAVLGSGLVSVHNHEENIFI---QQQHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGY-KWNDVQCSA 115          

HSP 7 Score: 54.299 bits (129), Expect = 1.200e-8
Identity = 31/107 (28.97%), Postives = 56/107 (52.34%), Query Frame = 1
Query: 1690 YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLE--GNFYPNGEWNDISCKT 2004
            Y      ++++++ + C      +V + N E N  I    +    G+ W+  +D+ TEG++V + G+   + NWA N+PN+Y N+DC+   G  Y   +WND+ C  
Sbjct:   13 YLTSNTCLSWKQSESACAVLGSGLVSVHNHEENIFI---QQQHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGENYGY-KWNDVQCSA 115          

HSP 8 Score: 54.299 bits (129), Expect = 1.334e-8
Identity = 29/107 (27.10%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  556 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL-WNDISCADSNAVICYK 873
            +++ + + C   G  L+ + + + N  +     Q+  G+ W+  +D+  EG F+ +DG    +  +AP +PN+Y KN+ CVH L  +    WND+ C+      C +
Sbjct:   21 SWKQSESACAVLGSGLVSVHNHEENIFIQQ---QHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDY-KNQDCVHTLGENYGYKWNDVQCSACQNYTCKR 123          
BLAST of Mannose-binding protein C vs. Ensembl Nematostella
Match: EDO30070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1U0])

HSP 1 Score: 66.6254 bits (161), Expect = 4.690e-13
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 1
Query: 1336 FKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVIC 1641
            +K AQ  C      L+ + + E N  I     KHN    W+  +D+ TE  FV++D   +++  W P +PN+Y+N+DCVH L    G  WND++C   ++  C
Sbjct:   24 WKRAQSACAVLSSGLVSVHNHEENVFIQQ---KHNGEKSWVGLSDVATEGRFVWADGSPMNFTNWAPNQPNDYKNQDCVHTLGVNYGYEWNDVQCSACHNYTC 123          

HSP 2 Score: 62.003 bits (149), Expect = 1.923e-11
Identity = 32/105 (30.48%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNAL-WNDIKCEDLNAVIC 1254
            L++ +AQ  C      LV + + + N  +     ++N  + W+  +DV  EG F  +D + + F+ WA  +PN+Y+N+DCVH L       WND++C   +   C
Sbjct:   22 LSWKRAQSACAVLSSGLVSVHNHEENVFIQQ---KHNGEKSWVGLSDVATEGRFVWADGSPMNFTNWAPNQPNDYKNQDCVHTLGVNYGYEWNDVQCSACHNYTC 123          

HSP 3 Score: 62.003 bits (149), Expect = 2.119e-11
Identity = 30/105 (28.57%), Postives = 58/105 (55.24%), Query Frame = 1
Query: 2077 VNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLC 2388
            +++ +A   C      L+ + N E N  +     K+   + W+  +D+  EG+F+++DG  +++ N+A  +PN+  N+DCVH L    G  WND+ C++ ++  C
Sbjct:   22 LSWKRAQSACAVLSSGLVSVHNHEENVFI---QQKHNGEKSWVGLSDVATEGRFVWADGSPMNFTNWAPNQPNDYKNQDCVHTLGVNYGYEWNDVQCSACHNYTC 123          

HSP 4 Score: 60.8474 bits (146), Expect = 6.038e-11
Identity = 31/105 (29.52%), Postives = 63/105 (60.00%), Query Frame = 1
Query: 2839 VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGF-WNDIACNSKNSFIC 3150
            ++++ AQ+ C      LV + N E  +N++ +  K+   + W+  +D A EG+FV ++   + ++ +   +PN+Y N+DCVH L  + G+ WND+ C++ +++ C
Sbjct:   22 LSWKRAQSACAVLSSGLVSVHNHE--ENVF-IQQKHNGEKSWVGLSDVATEGRFVWADGSPMNFTNWAPNQPNDYKNQDCVHTLGVNYGYEWNDVQCSACHNYTC 123          

HSP 5 Score: 58.151 bits (139), Expect = 4.899e-10
Identity = 32/105 (30.48%), Postives = 58/105 (55.24%), Query Frame = 1
Query: 2473 VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL--LGNYFANGKWNDFSCSTKNSFI 2781
            ++++ A   C + S  LV++ N E ++ I    +KH     W+  +D+  EG +V  DG+ + + NW   +PN+Y N+DC+  LG  +   +WND  CS  +++ 
Sbjct:   22 LSWKRAQSACAVLSSGLVSVHNHEENVFI---QQKHNGEKSWVGLSDVATEGRFVWADGSPMNFTNWAPNQPNDYKNQDCVHTLGVNYGY-EWNDVQCSACHNYT 122          

HSP 6 Score: 57.3806 bits (137), Expect = 8.428e-10
Identity = 34/120 (28.33%), Postives = 61/120 (50.83%), Query Frame = 1
Query: 1648 DILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNG-EWNDISCKT 2004
            D+  S     +   Y   ++ ++++ A + C   +  +V + N E N  I +     K    W+  +D+ TEG++V + G+ + + NWA N+PN+Y N+DC+       G EWND+ C  
Sbjct:    1 DVCGSGWNYFRGYCYKTSDICLSWKRAQSACAVLSSGLVSVHNHEENVFIQQKHNGEKS---WVGLSDVATEGRFVWADGSPMNFTNWAPNQPNDYKNQDCVHTLGVNYGYEWNDVQCSA 117          

HSP 7 Score: 56.9954 bits (136), Expect = 1.254e-9
Identity = 28/105 (26.67%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  169 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG-RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVIC 477
            ++  A   C      L+ + + + N  +     Q H G + W+  +D+  EG F + +G  + +  +A  +PN+Y+N+DCVH +    G+ WND+ C   ++  C
Sbjct:   23 SWKRAQSACAVLSSGLVSVHNHEENVFIQ----QKHNGEKSWVGLSDVATEGRFVWADGSPMNFTNWAPNQPNDYKNQDCVHTLGVNYGYEWNDVQCSACHNYTC 123          

HSP 8 Score: 49.2914 bits (116), Expect = 5.752e-7
Identity = 27/105 (25.71%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  556 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL-WNDISCADSNAVIC 867
            +++ A + C      L+ + + + N  +     ++   + W+  +D+  EG F+ +DG  + +  +AP +PN+Y KN+ CVH L  +    WND+ C+  +   C
Sbjct:   23 SWKRAQSACAVLSSGLVSVHNHEENVFIQQ---KHNGEKSWVGLSDVATEGRFVWADGSPMNFTNWAPNQPNDY-KNQDCVHTLGVNYGYEWNDVQCSACHNYTC 123          
BLAST of Mannose-binding protein C vs. Ensembl Nematostella
Match: EDO33473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS60])

HSP 1 Score: 65.4698 bits (158), Expect = 1.560e-12
Identity = 32/109 (29.36%), Postives = 58/109 (53.21%), Query Frame = 1
Query: 1330 VVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGL-WNDIKCDYKNSVICSKDI 1653
            + +K ++  C   G  L+ + + E N  I     +HN    W+  +D+ +E  FV++D    ++  W P +PN+Y+N+DCVH L    G  WND++C   ++  C + +
Sbjct:   24 LSWKQSESACAVLGSGLVSVHNHEENVFIQQ---QHNGEKSWVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVQCSSCHNYTCKRGV 129          

HSP 2 Score: 63.929 bits (154), Expect = 5.603e-12
Identity = 32/109 (29.36%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNAL-WNDIKCEDLNAVICYKNI 1266
            L++ +++  C   G  LV + + + N  +     Q+N  + W+  +DV  EG F  +D +   F+ WA  +PN+Y+N+DCVH L       WND++C   +   C + +
Sbjct:   24 LSWKQSESACAVLGSGLVSVHNHEENVFIQQ---QHNGEKSWVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVQCSSCHNYTCKRGV 129          

HSP 3 Score: 61.6178 bits (148), Expect = 2.963e-11
Identity = 31/107 (28.97%), Postives = 57/107 (53.27%), Query Frame = 1
Query: 2077 VNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGL-WNDISCNSINSVLCYK 2394
            +++ ++   C   G  L+ + N E N  +       K    W+  +D+  EG+F+++DG   ++ N+A  +PN+  N+DCVH L    G  WND+ C+S ++  C +
Sbjct:   24 LSWKQSESACAVLGSGLVSVHNHEENVFIQQQHNGEKS---WVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVQCSSCHNYTCKR 127          

HSP 4 Score: 58.9214 bits (141), Expect = 2.666e-10
Identity = 26/106 (24.53%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  169 TFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGF-WNDISCDDTNSVICYK 483
            ++ ++   C   G  L+ + + + N  +     Q++  + W+  +D+  EG F + +G    +  +A  +PN+Y+N+DCVH +    G+ WND+ C   ++  C +
Sbjct:   25 SWKQSESACAVLGSGLVSVHNHEENVFIQQ---QHNGEKSWVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVQCSSCHNYTCKR 127          

HSP 5 Score: 58.151 bits (139), Expect = 5.351e-10
Identity = 29/107 (27.10%), Postives = 64/107 (59.81%), Query Frame = 1
Query: 2839 VTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGF-WNDIACNSKNSFICSK 3156
            ++++++++ C   G  LV + N E  +N++ +  ++   + W+  +D   EG+FV ++     ++ +   +PN+Y N+DCVH L  + G+ WND+ C+S +++ C +
Sbjct:   24 LSWKQSESACAVLGSGLVSVHNHE--ENVF-IQQQHNGEKSWVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVQCSSCHNYTCKR 127          

HSP 6 Score: 55.0694 bits (131), Expect = 5.891e-9
Identity = 31/112 (27.68%), Postives = 59/112 (52.68%), Query Frame = 1
Query: 2452 YFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCL--LGNYFANGKWNDFSCSTKNSFI 2781
            Y      ++++++   C +    LV++ N E ++ I    ++H     W+  +D+  EG +V  DG+   + NW   +PN+Y N+DC+  LG  +   KWND  CS+ +++ 
Sbjct:   17 YLTSNTCLSWKQSESACAVLGSGLVSVHNHEENVFI---QQQHNGEKSWVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGY-KWNDVQCSSCHNYT 124          

HSP 7 Score: 52.7582 bits (125), Expect = 4.273e-8
Identity = 28/107 (26.17%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  556 TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNAL-WNDISCADSNAVICYK 873
            +++ + + C   G  L+ + + + N  +     Q+   + W+  +D+ +EG F+ +DG    +  +AP +PN+Y KN+ CVH L  +    WND+ C+  +   C +
Sbjct:   25 SWKQSESACAVLGSGLVSVHNHEENVFIQQ---QHNGEKSWVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDY-KNQDCVHTLGVNYGYKWNDVQCSSCHNYTCKR 127          

HSP 8 Score: 51.6026 bits (122), Expect = 1.039e-7
Identity = 29/106 (27.36%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 1690 YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNG-EWNDISCKT 2004
            Y      ++++++ + C      +V + N E N  I +     K    W+  +D+ +EG++V + G+   + NWA N+PN+Y N+DC+       G +WND+ C +
Sbjct:   17 YLTSNTCLSWKQSESACAVLGSGLVSVHNHEENVFIQQQHNGEKS---WVGLSDVTSEGRFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVQCSS 119          
BLAST of Mannose-binding protein C vs. Ensembl Medaka
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:101161518])

HSP 1 Score: 195.282 bits (495), Expect = 7.660e-50
Identity = 261/1157 (22.56%), Postives = 452/1157 (39.07%), Query Frame = 1
Query:  157 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAG-RFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYK----NTQPKT--------SHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPN---NYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV-----------------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVH---GLYYKNALWNDIKCEDLNAVICYK---NIG-------------SRGFTKFEISNKEIVIFEE----KVVFKHAQLLCKNNGYELLKIDSD-EINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY-ENEDCVHGLYYKNGLWNDIKCDYKNSVICS--------------KDILNSNE---TIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWING-NDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISC---------KTKNYLIYEYESTAEKEITIE----IMEGKV---------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNE--------DCV---HGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXG----KIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEP-NNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYI---ENIISTKEL--------EIFKER--VTFEE---------------AQNTCIKKGWSLVRIDNEETNQNIYD--LAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMS 3195
            Q   T+ +A K CQ +G +L+ I   + + Q Y   +  H G   WI  N +  E  +++ NG   +Y  +  G P++    +C      K   W   +C      IC K    N  P          SH +        + + K  + +A+A C+  G  L  I   +  S V +     Q    WI  ND +N+  F  SD  ++ + ++  GEP+   N+Q++   + G    +  W D +C   +  IC K++   + +     N+E V                 I  E  T+ +A+  C + G  L+ I +   N+ + +         +W   ++   +  F+ +   K+ F+ + AG+P+  Q   CV    G++    LW+ I C +    IC K   N+              + G+T     N  + I+ +    K  ++ AQ  CK  G +LL I S  ++N++ +         + WI      T   F +SD     ++ W  GEPNN+ ++E C     Y    WND  C+  N  IC               +++ N+ E    I    ++YV+   +  E A  +C ++   +  ++     K I+         +++I    ++     W+D  G  + Y  W  NEPN  NN++     +   G WNDI+C         ++ +++      TA           + +GK          N+  A E C ++G +L+ I NE   +    +   +    +WI  ND+N E  F+++DG+ ISY N+A G P +  +         DCV          G W    C +    +C K                 K+    Y +   ++ ++EA R CQ     L +I N      +      H     W+  N+    G +  +D   L Y  W + EP +NYG   C+  +   +  W    C+      YY +    + I+  E+        E  K+R  + F                 A   CIK G SLV I +      I      +++    +WI    K+ + +++  +   L Y+ +  G P    +E CV  ++  +G W+  +CN   S+IC   +P II   E + 
Sbjct:  235 QAALTWHQARKSCQQQGADLLSIV--ELHEQSYISGLTSHLGTSLWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVLIRG---KDGKWADHTCEKMHGYICKKKASTTMSEG----NQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPDRLQG--CVAITTGIFA--GLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFR-------SSAWIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGMVVNLDKSFSWLD--GTPVTYTAWNHNEPNFANNDENCVTIYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNEN-EQAFLTIQMFHYNEDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASILNPVTQAYMTLQMSSHN-EPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKDEPKSNYG---CVYID--VDKTWKTAPCTN----TYYSVCKRSSEIAPTEIPQHPGSCPESKKQRNWIPFRGHCYSFRSSVVDNWAFASVECIKMGASLVSIQDPAEAMFIQKNLELLEDGAKTFWIGLY-KSHDDEWMWIDKSVLDYTNWKSGMPK---SESCVD-IHSDSGQWSTTSCNRYKSYICK--TPKIIKPTEKLP 1351          

HSP 2 Score: 177.948 bits (450), Expect = 1.365e-44
Identity = 253/1129 (22.41%), Postives = 441/1129 (39.06%), Query Frame = 1
Query:  934 KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIG-RYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK----NIGSRGFTKFEISNKEIVIF--------EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK---------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFW--INGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYE-----------------------YESTAEKEITIEIME----GKVNYIKALELCKSKGYDLIRIEN-EEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQ-NNEDCVHGLFYTNGLWNDISCNSINSVLCY-------KP---FXXXXXXXXXXGKI--DTSKYFVHTGRVTYEEALRFCQIHSCRL-VTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTK--------NSFI-----YYYIENIISTKELEIFKERV---------TFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNE--------DCVHGLYYSN-----GFWNDIACNSKNSFICSK------YSPPI----IFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDT--------GKEVKKTKYYIHRIG--VTFQEAL----DF----CKERRCKLIVVDN------IDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPD-GKWRDVSCD 3888
            +  LT+++A+  C+ QG  L+ I +    S  Y   + +++G   WI  N +  E  ++ S+ N  ++  W  G P++    +C      K + W    C      IC K    N+               V +          K +++ A   C+ +G +L  I S E  S +            WI  ND + +  F +SD  ++++ +W  GEP++  N  EDCV  +  K+G W D  C+  +  IC K    +     Q++                Y +     T+EEA   C      ++ I+N   N  +           FW   +  +  T  KW  ++  K+ + ++   +P+       +    +  G W+ ISC  K   I +                       +    E+   ++I       K  + +A + CK+ G DL+ I +  ++N I +  +        WI          F +SDG    + N+ +GEPNN  ++E C     Y    WND +C S N  +C        KP     E+     E+G I  + S+++V+   +  E A  +C+ +   L V   +SE   +   +AR   +  Y     ++ K   W  +DG  + Y  WN  EPN   N++  +  Y   G WND +C  +        NSFI        + N     +  +FK +           + +A+  C  +G +LV I NE   Q    + + +    +WI  ND   E  FV ++   + Y+ + +G P +  +         DCV  +   N     G W    C +K  FIC K        PP      +   + SYK+ + K+ + EA  +CQ++   L  + N  ++    TL +       WI   ++   G++ + D   L +  W        K N  C+Y    +   W    C +    +C + S+   T          E KK + +I   G   +F+ ++     F    C +    L+ + +      I  N+ L E   K     +W+ G  K ++  W+  DK  L + NW +G   + K+++C+  + D G+W   SC+
Sbjct:  235 QAALTWHQARKSCQQQGADLLSIVELHEQS--YISGLTSHLGTSLWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVL-IRGKDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNR--KVTFTHFNAGQPDRLQGCVAITTGIFA-GLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFRSSA-------WIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGMVVNLDKSFSW--LDGTPVTYTAWNHNEPNFANNDENCVTIYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNE-NEQAFLTIQMFHYNEDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCV--IMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASILNP-VTQAYMTLQMSSHNEPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKD---EPKSNYGCVYID--VDKTWKTAPCTNTYYSVCKRSSEIAPTEIPQHPGSCPESKKQRNWIPFRGHCYSFRSSVVDNWAFASVECIKMGASLVSIQDPAEAMFIQKNLELLEDGAK----TFWI-GLYKSHDDEWMWIDKSVLDYTNWKSG---MPKSESCVDIHSDSGQWSTTSCN 1331          

HSP 3 Score: 144.436 bits (363), Expect = 3.362e-34
Identity = 202/903 (22.37%), Postives = 334/903 (36.99%), Query Frame = 1
Query:   49 WNDFSCEDPSAVICYKETEPKIS-------------AEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVH---GMFYKDGFWNDISCDDTNSVICYK-------NTQPKTSHVIKLLNRELIILQEKT-------------TYENAIAHCKSKGFQLIKIDDDQ-LNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVL---------------NKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEI---------VIFEEKVV---------FKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNY--------ENEDCV--HGLYYK-NGLWNDIKCDYKNSVICSKDI---LNSNETIKQ------QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNK--IIYEWSKNMKIGRFWINGNDIITEG--KWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYES-TAEKEI-----TIEIMEGKVNYIK------------------ALELCKSKGYDLIRIENEEINKIVYD--VATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKP 2397
            W D +CE     IC K+    +S                   S    I  E  TF EA + C   G NL+ I +   N  + +L        FW   ++ + +  F++   +++ +  F  G+P+  R + CV    G+F   G W+ ISC +    IC K        T P T+  +        +++  T             T++ A   CK+ G  L+ I   + LN++ +  +        WI          F  SDG    +  +  GEPNN+  +EHC     Y    WND +C   N  IC  +  +    + TV+               N +  +  E L    A+  CK     L  +  +     ++    + +  +Y+I    V ++ +F   D   + ++ W   EPN   N++    +Y +   WNDI C      +C +   S  F    ++   +         ++F+ K           ++ A+  C N G  L+ I  +E         + H    +WI  ND+  E  FV++D K ISY  W  G P +         E  DCV   G   K  G W    C  K   IC K++   +    T  Q         Y +    + ++EA   C   +  +  I N  T     +   S N  +   WI  N+ +T G  KWVD+    L Y  W K+EP   +N  C+  +   +  W    C    Y + +  S  A  EI     +    + + N+I                   A   C   G  L+ I++      +       ++    +WI     + + ++++ D   + Y N+  G P    +E CV  +   +G W+  SCN   S +C  P
Sbjct:  469 WADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPD--RLQGCVAITTGIFA--GLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFRSSA-------WIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYI-GMVVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDENCVTIYREMGYWNDINCGLELPSVCRR---SNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSI-LNENEQAFLTIQMFHYNEDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASILNPVTQAYMTLQMSSHNEPV---WIGLNNNVTGGRFKWVDNW--SLFYTKWGKDEPK--SNYGCVYIDV--DKTWKTAPCTNTYYSVCKRSSEIAPTEIPQHPGSCPESKKQRNWIPFRGHCYSFRSSVVDNWAFASVECIKMGASLVSIQDPAEAMFIQKNLELLEDGAKTFWIGLYKSH-DDEWMWIDKSVLDYTNWKSGMP---KSESCVD-IHSDSGQWSTTSCNRYKSYICKTP 1341          

HSP 4 Score: 116.316 bits (290), Expect = 1.163e-25
Identity = 173/840 (20.60%), Postives = 317/840 (37.74%), Query Frame = 1
Query: 1702 EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTK-NYLIYEYESTAEKEITIE------------------IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN--QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXX----------XXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKE-----------------------LEIFKE----RVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNSFIC-------SKYSPPII-----------FIDEHMSYKIFINKVTYREAVDKCQSE-GYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCL-------YSSETLSGKWLGTSCVSKNSVI--CYKPSKTIDTGKEVK----KTKYYIHRIG--VTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWT--------NGKVNIQKTQNC--LQGNP---DGKWRDVSCDDKNPF 3903
            +  +T+ +A   C Q    ++ I  +     I   + ++     WI  N +  E  W  S GN   YLNW    P++    +C   N     +W   +C  K  Y+  +  ST      I+                  +   K  +  AL  C+  G DL  I + E    V      ++    WI  ND   +  F +SD   +++  +  GEP++   + EDCV  +   +G W D +C  ++  +C K       E          K    +  +  Y + +   T+EEA + C      L+ I N   +  +++L        +W   ++ + +  +      K+ + ++N G+P+       +    FA G W+  SC+ K  +I   + + +                           L+I+++    + T++EAQ+ C   G  L+ I +     NI   +        WI    +     F  S+    ++  +  GEPNN+  +E C     Y   +WND  C S N +IC        K  P ++            I  +  + +    +    A   C+   G   +   +S+  FI   ++ R+  + Y+I G     D  +++ DG  +T+  W          + NC+       Y ++   G  L + C   NS I     P+   + G   +    K K Y   +G    +++A +FC      L+ + N +   +L  +      E +W+  ND + E  ++ +D K +++ NW         +G+  + +  +C  + GNP    G W+   C  K  F
Sbjct:  235 QAALTWHQARKSCQQQGADLLSIVELHEQSYISGLTSHLGTS-LWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVL-IRGKDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPDRLQGCVAITTGIFA-GLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFRS------SAWIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIA-RFSDMQYYI-GMVVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDENCVTIYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNENEQAFL-TIQMFHYNEDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGF 1062          

HSP 5 Score: 80.8777 bits (198), Expect = 9.461e-15
Identity = 128/638 (20.06%), Postives = 240/638 (37.62%), Query Frame = 1
Query:    7 NEHCVHGLYYPNALWNDFSCEDPSAVIC------YKETEPKISAEI--ELQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKN------TQPKTSHVIKLLNRELIILQEKT---------TYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEP-----NNYQKNEH--CVHGLYYSNAL---WNDISCADSNAVICYKESKIEVLKKITVL-------NKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYA---VQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKN--IGSRGFTKFEISNKE-------------IVIFEEKVV--FKHAQLLCKNNGYELLKIDSDEINSMIYDF---AVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC-SKDILNSNETIKQQQKYYVHEV 1707
            +EHC     Y    WND +CE  +  IC        + EP +  E+    +  ++I       +  E      A   C+    +L  +  D     ++    ++   +++I    + ++ +F +++G  + Y  +   EPN   N++    ++ + G+WNDI+C      +C ++      T   T+        + I+ + K           + +A   C ++G  L+ I ++   + +      Y    +WI  ND+  E +F+ +DGK I Y  +A G P       Y  +E   CV        L   W    C      IC K    +++   T         N    +  +++ + +A+  C++    L  I     N +   Y    + ++    WI  N+    G F+  D   + ++KW   EP +  N  CV+     +  W    C +    +C ++  I      +   S  E                F   VV  +  A + C   G  L+ I  D   +M        ++    T+WI       ++ +++ D   + Y  W  G P   ++E CV  ++  +G W+   C+   S IC +  I+   E +     + V EV
Sbjct:  740 SEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYI-GMVVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDENCVTIYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNENEQAFLTIQMFHYN-EDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASI----LNPVTQAYMTLQMSSHNEPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKDEPKS--NYGCVY--IDVDKTWKTAPCTNTYYSVCKRSSEIAPTEIPQHPGSCPESKKQRNWIPFRGHCYSFRSSVVDNWAFASVECIKMGASLVSIQ-DPAEAMFIQKNLELLEDGAKTFWIGLYKSH-DDEWMWIDKSVLDYTNWKSGMP---KSESCVD-IHSDSGQWSTTSCNRYKSYICKTPKIIKPTEKLP-AVAHVVQEV 1360          

HSP 6 Score: 77.7962 bits (190), Expect = 6.505e-14
Identity = 90/403 (22.33%), Postives = 170/403 (42.18%), Query Frame = 1
Query: 2830 KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIG-QYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSK-----YSPPII----FIDEHM------SYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENN--NCLYSSETLSGKWLGTSCVSKNSVICYKPSKT---------IDTGKEVKKTKY--YIHRIGV---TFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQ---GNPDGKWRDVSCDDKNPFFFEFIDENEQ 3933
            +  +T+ +A+ +C ++G  L+ I   E ++  Y   + + +G   WI  N    E  +  SN +  +Y  +  G P++    +C          W   AC  K  +IC K       PP I    F   H        Y +  +K  +R+A+  C+ +G  L  + + +    V + +   +    WI   D +N   + +SD  Q+TF  W T   PS   N+  +C+       GKW   +C   +  IC K + T         ++ G ++   ++  + + IG    TF+EA   C      L+ + N   N +L  L      + +W   ++ +++  +  +  +K+TF ++  G+ +  + Q C+    G   G W  +SC +K  +  + + +N Q
Sbjct:  235 QAALTWHQARKSCQQQGADLLSI--VELHEQSYISGLTSHLGTSLWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGE-PSHIINHQEDCVLI-RGKDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPD--RLQGCVAITTGIFAGLWDVISCTNKEKYICKKVADNVQ 631          
BLAST of Mannose-binding protein C vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163769])

HSP 1 Score: 183.726 bits (465), Expect = 2.273e-46
Identity = 253/1189 (21.28%), Postives = 454/1189 (38.18%), Query Frame = 1
Query:  334 VNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSH---------VIKLLNRELII-------LQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNA--LWNDISCADSNAVICYKESKIEVLKK----------ITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKI---DDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK-------------NIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV-HGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQ--------------------KYYV--HEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYP---NGEWNDISCKT-----------------KNYLIYEYESTAEKEITIEIMEGKVNYIK-----ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQN-NEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXG------------KIDTSKYFVHTGR-VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEG-EWVNIDGNKLKYLNW----NQGEPN----NYGNEDCLLGNYFAN---GKWNDFSCSTKNSFIYYY----------------IENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSP-PIIFIDEHMS-----------------------YKIFINKVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKL-VNYWIDGTDSKNDGKWTFSDGQQLTFKNW 3417
             +G   + H+       N   + C+    YKD ++ D +  D+ +   +   + K  H           +  ++E++         Q   T+  A A CK +   L+ I D    +++  L    +  + WI    +  E  +  +DGK   Y K+  G P   Q N     GL  S+   LW   SC      ICYK                   I        + +  LT+  A   C+ +G  L  I   +D+ F      YA  + +   WI  ND   EG FE SD + + F+ W  G+P    +E+CV  L  +N  W D  CE+ +  IC K             NIG +   K   S    +  E K  F  A+  CK +   L+ + +   N+ +     +     +W+  ++ +  + FV++++ ++ +  W  G P + +   CV        GLW+ + C  K   IC      +  T+                        K++        T+ EA ++C      ++ I + + + I      + + G+ WI  +       +V S G+ + +L+W + EPNN+NN E C E   Y    NG WND +C++                  N  + +Y  TA+  I  +  E  +N +      A   C+    DL  I +   N  ++ + +++  G ++I  + ++++G + ++DG  I ++ +   +P+    +++CV  + Y  G W+  +C      +C + F    +                  K D   Y + + R  T+EEA + C      LV + + ++   +   A  +  S +W+  + + ++G  W   DG+   Y NW    NQ  P      +G EDC++ +   +   GKW   SC+    FI                   I   +    ++   + +T+E+A   C     +L  I +E     +  LA   K    WI  N     G F   +   + ++K+   EP+   +  CV+     +G W    CN     +C + +  P+   DE                          Y     ++ + +A   C   G  L  +E+  +  FI   + +   +  ++WI G    + G+W + D   +TF NW
Sbjct:  136 ASGACTRTHRELYSIGGNAFGKICMFPFLYKDRWYGDCTTLDSKTKRSWCAVETKYEHEQWGYCPSSSTEHWSKEVVTGTYYQINTQSALTWAQADASCKQQASSLLSITDPVQQAVISALLGSGR-NKLWIGLV-LDTEHGWKWTDGKPFRYLKWDSGNP---QPNPGHNCGLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDEL---WIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKT-FDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMPGHAQG--CVAMATGISAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFEARDYCRAIGGDLLSIHS-QADLI------SRRGGKAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKLISRS-YGAFYIGLS-VDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV-SMKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAFLTIKAASNLASNFWIGLSCLNQDGFYWA--DGSSRSYTNWGYNKNQRRPGMFYQRWGEEDCVMMSSNVSSGIGKWIIKSCNDTYGFICQKKLDESTQDQGESINPNIYTRLGNDSIKALPQNLTWEDAMKACKADNANLASIRSELMKAQVDLLAFTLK-APLWIGINKNKTGGSFKYVDGWHMSFAKWAELEPSR--DRPCVY--VDQDGNWRTAFCNQTMKSLCMQTTDVPLPDTDEFFGRCPEDTNVEYQESYTWMPFYGYCYLFVTEEIEWADAASSCVRHGGILASIEDPVEQQFIKSNIEMFQDVHTSFWI-GLYKTHKGEWLWLDYSFMTFTNW 1294          

HSP 2 Score: 164.466 bits (415), Expect = 2.216e-40
Identity = 220/1039 (21.17%), Postives = 405/1039 (38.98%), Query Frame = 1
Query:   46 LWNDFSCEDPSAVICYKETEPKISAEIE---LQSKYVI-------IFQEKTTFTEANKLCQAKGYNLIKI---EDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVL-------------KKITVLNKELVIFK-------ERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYY---KNALWNDIKCEDLNAVICYKNIG-----------------SRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNET----------------IKQQQKYY--VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEG-KWVDSKGNKLVYLNWAKNE----PN----NYNNEDC--LEGNFYPN-GEWNDISCKTKNYLIYEY---ESTAEK-------------EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK----PFXXXXXXXXXXGKIDTSK---------------YFVHTGRVTYEEALRFCQIHSCRLVTIENS-ELDILILNLARKHKI-SGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNN-YGNEDCLLGNYFANGKWNDFS 2757
            LW   SC      ICYK   P     +E       ++        + +   T+ +A K C+ +G +L  I   ED  F       A    +   WI  ND   EG FE+ +   + +  +  G+P    +E+CV  +  ++G W D  C++ +  IC K +  + +     LN                I  E  T++ A   CK+    L+ + +   N+ + +L  Q     +W+  ++ +N   F+ ++  ++ +  +  G P + Q       G+  S  LW+ + C +    IC  +++  VL             +  T +    + +K       E  T+++A+D C++ G  L+ I  +          +    G+ WI  +       +  SD + + F  W  GEPNN+ N E C     Y   +N  WND  CE  N  +C    G                 + G+ +++   KE  I       + A+  C+ +  +L  I S   N  ++   +  + G ++I  + +  + ++ ++D   I +Q+W   +P+    +++CV  + Y+ G W+   C  +   IC +       T                +K  +K Y  + +   T+EEA   C +    +V + + +    +   + +     FWI  + +  +G  W D  G+   Y NW  N+    P      +  EDC  +  N     G+W   SC      I +    EST ++               +I+ +   + +  A++ CK+   +L  I + E+ K   D+         WI  N     G F Y DG ++S+  +A  EP+   +  CV+     +G W    CN     LC +    P  +  +      + DT+                Y   T  + + +A   C  H   L +IE+  E   +  N+     + + +W+ G     +GEW+ +D + + + NW   EP++ YG      G++    +W+D S
Sbjct:  312 LWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYA---SSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMPGHAQGCVAMATGI--SAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFEARDYCRAIGGDLLSIHSQA-------DLISRRGGKAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWK--GKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYIGLS-VDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV-SMKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAFLTIKAASNLASNFWIGLSCLNQDGFYWAD--GSSRSYTNWGYNKNQRRPGMFYQRWGEEDCVMMSSNVSSGIGKWIIKSCNDTYGFICQKKLDESTQDQGESINPNIYTRLGNDSIKALPQNLTWEDAMKACKADNANLASIRS-ELMKAQVDLLAFTLKAPLWIGINKNKTGGSFKYVDGWHMSFAKWAELEPS--RDRPCVY--VDQDGNWRTAFCNQTMKSLCMQTTDVPLPDTDEFFGRCPE-DTNVEYQESYTWMPFYGYCYLFVTEEIEWADAASSCVRHGGILASIEDPVEQQFIKSNIEMFQDVHTSFWI-GLYKTHKGEWLWLDYSFMTFTNWAPEEPDSEYGAIMTSDGSWTTGRRWHDKS 1323          

HSP 3 Score: 142.895 bits (359), Expect = 8.887e-34
Identity = 196/980 (20.00%), Postives = 375/980 (38.27%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNG--LWNDIKCDYKNSVICSKDILNSNETIKQQ------------QKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDC--LEGNFYPNGEWNDISCKTKNYLIYEYESTAEK---EITIEI-------MEGKVNYIKALEL---------CKSKGYDLIRIENEEINKIVYDVATKNKVGQYWIN-ANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCV-HGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTS---------------KYFV--HTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCL---LGNYFANGKWNDFSCSTKNSFIYYYIENIIST----------------------KELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYG-NEDCVHGLYYSNGFWNDIACNSKNSFICSK-YSPPI------------------IFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNW-------QTASLPSDKENNNCLYSSETLS---GKWLGTSCVSKNSVICYKP--SKTIDTGKEVKKTKYYIHRIG----------VTFQEALDFCKERRCKLIVVDN--IDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCD 3888
            +  + +  A   CK     LL I +D +   +    +       WI    + TE+ + ++D K   Y KW  G P      +C  GL   +G  LW    C  K   IC K  +       ++              +++H  L+T+ +A+  C +    +  I NVE    +            WI  ND  TEG +  S  + + + +W   +P    +E+C  L G    NG W D  C+ K+  I   +S++E+   E+ + I         G   Y    E          CK+    L+ + N   N  +  +  +     +W+  +N  N++  F++++   + + ++  G P +   + CV      + GLW+ + C +    +C    +          +                   K+F    +   T+ EA  +C+     L++I +S+ D++        +    W+  +       +V  DG+ + +L+W +GEPNN+ N E C    L ++  NG WND +C + N ++      +                         KE  I     + E+A++ C +    L  I +   N  ++ L +    G ++I  +   ++G +  ++   + + ++ + +P+    +++CV  + Y  GFW+   C  +   IC + +SPP+                  +  D+     I   K T+ EA  +C     +L+ V +  +   +   +      N+WI G    N   + ++DG   ++ NW       +           +C+  S  +S   GKW+  SC      IC K     T D G+ +    Y   R+G          +T+++A+  CK     L  + +  +   + L   + K  +   W+  N     G++   D   ++F  W   ++   + + C+  + DG WR   C+
Sbjct:  222 QSALTWAQADASCKQQASSLLSI-TDPVQQAVISALLGSGRNKLWIGLV-LDTEHGWKWTDGKPFRYLKWDSGNPQPNPGHNC--GLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVLLRGE---NGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNID-VFVWTNTDQVKFTHWNAGMPGHA--QGCVAMATGISAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFEARDYCRAIGGDLLSI-HSQADLI------SRRGGKAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYIGLSVD-LDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV-SMKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAFLTIKAASNLASNFWI-GLSCLNQDGFYWADGSSRSYTNWGYNKNQRRPGMFYQRWGEEDCVMMSSNVSSGIGKWIIKSCNDTYGFICQKKLDESTQDQGESINPNIY--TRLGNDSIKALPQNLTWEDAMKACKADNANLASIRSELMKAQVDLLAFTLKAPL---WIGINKNKTGGSFKYVDGWHMSFAKW--AELEPSRDRPCVYVDQDGNWRTAFCN 1173          

HSP 4 Score: 103.219 bits (256), Expect = 1.171e-21
Identity = 121/531 (22.79%), Postives = 212/531 (39.92%), Query Frame = 1
Query: 2473 VTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYY---------YIENIISTKE--------LEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDE-------------HMSYKIFIN--KVTYREAVDKCQSEGYSLIKVENS-DISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLS-GKWLGTSCVSKNSVICYKPSKTI----------------DTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQ-KTQNCLQ-----GNPDGKWRDVSCDDKN 3897
            +T+ +A   C+  +  L++I +     +I  L    + +  W+ G  +  E  W   DG   +YL W+ G P      +C L +      W   SC+ K  +I Y         ++E    +            + +  +T+ +A   C K+G  L  I N E    +          + WI  ND++ EG F  S++  + ++ +  G+P    +E+CV  L   NG W D  C  K+ FIC K S      DE             H SY  FI     T+ EA D C++    L+ V N  D +F+V  +  R +  N+W+  ++ KN   + +++  Q+ F +W  A +P   +   C+  +  +S G W    C +K   IC   ++                  D  +   +   Y    G   +E   F     C+ I  D +  +     +S++    K W+  +  D    ++ SD   + F +W  G+ N     ++C +      + +G W D +C+  N
Sbjct:  225 LTWAQADASCKQQASSLLSITDPVQQAVISALLGSGR-NKLWI-GLVLDTEHGWKWTDGKPFRYLKWDSGNPQPNPGHNCGLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPE-KNFWLGLSNQKNIDVFVWTNTDQVKFTHWN-AGMPGHAQ--GCVAMATGISAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFEARDYCRAIGGDLLSIHSQADLISRRGG--KAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYN 746          

HSP 5 Score: 73.559 bits (179), Expect = 1.627e-12
Identity = 97/436 (22.25%), Postives = 161/436 (36.93%), Query Frame = 1
Query:   40 NALWNDFSCEDPSAVIC--YKETEPKISAE-------------IELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNREL----------------IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFA-------PGEPNNYQKNEHCVHGLYYSN-----ALWNDISCADSNAVICYK---ESKIEVLKKI------TVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVH 1188
            N  WND +CE  +  +C       PK                 I+ + K   I     +  +A   CQ    +L  I     N  ++ L I    G F+I  + + ++G++ + +G  I + ++ + +P+    +++CV  M Y+ GFW+  +C      IC +   P  +                          II   K T+E A   C      L+ +   Q+ + +   A       +WI  + +  +G F  +DG    Y  +        PG        E CV  +  SN       W   SC D+   IC K   ES  +  + I       + N  +    + LT+  A   CK+    L  I  E   + V   A        WI  N  +  G+F+  D   + F+KWA  EP+  ++  CV+
Sbjct:  734 NGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYIGLS-VDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV-SMKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAFLTIKAASNLASNFWIGLSCLNQDG-FYWADGSSRSYTNWGYNKNQRRPGMFYQRWGEEDCV--MMSSNVSSGIGKWIIKSCNDTYGFICQKKLDESTQDQGESINPNIYTRLGNDSIKALPQNLTWEDAMKACKADNANLASIRSELMKAQVDLLAFTLK-APLWIGINKNKTGGSFKYVDGWHMSFAKWAELEPS--RDRPCVY 1160          

HSP 6 Score: 73.1738 bits (178), Expect = 1.711e-12
Identity = 60/246 (24.39%), Postives = 108/246 (43.90%), Query Frame = 1
Query: 3211 NKVTYREAVDKCQSEGYSLIKVENSDISFIVHTL--SLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK----PSKT-------IDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNC-LQGNPDGKWRDVSCDDKNPFF 3906
            + +T+ +A   C+ +  SL+ + +     ++  L  S R KL   WI G     +  W ++DG+   +  W + + P     +NC     +    W  +SC  K   ICYK    P+          D         +++HR  +T+ +AL  C++    L  + N++   ++       S ++ W+  ND+  EG +  SD   +TF +W  GK     ++NC L    +G W D  C++K+ F 
Sbjct:  223 SALTWAQADASCKQQASSLLSITDPVQQAVISALLGSGRNKL---WI-GLVLDTEHGWKWTDGKPFRYLKWDSGN-PQPNPGHNCGLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVLLRGENGNWADRYCEEKHGFI 463          
BLAST of Mannose-binding protein C vs. Ensembl Medaka
Match: mrc2 (mannose receptor C type 2 [Source:NCBI gene;Acc:101168215])

HSP 1 Score: 162.925 bits (411), Expect = 7.450e-40
Identity = 246/1164 (21.13%), Postives = 447/1164 (38.40%), Query Frame = 1
Query:  931 FKERLTYYKAQDLCKSQGYKLVKI----DDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYK--NIGSRGFTKFEISNKE---------------IVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN--EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQ-----------QKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGR----FWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKT--KNYLIYEYESTAE-------------------------------KEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDV-------ATKNKVGQYWINANDINV--EGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTS-----------KYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKH-KISG--YWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYI-------------------ENIISTKELEIFK-----ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEP-------NNYGNEDCVHGLYYSN----GFWNDIACNSK-NSFICSK-----YSPPIIFIDEHMSYKIFINKVTYR---------EAVDKCQSEGYSLIKV----ENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSE-TLSGKWLGTSCVSK-NSVICYKPSKTIDTGKEVKKTKYYIHRIG----VTF---------------QEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKY--WLNGNDKDNEGAWIDSDKKKLTFFNWTNGKV--NIQKTQNC--LQGNPDGKWRDVSCDDKN 3897
            F+  L++ +A+  C+ QG  L+ +    +    N ++  Y+        WI  ND+ I G ++ SD + +K+  W   +PN+   E+CV      +  W +  C      +C K  N     FT    ++ E                 +  EK  +  AQ  C+     L  I +      I   +++ +I   WI  +D   +  F ++D   + +  W+P EPNN+ N  EDCV  ++   G W+D  C+     IC K    S+   +QQ             Y+V E L+T+E+A   C  H   +V I    TN+    ++ ++  GR    FWI   D  + G +    G+ + Y NW +NEP    +           G W    C +    ++  + + T+                                K      ME +++++ A   C+  G  L+ I   +    V  V       + +++   +WI  N  N    G + +SDG  ++Y+NF     N +       G       W  + C+S    +C  P +   ++  E  + +TS           K+F H  R T+++A R C      L ++ +++  + + N  RK  K+ G  +WL  +  + +G +   D + L Y++W  G P+    +   +    +   W+D  C +   +I   +                    +  ++ + + FK      RVT+  A+  C  +G  ++ + +    Q      +K      W+       +G F  +    L Y+ +  GEP       +N    +CV  ++ +     G W   AC  + N FIC K       P    I   +S  + +  VTYR          ++  C+S   +L  V    + + ++ ++++L     +  Y   G        +T+   + + + NW+      D E N        T +G+W  T C SK  +VIC   ++++    +        H +G    V F               Q+A   CK+   +L+ + +   N ++WE  +  + + +  WL    K     W D DK+ L + NW    V  ++    +C  +Q N  G W+  SC ++ 
Sbjct:  256 FQAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSAA-----LWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITR-SLRKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCV-SIWGAEGRWDDSPCNLTLPSICKKPGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPI----TNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEPAKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNFGRYYYNVRQCAAADLGAM----TWLAMHCDSELDWICKIP-RGSVEKLPEITEGNTSPEWIMFKEAEYKFFDH--RTTWDQAQRICSWFDSSLASVHSADEQMFLANTLRKMVKVEGDSWWLGLHTYENDGRFRWSDHSVLNYISWALGRPHPLSRDRRCVSISASKVDWSDQKCHSDLPYICKRVNVTGTVPPTPSTPHPPSGCPDGWASYQHKCFKVFDQSPRVTWSAAKLKCDTQG-GVLAVVSSPLEQAFVTTLLKYISADLWVGLTSDP-KGHFQWAQAGLLSYTNWAPGEPLDNSGPHHNKTPGNCVVMIHGNPEKKVGMWASKACEMENNGFICQKQQDRGLPPAPPLIPSSLSKPVELGGVTYRVVKKRLDWTSSLHICESLNGTLATVKDPYQQAYLTLLMNSLHQPAWIALYNYGGR------SFTWLGNEDVVYSNWK------DGEPNQMAGCGHMTTTGQWTMTPCDSKLETVICQIANESVS--HQWTYPGQCPHSLGEWAWVHFRNHCYAFNLQSLKLQQDAHKSCKKIGAELLSIMDEAENGFIWEHIQSYAEQAHGAWLGVKVKGRGLVW-DEDKEML-YTNWETHNVAFSVLSINSCFWIQSN-SGFWKPGSCRNRT 1382          

HSP 2 Score: 112.079 bits (279), Expect = 2.885e-24
Identity = 194/1018 (19.06%), Postives = 368/1018 (36.15%), Query Frame = 1
Query:  136 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNT----QPKTSHVI------------KLLNRELIIL-QEKTTYENAIAHCKSKGFQLIKIDD-DQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN-EHCVHGLYYSNALWNDISCADSNAVICYKE-SKIEVLKKITVLNKELV--------IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGR-YWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNA-VICYKNIGSRGFTKFEISNKEIVI-------------------------FEEKVVFKHAQLLCKNNGYELLKIDSDEINSMI-------YDFAVKHNIGTYWIDAN--DIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICS---------KDILNSNETIK----QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNM---KIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYE------------------------YESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEP-------NNQNNEDCVHGLFYTN-----GLWNDISCNSI-NSVLCYK------PFXXXXXXXXXXGKIDTS--KYFVHTGRVTYEEALRFCQIHSCRLVTI----ENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNK-LKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIEN 2799
            S Y   FQ   +++EA   CQ +G +L+ +      T +  L   Y A   WI  ND+ + G +++ +   +KY  + K +PN+   E+CV       G W +  C      +C K       P T+               +        L  EKT +  A  +C+     L  I    +L  +  +L  +  I + WI  +D   + +F  +D   +++  + P EPNN++   E CV  ++ +   W+D  C  +   IC K  +K +   +    N+           + ++ LT+  A+  C+S    LV I + +F     N  V    G  +WI   D    G+F     + + ++ W   EP   Q+            LW   +C    A  IC +N  +    +         +                          E ++ +  A L C+ +G  LL I   +    +       +  + +H    +WI  N  +     ++ +SD   ++YQ +       Y N             W  + CD +   IC           +I   N + +    ++ +Y   +   T+++A   C+  +  +  + + +    +    + M   +   +W+  +    +G++  S  + L Y++WA   P+  + +           +W+D  C +    I +                        + S   K   +     +V +  A   C ++G  ++ + +  + +       K      W+     + +G F ++    +SY N+A GEP       +N+   +CV  + + N     G+W   +C    N  +C K      P             ++     Y V   R+ +  +L  C+  +  L T+    + + L +L+ +L +   I+ Y   G        W+   GN+ + Y NW  GEPN         G+    G+W    C +K   +   I N
Sbjct:  250 SCYQFNFQAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSAA-LWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSL--RKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCV-SIWGAEGRWDDSPCNLTLPSICKKPGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPITN-RFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEPAKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNF----GRYYYNVRQCAAADLGAMTWLAMHCDSELDWICKIPRGSVEKLPEITEGNTSPEWIMFKEAEYKFFDHRTTWDQAQRICSWFDSSLASVHSADEQMFLANTLRKMVKVEGDSWWLGLHTYENDGRFRWSDHSVLNYISWALGRPHPLSRDRRCVSISASKVDWSDQKCHSDLPYICKRVNVTGTVPPTPSTPHPPSGCPDGWASYQHKCFKVFDQSPRVTWSAAKLKCDTQG-GVLAVVSSPLEQAFVTTLLKYISADLWVGLTS-DPKGHFQWAQAGLLSYTNWAPGEPLDNSGPHHNKTPGNCV-VMIHGNPEKKVGMWASKACEMENNGFICQKQQDRGLPPAPPLIPSSLSKPVELGGVTYRVVKKRLDWTSSLHICESLNGTLATVKDPYQQAYLTLLMNSLHQPAWIALYNYGGRSFT----WL---GNEDVVYSNWKDGEPNQMAG----CGHMTTTGQWTMTPCDSKLETVICQIAN 1244          

HSP 3 Score: 110.923 bits (276), Expect = 6.080e-24
Identity = 146/705 (20.71%), Postives = 272/705 (38.58%), Query Frame = 1
Query: 2065 MEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTG--------------RVTYEEALRFCQIHSCRLVTIEN-SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN--EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE----------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNS-KNSFIC---------------------SKYSPPIIFIDEHMSY--KIFI-----NKVTYREAVDKCQSEGYSLIKVENSDIS-FIVHTL------SLRYKLVNYWIDGTDSKN---DGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKT--------------KYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLW-ELSKKLSIE--KYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN-IQKTQNCLQGNPDG-KWRDVSCDDKNPFF 3906
             +  +++ +A   C+ +G DL+ +        +  + T       WI  ND+++ G + +SD   + Y N+   +PN+ + E+CV     ++G W +  C+     +C K      D    +   D  KY    G              +  +  A + CQ     L +I    EL+ +  +L  +  I   W+  +D   + ++   D   + +  W+  EPNN+ N  EDC+   + A G+W+D  C+     I          K  +                + ++ +TFE+A+ +C     +LV I N         L        +WI   D+   G F   +   + Y+ + R EP    +         + G W    C S K  FIC                     S   P     + ++ Y  K+F      N++++ +A   C+  G  L+ +   D   F++  L      S  ++   +WI G + +N   +G W +SDG  +T++N+          N     +++  +  WL   C S+   IC  P  +++   E+ +               K++ HR   T+ +A   C      L  V + D  ++L   L K + +E   +WL  +  +N+G +  SD   L + +W  G+ + + + + C+  +     W D  C    P+ 
Sbjct:  256 FQAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSAA-LWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSL--RKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCV-SIWGAEGRWDDSPCNLTLPSICKKPGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPITNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEPAKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWI-GLNRRNPMDNGSWKWSDGMAVTYQNFGRYYY-----NVRQCAAADLGAMTWLAMHCDSELDWICKIPRGSVEKLPEITEGNTSPEWIMFKEAEYKFFDHR--TTWDQAQRICSWFDSSLASVHSADEQMFLANTLRKMVKVEGDSWWLGLHTYENDGRFRWSDHSVLNYISWALGRPHPLSRDRRCVSISASKVDWSDQKCHSDLPYI 948          

HSP 4 Score: 89.7373 bits (221), Expect = 1.637e-17
Identity = 109/566 (19.26%), Postives = 222/566 (39.22%), Query Frame = 1
Query: 2440 DTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENII-------STKELEIFKERVTFEEAQNTCI-----KKGWSLVRIDNEETNQNIYDL-----------AVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN--EDCVHGLYYSNGFWNDIACNSKNSFICSK--------------------YSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVS-KNSVICYK------------------PSKTIDTGKEVKKTKYYIHRI--------GVTFQEALDFCKERRCKLIVVDNIDTNIYLWEL-----SKKLSIEKYW----LNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDK 3894
            D+   F     +++ EA   CQ     L+++        I  L   +  +  W+  ND+   G W   D + LKYLNW + +PN+   E+C++    ++G+W +  CS    ++     N         S  + E ++  V ++  Q  C      K  W+  + + ++   N+  +           +++  I Q WI  +D  ++  F  +++  + ++ +   EPNN+ N  EDCV  ++ + G W+D  CN     IC K                    +SP   ++ E +        +T+ +A   C+S   +L+ + N       ++L       ++WI   D  + G + +  G  +++ NW     P+  ++     ++   +G W    C S K   IC +                   S +  +G +      Y +++         +++ +A  FC+     L+ +   D   ++ ++      +    E++W    LN  +  + G+W  SD   +T+ N+     N+++      G     W  + CD +
Sbjct:  249 DSCYQFNFQAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYS-AALWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSLRKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCV-SIWGAEGRWDDSPCNLTLPSICKKPGTKSDGKPQQQDCNQGWKWHSPACYWVGEDL--------LTFEDAKKSCESHQAALVPITNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNE-PAKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNFGRYYYNVRQCAAADLGA--MTWLAMHCDSE 801          
BLAST of Mannose-binding protein C vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163523])

HSP 1 Score: 162.155 bits (409), Expect = 1.155e-39
Identity = 220/1017 (21.63%), Postives = 391/1017 (38.45%), Query Frame = 1
Query:  943 LTYYKAQDLCKSQGYKLVKIDD---EQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTK-----------FEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQK------------YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLE-GNFYPNGEWNDISCKTK-NYLIYEYESTA---EKEITIEIMEGKVNYIK-------------------ALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNN-EDCVHGLFY---TNGLWNDISCNSINSVLCYKPFXXXXXX----------XXXXGKID--TSKYFVHTGRVTYEEALRFCQIHSCRLVTIEN-SELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPN-NYGNEDCLLGNYFANGKWNDFSCSTKNSFIY---------YYIENIISTKELEIFK--------------ERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDAN---------------------DKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVH--GLYYSN---------------GFWNDIACNSKNSFIC-------SKYSP-PI-------IFIDEHMSYKIFINKVTYREAVDKCQSEGYSL--IKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTI 3552
            LT+ +A+  CK Q   L+ + D   E + + +          ++WI    +  E  ++ S +N  ++  W +G P +     C       +  W +  C      IC  + G    TK              + +   ++  +  +  AQL C+    +L+ I + E  S I+           WI  ND  TE  F +SD   + +  W  G+P   EN EDCV  +  + G W D  C+ K+  IC K    S   I Q++             Y V     T++EA   C+     +  +S    N  +           FW+  ++      +V +   ++ + +W    P   + + C+     +  G W+ + C  K  Y+  +    A       T+ +    V + K                   A E C + G DL+   +++       VA + +  + WI  +  N++  +++SDG  ++++++++GEPNN+NN E C     Y     G WND  C   NS  C  P                    +G ++   ++YF++   ++ EEA +FC+     L TI + +E   L   ++R H    YW+ G ++  +G  V +D +++ Y  W++G+P+  + +E C++     +G W+D++C  ++  I            +  I++ K    F               +R+T+  A  TC     +L  ID+ E    +    V       WI  +                     ++     F D + + +K   F   +  ++  +D VH   ++ S+               G W    CN  N+F+C       S  SP P        IF D   S+K F   +T+  A   C  +G +L  IK E +     +    L+  +   WI     +    + F  G +L F NW      SD+   +C+Y    + GKW  +SC      +C K S  +
Sbjct:  212 LTWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWIGLT-LDPEHGWKWSSQNPFRYLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVL-IRGQKGNWADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMPG--DRQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFHSKDDL-----VAGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISRSH--GNYWI-GLNVDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVIMR-VEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLHGGEFYWSNGRKRSFVNLLERNFRNPFRDYHPYQIKRPVFFHDDELHF--QDYVHFSEMHRSDRDKCAVINTNPSLGIGKWIPQFCNDTNAFVCLRDVDPKSPDSPEPTTPTGYTKIFND---SFKSFPQNMTWDGAQKYCAGDGANLASIKTEWAQAYVELQVAKLKRPV---WIGLNKDRTSSYFRFIAGSRLKFVNWNENEPRSDQ---SCVYVD--VGGKWKTSSCNQTYHFVCMKSSDVL 1202          

HSP 2 Score: 148.673 bits (374), Expect = 1.517e-35
Identity = 207/1009 (20.52%), Postives = 381/1009 (37.76%), Query Frame = 1
Query:   73 PSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVI----------KLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLK----------------KITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYY---KNALWNDIKCEDLNAVICYKNIGSRGFTK---------------FEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPN-NYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKD-ILNSNETI---------------KQQQKYY--VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAK----------------------------------NEPNNYNNEDCLEGNFYPN---GEWNDISCKTKNYLI----YEYESTAEKEITIEIMEGKV------------NYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK-----PFXXXXXXXXXXGKIDTSK-----------YFVHTGRVTYEEALRFCQIHSCRLVTIEN-SELDILILNLAR-KHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPN 2691
            P A +C   T P IS       +   +++ + T+++A   C+ +  +L+ I + +  + +++          WI  ND   EG F++ +   +++  +  G+P    N EDCV  +  + G W D  C++ +  IC K ++   S ++          +  +   ++  E  T++ A   C      L  +     N+ + +L        +W+  ++ +    F+ ++ K++ +  +    P + Q       G  +   LW+ + CA+    IC + +K  V+                 K+   N     F ++ T+Y+A++ C + G  L+      F+S     A +    R WI  +   ++  +  SD + + F  W+ GEPNN  N E C     Y       WND +CE  N+  C   +G                      E    +  I ++ +  + A+  CK    +L  I+S   N+ ++   +  + G YWI  N +  + T V+ D  ++ YQ+W  G+P+  + +E CV  +  ++G+W+D  C +++  IC +    ++N T+               K Q K Y  V +  +T+  A   C   N  +  I + E    +     +      WI G   +  G++  S G K  ++N  +                                  +E +  + + C   N  P+   G+W    C   N  +     + +S    E T      K+             +  A + C   G +L  I+ E     V     K K    WI  N       F +  G  + + N+   EP  ++++ CV+      G W   SCN     +C K     P +            + S            Y   T    + EA   C  H   +V+IE+ SE D +   L   K + + +WL G     +G W  +D   + Y NW+  +P 
Sbjct:  330 PEAGLC---TAPWIS----YNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVL-IRGQKGNWADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMPGDRQGCVAMATG--HHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLS-----FHSKDDLVAGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWK-RISRSHGNYWIGLN-VDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVI-MRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWI-GFHKLHGGEFYWSNGRKRSFVNLLERNFRNPFRDYHPYQIKRPVFFHDDELHFQDYVHFSEMHRSDRDKCAVINTNPSLGIGKWIPQFCNDTNAFVCLRDVDPKSPDSPEPTTPTGYTKIFNDSFKSFPQNMTWDGAQKYCAGDGANLASIKTEWAQAYVELQVAKLKR-PVWIGLNKDRTSSYFRFIAGSRLKFVNWNENEP--RSDQSCVY--VDVGGKWKTSSCNQTYHFVCMKSSDVLPVQPSNFPGVCPDDPNPSSQHYWIPFRGHCYTFFTKLENWPEASTDCSKHGGMIVSIEDPSEQDFIETELQNYKDQHNSFWL-GLYKTHKGTWKWLDRTVMDYTNWDSHQPG 1313          

HSP 3 Score: 141.354 bits (355), Expect = 2.578e-33
Identity = 241/1227 (19.64%), Postives = 452/1227 (36.84%), Query Frame = 1
Query:  307 IKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVIC----YKNTQPKTSHVIKLLNRELIILQEKT------------TYENAIAHCKSKGFQLIKIDDDQLNSMV----------------YNLAVQYQIGRYWIDANDMQ----NEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYK--ESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKE-------------IVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCV-HGLYYKNGLWNDIKCDYKNSVICSK----DILNSNETIKQQQKYYVHEVLV--------------TYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNN-EDCLEGNFYP---NGEWNDISCKTKNYLIYE-----------------YESTAEKEITIE-----IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQN-NEDCVHGLFYTNGLWNDISCNSINSVLCYK-----------PFXXXXXXXXXXGKIDTSKYF--VHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLN---------------WNQGEPNNYGNEDCLLGNY----------------------FANGKWNDFSCSTKNSFIYYY---------IENIISTKELEI-------FKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYS----------PPIIFIDEHMS------------YKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVN--YWIDGTDSKNDGKWTFSDGQQLTFKNWQT 3423
              + GTF+     R     F  G       + C+    Y + +++D +  D   + C    Y ++      V    +R+  I   KT            T+  A + CK +   L+ + D    + V                  L +  + G  W   N  +    + G  +SS G       FA G  +   +N  C   L Y       I C+     +  K  E+ +     I+   +   +++ + T+  AQ  C+ +   LV I + +  S +++          WI  ND   EG F+ SD++ ++F+ W  G+P   +N EDCV  +  +   W D  CE+ +  IC K   + G    EI  +E              ++  E   F  A+++C ++   L  + +   N+ +           +W+  ++ +  N FV++++K++ +  W    P   + + CV     +  GLW+ + C  K   IC +     ++  + T    Q   V    +              T+ EA  +C      ++   +   + ++   +   +  R WI  +    +  +V S G+ + + +W+  EPNN NN E C E + Y     G WND  C+  N    +                 Y +T++  +  +     I +  ++  +A + CK    DL  I +   N  ++   +++  G YWI  N ++ +G  ++ D   + Y+ +  G+P+ ++ +E CV  +   +G+W+D +C   +  +C +           P    K   +   +   SK +  V   R+T+  A + C+  +  L +I++ E+   +L        +  W+  + +   GE+   +G K  ++N               +    P  + +++    +Y                         GKW    C+  N+F+             E    T   +I       F + +T++ AQ  C   G +L  I  E   Q   +L V       WI  N       F       LK+  +   EP +  ++ CV+      G W   +CN    F+C K S          P +   D + S            Y  F     + EA   C   G  ++ +E+      + T    YK  +  +W+ G    + G W + D   + + NW +
Sbjct:  117 FTISGTFDGACA-RTYREMFTTG--GTAAGKPCMFPFMYGNQWYSDCTMTDHTELWCAVETYYSSDSDKWGVCPTNSRQSWIKHPKTGAYYQLNSDAALTWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWIGLTLDPEHGWKWSSQNPFRYLNWDSGYPLSSPGHVC---GFADGTADYSWRNSVCSKRLGY-------ICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVL-IRGQKGNWADSVCEEKHGFICMKKSEASG---SEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMPG--DRQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFHS--KDDLV---AGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISRSH-GNYWIGLN-VDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVI-MRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLHG-GEFYWSNGRKRSFVNLLERNFRNPFRDYHPYQIKRPVFFHDDELHFQDYVHFSEMHRSDRDKCAVINTNPSLGIGKWIPQFCNDTNAFVCLRDVDPKSPDSPEPTTPTGYTKIFNDSFKSFPQNMTWDGAQKYCAGDGANLASIKTEWA-QAYVELQVAKLKRPVWIGLNKDRTSSYFRFIAGSRLKFVNWNENEPRS--DQSCVY--VDVGGKWKTSSCNQTYHFVCMKSSDVLPVQPSNFPGVCPDDPNPSSQHYWIPFRGHCYTFFTKLENWPEASTDCSKHGGMIVSIEDPSEQDFIETELQNYKDQHNSFWL-GLYKTHKGTWKWLDRTVMDYTNWDS 1309          

HSP 4 Score: 108.612 bits (270), Expect = 2.605e-23
Identity = 138/678 (20.35%), Postives = 256/678 (37.76%), Query Frame = 1
Query: 2068 EGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQ---YWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRV--------TYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE-----------------IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCV-HGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMS-------------------YKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKEN-NNCLYSSE---TLSGKWLGTSCVSKNSVICYKP----------------SKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGN-DKDNEGAWIDSDKKKLTFFNWTNGKVNIQK--TQNCLQGNPDGKWRDVSC 3885
            +  + + +A   CK +   L+ + +      V  + T  ++ +   +WI    ++ E  + +S      Y N+  G P +     C       +  W +  C+     +C          K  E  + T+ +  + GR         T+ +A   C+     LV+I N E    I +          W+  ND   EG +   D + +++ +W  G+P    N EDC+L      G W D  C  K+ FI         ++ L+                 +  E  TF+EA+  C      L  +     N  +  L        +W+  +++     FV +N   ++++ +    P +   + CV     +  G W+ + C +K  +IC + +   +      +                   +K F +K T+ EA + C + G  L+   + D       ++ R +    WI  +    D  + +SDG  + F++W     P++K N  +C   S     + G W    C   NS  C  P                + T D   E K  +Y+I++  ++ +EA  FCK+    L  +++ + N +LW+   + S   YW+  N D D    W+  D  ++ +  W  G+ + +    Q  +    DG W D +C
Sbjct:  209 DAALTWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWIGLT-LDPEHGWKWSSQNPFRYLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVLIRG-QKGNWADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMPGD--RQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFHSKD-----DLVAGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGE-PNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISR-SHGNYWIGLNVDFDGTRVWM--DHSEVIYQQWDEGQPDYKHYDEQCVIMRVEDGVWHDYNC 873          

HSP 5 Score: 95.1301 bits (235), Expect = 4.058e-19
Identity = 142/734 (19.35%), Postives = 261/734 (35.56%), Query Frame = 1
Query:  151 IFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFY---KDGFWNDISCDDTNSVIC------------------YKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKEL----------------VIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVR---------------------IEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKN---------------ALWNDIKCEDLNAVICYKNIGSR-----------GFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVIC--SKDILN----------SNETIKQQQKYYVH---------EVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMK--IGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPN--NYNNEDCLEGNFYPNGEWNDIS--CKTKNYL 2016
             F +K T+ EA + C A G +L+      F+++   +A +    R WI  +   ++  + + +G  + +  ++ GEPNN  N E C     Y    +G WND  C+  NS  C                  Y  T   +   ++    +  I Q+  + E A   CK     L  I+    N+ ++   +    G YWI  N +  +G  +  D  +++Y+++  G+P+    +E CV  +   + +W+D +C   +  IC +         +  +                    ++  +R+T++ A   C+     L  ID  +  + +    V       WI  + +                          F D    +IK   +   +  ++Q+      ++  +                 W    C D NA +C +++  +           G+TK  I N     F + + +  AQ  C  +G  L  I ++   + + +  V       WI  N  +T + F +    ++ +  W   EP +  ++ CV+      G W    C+     +C  S D+L            ++     Q Y++            L  + EA   C++H   IV I +      I    +N K     FW+ G     +G W       + Y NW  ++P    Y      +G +     WN     CKT   L
Sbjct:  632 FFGDKKTWYEAREYCTAIGGDLLS-----FHSKDDLVAGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTT---SDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWK-RISRSHGNYWIGLN-VDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVI-MRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLHGGEFYWSNGRKRSFVNLLERNFRNPFRDYHPYQIKRPVFFHDDELHFQDYVHFSEMHRSDRDKCAVINTNPSLGIGKWIPQFCNDTNAFVCLRDVDPKSPDSPEPTTPTGYTK--IFNDSFKSFPQNMTWDGAQKYCAGDGANLASIKTEWAQAYV-ELQVAKLKRPVWIGLNKDRTSSYFRFIAGSRLKFVNWNENEPRS--DQSCVY--VDVGGKWKTSSCNQTYHFVCMKSSDVLPVQPSNFPGVCPDDPNPSSQHYWIPFRGHCYTFFTKLENWPEASTDCSKHGGMIVSIEDPSEQDFIETELQNYKDQHNSFWL-GLYKTHKGTWKWLDRTVMDYTNWDSHQPGMATYAEIATSDGMWKTGRPWNKRPYICKTAKIL 1346          

HSP 6 Score: 62.7734 bits (151), Expect = 2.938e-9
Identity = 52/246 (21.14%), Postives = 102/246 (41.46%), Query Frame = 1
Query: 3217 VTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKL---VNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYK------PSKTIDTGKEVKK------TKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQ-NC-LQGNPDGKWRDVSCDDKNPF 3903
            +T+ EA   C+ +  +L+ + +      V  +    ++     +WI  T     G W +S      + NW +   P     + C ++  T    W  + C  +   IC        P+K  + G             Y ++R   T+ +A   C++    L+ + N++   +++     +  ++ W+  ND+  EG +  SD+  + F +W  GK  +Q+ Q +C L     G W D  C++K+ F
Sbjct:  212 LTWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWIGLTLDPEHG-WKWSSQNPFRYLNWDSG-YPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVLIRGQKGNWADSVCEEKHGF 455          

HSP 7 Score: 53.1434 bits (126), Expect = 2.341e-6
Identity = 41/153 (26.80%), Postives = 66/153 (43.14%), Query Frame = 1
Query:   64 CEDPSAVICYKETEPKI--SAEIELQSKYVIIF-------QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKD--GFWNDISCDDTNSVICYKNT 489
            C D +A +C ++ +PK   S E    + Y  IF        +  T+  A K C   G NL  I+ +     V  L +       WI  N  +    F ++ G R+K+  + + EP +  ++ CV    Y D  G W   SC+ T   +C K++
Sbjct: 1054 CNDTNAFVCLRDVDPKSPDSPEPTTPTGYTKIFNDSFKSFPQNMTWDGAQKYCAGDGANLASIKTEWAQAYV-ELQVAKLKRPVWIGLNKDRTSSYFRFIAGSRLKFVNWNENEPRS--DQSCV----YVDVGGKWKTSSCNQTYHFVCMKSS 1199          
BLAST of Mannose-binding protein C vs. Ensembl Medaka
Match: ENSORLT00000033058.1 (pep primary_assembly:ASM223467v1:21:6426657:6438028:1 gene:ENSORLG00000027148.1 transcript:ENSORLT00000033058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 2.399e-14
Identity = 39/117 (33.33%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  136 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR-NEDCVHGMFYKDGFWNDISCDDTNSVICYK 483
            S    + +E  ++ EA K C+A+G +L+ I     N  +  L  +    R WI   D  +EGT+++V+G  +    +  G+P+NY  +EDCV   F   G WNDI C  +  +IC K
Sbjct:   24 SSCYFLSEESKSWDEARKSCKARGADLVVINSKDENEFISKLNTE----RCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEK 136          

HSP 2 Score: 68.1662 bits (165), Expect = 5.956e-13
Identity = 36/114 (31.58%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  535 IILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKE 876
             + +E  +++ A   CK++G  L+ I+    N  +  L  +    R WI   D   EG +   DG  +    +  G+P+NY  +E CV   + S  LWNDI C  S  +IC KE
Sbjct:   28 FLSEESKSWDEARKSCKARGADLVVINSKDENEFISKLNTE----RCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEKE 137          

HSP 3 Score: 67.0106 bits (162), Expect = 1.660e-12
Identity = 34/112 (30.36%), Postives = 64/112 (57.14%), Query Frame = 1
Query: 2062 IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYK 2394
            + E   ++ +A + CK++G DL+ I +++ N+ +  + T+    + WI   D ++EG + + DG +++   +  G+P+N   +EDCV   F + GLWNDI C     ++C K
Sbjct:   29 LSEESKSWDEARKSCKARGADLVVINSKDENEFISKLNTE----RCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEK 136          

HSP 4 Score: 65.855 bits (159), Expect = 4.325e-12
Identity = 38/113 (33.63%), Postives = 57/113 (50.44%), Query Frame = 1
Query: 1315 IFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICSKD 1650
            + EE   +  A+  CK  G +L+ I+S + N    +F  K N    WI   D   E T+ + D   ++   W  G+P+NY+ +EDCV   +   GLWNDI C     +IC K+
Sbjct:   29 LSEESKSWDEARKSCKARGADLVVINSKDEN----EFISKLNTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEKE 137          

HSP 5 Score: 64.6994 bits (156), Expect = 9.649e-12
Identity = 36/112 (32.14%), Postives = 62/112 (55.36%), Query Frame = 1
Query: 2824 IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY-GNEDCVHGLYYSNGFWNDIACNSKNSFICSK 3156
            + +E  +++EA+ +C  +G  LV I++++ N+ I  L  +    + WI   D+ +EG +   +  +L  + +  G+P+NY G+EDCV   + S G WNDI C      IC K
Sbjct:   29 LSEESKSWDEARKSCKARGADLVVINSKDENEFISKLNTE----RCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEK 136          

HSP 6 Score: 64.6994 bits (156), Expect = 1.022e-11
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 1
Query:  928 IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ-NEDCVHGLYYKNALWNDIKCEDLNAVICYK 1260
            + +E  ++ +A+  CK++G  LV I+ +  N  +       N  R WI   D  +EGT++  D + +  + W +G+P+NY  +EDCV   +    LWNDI C+    +IC K
Sbjct:   29 LSEESKSWDEARKSCKARGADLVVINSKDENEFISKL----NTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEK 136          

HSP 7 Score: 63.1586 bits (152), Expect = 3.390e-11
Identity = 38/115 (33.04%), Postives = 56/115 (48.70%), Query Frame = 1
Query: 1690 YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYN-NEDCLEGNFYPNGEWNDISCKTKNYLIYEYE 2031
            Y++ E   +++EA   C      +V I++ + N+ I      +   R WI   D   EG W    G+ L    W   +P+NY+ +EDC+E +F   G WNDI CK    LI E E
Sbjct:   27 YFLSEESKSWDEARKSCKARGADLVVINSKDENEFI----SKLNTERCWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLICEKE 137          

HSP 8 Score: 58.9214 bits (141), Expect = 1.108e-9
Identity = 34/114 (29.82%), Postives = 55/114 (48.25%), Query Frame = 1
Query: 2443 TSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY-GNEDCLLGNYFANGKWNDFSCSTKNSFI 2781
            +S YF+     +++EA + C+     LV I + + +  I  L  +      W+   D   EG W  +DG+ L    W  G+P+NY G+EDC+  ++ + G WND  C      I
Sbjct:   24 SSCYFLSEESKSWDEARKSCKARGADLVVINSKDENEFISKLNTER----CWIGLTDRDLEGTWKWVDGSSLNLTFWGSGQPDNYDGDEDCVETHFKSPGLWNDIPCKLSRRLI 133          
BLAST of Mannose-binding protein C vs. Planmine SMEST
Match: SMESG000078340.1 (SMESG000078340.1)

HSP 1 Score: 2647.08 bits (6860), Expect = 0.000e+0
Identity = 1312/1314 (99.85%), Postives = 1312/1314 (99.85%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDENEQCKE 3942
            QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISN ETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFKEDKDEKKEEGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTA LPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDENEQCKE
Sbjct:  243 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFKEDKDEKKEEGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTAPLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPDGKWRDVSCDDKNPFFFEFIDENEQCKE 1556          

HSP 2 Score: 1174.46 bits (3037), Expect = 0.000e+0
Identity = 602/1299 (46.34%), Postives = 856/1299 (65.90%), Query Frame = 1
Query:  130 LQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHV--IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQ----QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEIT--------IEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFID--------EHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFE-------FIDEN 3927
            +  K V+   +K TF +A +LCQ  GYN+++I++DQFN  +YN+A++Y  GR+WID NDI+ +  F   +G+R+ + KF  GEPNNY+N E C+ G+FY +G WNDI+C+D N++IC K+ Q   S    + + N++L+I+ EK T+  A A C SKG QLIKI D+  N+ +YNLAVQY+IGRYWIDAND QNEGNF+ +DG+KI + KFA GEPNNYQKNEHCVHGLYY NALWND SC D +AVICYKE++ ++  +I + +K ++IF+E+ T+ +A  LC+++GY L+KI+D+QFN+ VYN A+Q + GR+WIDAND+++EGTFE  +  +IK+ K+A GEPNNY+NEDCVHG++YK+  WNDI C+D N+VICYKN   +     ++ N+E++I +EK  +++A   CK+ G++L+KID D++NSM+Y+ AV++ IG YWIDAND+Q E  F+ SD KKI Y+K+ PGEPNNY+ NE CVHGLYY N LWNDI C   N+VIC K+  +  E +K+     ++  + +  +TY +A + C     ++VKI + + N I+Y ++    IGR+WI+ ND+  EG + DS  NK+ +  WA  EPNNY NEDC+ G +Y N  WNDI C+  N +I  Y++   +  T        I I E KV +  A  LCK+ GY+L++I+++EIN ++YD A K+ +G YWI+ANDI  E  F+YSD + ISY+ +  GEPNN  NEDCVHGL+Y NGLWNDI C+  NSV+C K      +  K        KY+VH   VTYEEA+ FC  H+CR+V I N E + +I   ++  KI  +W++GNDI  EG+WV+  GNKL YLNW + EPNNY NEDCL GN++ NG+WND SC TKN  IY Y         +EI + +V + +A   C  KG+ L+RI+NEE N+ +YD+A KNK+GQYWI+AND  VEG+F+ S+   + Y  F  GEPNN  NEDCVHGL+Y+NG WNDI+CNS NS +C  Y P     D        +   Y +   +VTY EA+  CQ     L+ +ENS++  ++  L+ ++K+  YW+DG D K +G+W   DG +L + NW     P++  N +CL  +   +GKW   SC +KNS I Y     I T KE++     I +  VTF+EA + C ++   L+ +DN +TN  +++L+ K  I +YW++ NDK  EG ++DS+   L +  +  G+ N    ++C+ G    +G W D++C+ KN F          FIDE+
Sbjct:   24 ILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWNDINCNDINAIICSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKE--SKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVIC-YKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIK-----QQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC--YKPFKEDKDEKKEEGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGE-PNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIIST-KELE-----IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEH 1305          

HSP 3 Score: 1108.21 bits (2865), Expect = 0.000e+0
Identity = 599/1323 (45.28%), Postives = 843/1323 (63.72%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISA--EIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ-NEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQ--QQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYE-----STAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYY----------YIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQK-TQNCLQGNP--DGKWRDVSCDDKN 3897
            Q +EHC+ GL+YPN LWND +C D +A+IC K+ +  +S   E+ + +K ++I  EK TF +A  LC +KG  LIKI D+ FNTQ+YNLA+QY  GR+WIDAND + EG F Y +GQ+I ++KFA+GEPNNY +NE CVHG++Y +  WND SC+D ++VICYK T+PK S  I+L ++ +II QEKTT+  A   C++KG+ LIKI+DDQ N+ VYNLA+QY  GR+WIDAND++ EG F   +G++I Y KFA GEPNNY +NE CVHG++Y +  WNDISC D+N+VICYK ++ +    I +LN+EL+I +E+ TY  A   CKS+G++L+KIDD+Q NS+VYN AVQ  IGRYWIDAND++ EG F  SD  KI + K+A GEPNNYQ NE CVHGLYY NALWNDI C D NAVICYK        K  + NKE+VIF+E++ +  AQ LCK+ GY+L+KID ++ NS++Y++AV++NIG YWIDAND++ E TF  SD  KI + KW  GEPNNY+NEDCVHGLYYKN LWNDIKC+  N+VIC K+I +   T  +   ++  + E  V ++ A   C  +   ++KI + E N +IY+++    IG +WI+ NDI TE  +V S   K+ Y  W   EPNNY NEDC+ G +Y NG WNDI C  KN +I   +      T +++    + E  V Y +A+  C      +++I NEE NKI+Y+ +   K+G++WIN NDI  EG+++ S G  + Y N+A  EPNN NNEDC+ G FY NG WNDISC + N ++        + E   E +I      +  G+V Y +AL  C+     L+ IEN E++ ++ ++A K+K+  YW++ NDI  EG+++  DG  + Y N+  GEPNN  NEDC+ G ++ NG WND SC++ NS + Y            E  I T +  +   RVT+EEA   C      LV I+N E +  I +LA K+KI  YW+D ND   EG++V+ + + LKY  + +GEPNNYGNEDC+ G Y++NG WND +C++KNSFI   Y   II   E    +IF  +VT+ EA + C  +G+SL++++N + +  ++ L+++ K+  YWID  D   +GK+  S+   L +  +     P++  N +C++     +G W   +C SKNS IC K S  I    E    K +I++  VT++EA+D C+     LI V+N D +  +  LS +  +  YW++G D  N+G W  SD ++LTF NW    +   K   NCL  +    GKW   SC  KN
Sbjct:  111 QNSEHCLQGLFYPNGLWNDINCNDINAIICSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNY-RNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI-------YEYESTAEKEITIE---IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFKEDKDEKKEEGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFI-YYYIENIISTKE---LEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGE-PNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINK--VTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTAPLPSDKENNNCLYSSETLSGKWLGTSCVSKN 1415          

HSP 4 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 423/1032 (40.99%), Postives = 627/1032 (60.76%), Query Frame = 1
Query:  892 LKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKNALWNDIKCEDLNAVICYKNIGS--RGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE-NEDCVHGLYYKNGLWNDIKCDYKNSVICSKDI-LNSNETIKQQQKYY-VHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIE-------IMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYY-------YIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPII----FIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFF 3906
            L   T+L K++V   ++ T+ +A++LC+  GY +V+ID++QFN ++YN AV+  +GRYWID ND++ +  F +SD  ++ FSK+  GEPNNYQN E C+ GL+Y N LWNDI C D+NA+IC K+I +    F +  +SNK+++I  EK  F  AQ LC + G +L+KI  +  N+ IY+ AV++ IG YWIDAND Q E  FVY+D +KI++ K+  GEPNNY+ NE CVHGLYY N LWND  C+  ++VIC K+     +  I+ Q KY  + +   T+ EA   C      ++KI + + N  +Y  +     GRFWI+ NDI  EG +    G ++ Y  +AK EPNNY NEDC+ G FY +G WNDISC   N +I    +  +    I+       I++ K  Y  A+  CKSKG+ LI+I+++++N +VY++A + ++G+YWI+AND+  EG FI SDG+ I YR FA GEPNN Q NE CVHGL+Y+N LWNDISC   N+V+CYK  K +  +K     +   +  +   R+TY +A   C+    +LV I++ + + ++ N A ++ I  YW+D ND++ EG + + D NK+K+  W  GEPNNY NEDC+ G Y+ N  WND  C   N+ I Y       + +  IS KE+ IF+E+V F+ AQ  C   G+ L++ID++E N  IYD AVK+ IG YWIDAND   E  FV S++  + Y K+  GEPNNY NEDCVHGLYY NG WNDI C+ KNS ICSK    I+     I +   Y +    VTY EA++ C      ++K+ N + + I++  S   K+  +WI+G D   +GKW  S G +L + NW   + P++  N +CL  +   +G+W   SC +KN +I Y+   T +     K+    I    V + +AL+ CK +   LI ++N + N  +++++ K  + +YW+N ND + EG +I SD + +++ N+ +G+ N Q  ++C+ G    +G W D+SC+  N   
Sbjct:   19 LNGATILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWNDINCNDINAIICSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKIT---VLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSK---DILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNW-AKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLI-YEYESTAE-----KEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVL 1037          
BLAST of Mannose-binding protein C vs. Planmine SMEST
Match: SMESG000053708.1 (SMESG000053708.1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 416/1310 (31.76%), Postives = 680/1310 (51.91%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIF---KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFEF 3915
            Q+ E+C+HGL+YPN LWND  C    AVIC K T+  +     L        +E+  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ ND+  EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K         I+ +     + +E+  Y +A+ +C  +  +++ I +  +N  V+++A+++ +G+YWI+ ND   EG ++ S    + Y+ +  GEP+  Q+ E+C+ GL+YSN LWNDI C  SNAVIC K   I+        +   V+  +++TY +A   CK Q  +L+ I +   N  V+N A++  IG YWID ND  +EG + DS  N +++  W +GEPN  + E+CVHGLYY   LWNDI C   N VIC K+     F ++       +I +E + +  A   C      LL I +++IN  I++ AV +N+GTYWI  ND   E ++V S +  + ++KWY GEPN   NE+C+HGL Y N  WND+ C  +N VIC             ++     E+  ++ E    C  +N +I KI      +I  ++ ++M   +        +T  K +D+  +K  Y        + Y +   L   +     W +    T   ++ + + T   E        K+ Y  A++ C ++  +L+ I+NE  NK+V+D++ +  +  YWIN ND+  EG ++ S+   +SY N+ + EP+    E+C+  L Y +G WND+ C+  NSV+C +P            +  T+KY +   R+ + +A+ +C+  +  L+ IEN   + +++ L +K     YW++GND  +EG W+N D  ++ Y NW+  EP  Y  E+C+ G    NG WND +C +    I   I+N        +F    E++    A+  C  +   +V+IDN   N      A+K+ +  +WID  D A EG +VD  +  L Y  +   +P+    E+CV     +NG W+D  C S NS IC     PI   D    + I   K+ +  AV  C+ +   L+K++   ++  V+ LS+ + L  YWI+G D++ +G+W  S    L+FK W   S P   +N NC+  +      W    C S NSVIC    + I  G     +KY++      +++ + +CK ++  L+ + +   N ++++L+ K  +  +W+NGND  NEG W+D+D + LT+ NW   + N  K +NC+QG    DG W +V CD KN    E 
Sbjct:   94 QRQENCIHGLFYPNGLWNDIPCTMSYAVICEK-TKQNVEFGYHLN-------KERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEK--------TIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSG-QRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKT-------DYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEY-----GYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICE----------PMEKSPADPEICKSFLE---LC--YNSKIRKIC-----QITCKFWQSMTTKKI------SVTTSKSLDNISDKEFY--------DKYCSVRFLANLYQKICGWMEKEMTTVAPVVQKLKDTV--EFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC-EPM-----------RHTTNKYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYKKENCIQG-LRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICE----PI--NDMKNGFHITSVKMKFDTAVKYCRDKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWH-KSEPKGGQNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYG----PSKYHMSESKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNEALTYLNWNIRQPNGGKKENCIQGLYFSDGTWNNVKCDMKNKVICEL 1310          

HSP 2 Score: 447.588 bits (1150), Expect = 7.324e-135
Identity = 238/613 (38.83%), Postives = 354/613 (57.75%), Query Frame = 1
Query: 1321 EEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYK-PFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELE--IFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFIC 3150
            +EK+ +  A   CK    E++ I    IN  ++D AVK+N+G YWI+ ND   E +++ S +  + Y+ W  GEP     E+C+HGL+Y NGLWNDI C    +VIC K   N       +  Y++++  + Y  A+N+C +    +V I +   NK +++ +    +G++WINGND+  EG W+DS+ N L Y NW   EPN    E+C+ G FYPNG WNDI C T +Y +   ++    E    + + ++NY  A+  C  +  +++ I N  INK V+D+A K  +GQYWIN ND   EG+++ S    + Y+N+  GEP+ Q  E+C+ GLFY+NGLWNDI CN  N+V+C K P            K D   Y V+  ++TY  A+ FC+  +  L+TI N  ++  + N+A K+KI  YW+DGND   EG WV+   N ++Y NW  GEPN    E+C+ G Y+  G WND SC+T N+ I    +      E    I  E + ++ A   C++K   L+ I NE+ N+ I+++AV   +G YWI  ND + EG +VDS N +L++ K+ +GEPN   NE+C+HGL Y N FWND+ C  +N  IC
Sbjct:   17 KEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNV------EFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPC-TMSYAVICEKTIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPII----------KTDYG-YVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC 611          

HSP 3 Score: 443.351 bits (1139), Expect = 2.463e-133
Identity = 237/619 (38.29%), Postives = 355/619 (57.35%), Query Frame = 1
Query:  544 QEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEK--EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            +EK  Y +AI +CK +  +++ I D  +N  V+++AV+Y +G+YWI+ ND   EG+++ S    + Y+ +  GEP   Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T  N E    + KER+ Y  A + CK Q  ++V I D   N  V++ AV+ N+G+YWI+ ND+  EG + DS  N +++  W +GEPN  + E+C+HGL+Y N LWNDI C    AVIC K I +  F           + +E++ +  A   C     E++ I +  IN  ++D A+K N+G YWI+ ND   E  ++ S +  + Y+ W  GEP+    E+C+ GL+Y NGLWNDI C++ N+VIC K  +     IK    Y V+   +TY  A++FC + N  ++ I N   NK ++  +   KIG +WI+GND   EG WVDSK N + Y NW   EPN    E+C+ G +YP G WNDISC T N +I +      +  E    I +  ++Y  A++ C  K   L+ I+NE+INK ++++A    +G YWI  ND + EG ++ S   ++ ++ +  GEPN   NE+C+HGL Y N  WND++C   N V+C
Sbjct:   17 KEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKG-QRQENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYH--------LNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPI-----IKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC 611          

HSP 4 Score: 438.728 bits (1127), Expect = 1.374e-131
Identity = 238/644 (36.96%), Postives = 360/644 (55.90%), Query Frame = 1
Query:  157 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEI--SNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEY--ESTAEKEITIEIME 2070
            +EK  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ ND  +EG++       ++Y  +  GEP   R E+C+HG+FY +G WNDI C  + +VIC K  Q         LN+      E+  Y +A+ +CK +  +++ I D  +N  V+++AV+Y +G+YWI+ NDM  EGN++ S    + Y+ +  GEPN  Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T+ N E    + KER+ Y  A + C  Q  ++V I +   N  V++ A++ N+G+YWI+ ND   EG + DS  N +++  W +GEP+  + E+C+ GL+Y N LWNDI C   NAVIC          KF I  ++   V+  +K+ +  A   CK    ELL I +  +N  +++ A+K+ IG YWID ND   E  +V S    + Y+ W  GEPN    E+CVHGLYY  GLWNDI C+  N+VIC K    S      +  Y + +  + Y+ A+ FC + N R++ I N + NK I+  +    +G +WI GND   EG WVDS+   L +  W + EPN   NE+C+ G  Y N  WND++C  +N +I E   +S A+ EI    +E
Sbjct:   17 KEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQ--NVEFGYHLNK------ERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNG-QRRENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVIC---------LKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFV---EYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEICKSFLE 629          

HSP 5 Score: 412.149 bits (1058), Expect = 4.070e-122
Identity = 218/630 (34.60%), Postives = 343/630 (54.44%), Query Frame = 1
Query: 1690 YYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKT 3579
            Y++++  + Y  AIN+C      +V IS+   NK +++ +    +G++WINGND   EG W+DS+ N L Y NW   EP     E+C+ G FYPNG WNDI C T +Y +   ++    E    + + ++NY  A+  CK +  +++ I +  INK V+D+A K  +GQYWIN ND+  EG ++ S    + Y+N+  GEPN Q  E+C+HGLFY NGLWNDI C    +V+C K  +  +             Y ++  R+ Y  A+ +C   +  +V I N+ ++  + ++A K  +  YW++GND  KEG+W++   N L+Y NW  GEP+    E+C+ G +++NG WND  C+  N+ I      I +     +  +++T+  A + C ++   L+ I N   N+ ++++A+K KIG YWID ND  +EG +VDS  + ++Y  +  GEPN    E+CVHGLYY  G WNDI+CN+ N+ IC K      F++    Y I    + Y  AV  C  +   L+ ++N  I+  +  +++ Y L  YWI G D   +G W  S    L FK W     P+   N NC++     +  W   +C  +N VIC +P +      E+ K+
Sbjct:   13 YHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPC-TMSYAVICEKTKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFG-----------YHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVE--YGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGE-PNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC-EPMEKSPADPEICKS 626          

HSP 6 Score: 398.667 bits (1023), Expect = 2.739e-117
Identity = 216/630 (34.29%), Postives = 346/630 (54.92%), Query Frame = 1
Query: 2047 EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL--EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFEFIDE 3924
            E    + + K+NY  A+  CK +  +++ I +  INK V+D+A K  +GQYWIN ND  +EG ++ S    + Y+N+  GEP  Q  E+C+HGLFY NGLWNDI C    +V+C K  +  +             Y ++  R+ Y  A+ +C+     +VTI ++ ++  + ++A K+ +  YW++GND+ KEG W++   N L+Y NW  GEPN    E+C+ G ++ NG WND  C+   + I    E  I   E    + KER+ +  A N C  +   +V I N   N+ ++D+A+K  +GQYWI+ ND A EGK++DS N+ L+Y  +  GEP+    E+C+ GL+YSNG WNDI CN  N+ IC K+  PII  D    Y + + K+TY  AV  C+ +   L+ + N  ++  V  ++++YK+  YWIDG D+  +G W  S    + +KNW++   P+ K   NC++     +G W   SC + N+VIC K  K      +  +  Y I    + +  A+ FC E+  +L+ + N   N  ++ ++   ++  YW+ GND   EG+W+DS    L F  W  G+ N  + +NC+ G    +  W DV+C ++N    E +++
Sbjct:   10 EFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNVEFG-----------YHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVI---CEKTIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKF--PIIKTD--YGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGE-PNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKK----SQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEK 616          

HSP 7 Score: 189.504 bits (480), Expect = 3.077e-48
Identity = 112/367 (30.52%), Postives = 193/367 (52.59%), Query Frame = 1
Query: 2830 KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPD--GKWRDVSCDDKNPFFFEFIDE 3924
            +E++T++ A   C+ +  +LV IDNE TN+ ++DL+++  I  YWI+ ND   EG +VDSNN+ L Y+ +   EP+    E+C+  L Y++GFWND+ C+  NS IC     P+        Y I  +++ + +AV+ C+     LI +EN   + IV  L  +    +YW++G D+  +G W  +D +++++KNW     P   +  NC+     ++G W   +C S   VIC +P +  +  +    + +Y     +    A +FC  R  +++ +DN   N      + K ++  +W++G D  NEG W+D   +KL++ NW + K +  K +NC+    D  G W D  C   N    E I++
Sbjct:  718 REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE----PMRHTTN--KYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKE-PQGYKKENCI-QGLRINGLWNDVTCDSLGEVIC-QPIQ--NKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICEPIND 1073          
BLAST of Mannose-binding protein C vs. Planmine SMEST
Match: SMESG000053708.1 (SMESG000053708.1)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 416/1310 (31.76%), Postives = 680/1310 (51.91%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIF---KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFEF 3915
            Q+ E+C+HGL+YPN LWND  C    AVIC K T+  +     L        +E+  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ ND+  EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K         I+ +     + +E+  Y +A+ +C  +  +++ I +  +N  V+++A+++ +G+YWI+ ND   EG ++ S    + Y+ +  GEP+  Q+ E+C+ GL+YSN LWNDI C  SNAVIC K   I+        +   V+  +++TY +A   CK Q  +L+ I +   N  V+N A++  IG YWID ND  +EG + DS  N +++  W +GEPN  + E+CVHGLYY   LWNDI C   N VIC K+     F ++       +I +E + +  A   C      LL I +++IN  I++ AV +N+GTYWI  ND   E ++V S +  + ++KWY GEPN   NE+C+HGL Y N  WND+ C  +N VIC             ++     E+  ++ E    C  +N +I KI      +I  ++ ++M   +        +T  K +D+  +K  Y        + Y +   L   +     W +    T   ++ + + T E          K+ Y  A++ C ++  +L+ I+NE  NK+V+D++ +  +  YWIN ND+  EG ++ S+   +SY N+ + EP+    E+C+  L Y +G WND+ C+  NSV+C +P            +  T+KY +   R+ + +A+ +C+  +  L+ IEN   + +++ L +K     YW++GND  +EG W+N D  ++ Y NW+  EP  Y  E+C+ G    NG WND +C +    I   I+N        +F    E++    A+  C  +   +V+IDN   N      A+K+ +  +WID  D A EG +VD  +  L Y  +   +P+    E+CV     +NG W+D  C S NS IC     PI   D    + I   K+ +  AV  C+ +   L+K++   ++  V+ LS+ + L  YWI+G D++ +G+W  S    L+FK W   S P   +N NC+  +      W    C S NSVIC    + I  G     +KY++      +++ + +CK ++  L+ + +   N ++++L+ K  +  +W+NGND  NEG W+D+D + LT+ NW   + N  K +NC+QG    DG W +V CD KN    E 
Sbjct:  336 QRQENCIHGLFYPNGLWNDIPCTMSYAVICEK-TKQNVEFGYHLN-------KERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEK--------TIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSG-QRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKT-------DYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEYGY-----LITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEP----------MEKSPADPEICKSFLE---LC--YNSKIRKIC-----QITCKFWQSMTTKKI------SVTTSKSLDNISDKEFY--------DKYCSVRFLANLYQKICGWMEKEMTTVAPVVQKLKDTVE--FGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC-EPM-----------RHTTNKYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYKKENCIQG-LRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICE----PIN--DMKNGFHITSVKMKFDTAVKYCRDKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWH-KSEPKGGQNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYGP----SKYHMSESKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNEALTYLNWNIRQPNGGKKENCIQGLYFSDGTWNNVKCDMKNKVICEL 1552          

HSP 2 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 328/890 (36.85%), Postives = 508/890 (57.08%), Query Frame = 1
Query:  157 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL 2820
            +E+  +  A   C+ +  +++ I D   N QV+++A++Y+ G++WI+ ND   EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K         I+ +     + +EK  Y +AI +CK +  +++ I+D  +N  V+++AV+Y +G+YWI+ ND+  EGN++ S    + Y+ +  GEPN  Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T  N E    + KE++ Y  A + CK Q  ++V I D   N  V++ AV+ N+G+YWI+ ND  IEG++ DS  N +++  W +GEP   + E+C+HGL+Y N LWNDI C    AVIC K   +  F           + +E++ +  A   CK    E++ I    IN  ++D AVK+N+G YWI+ ND+  E  ++ S +  + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K I N       +  Y++++  + Y  A+N+CN  N  +V I N   NK +++ +    +G++WINGND   EGKW+DS+ N L Y NW   EP+    E+C++G FY NG WNDI C   N +I       + +    +   K+ Y +A+  CK +  +L+ I N  +NK V+++A K K+G YWI+ ND  +EG ++ S    + Y+N+  GEPN +  E+CVHGL+Y  GLWNDISCN+ N+V+C K         K++ +     Y +    + Y+ A++FC   + RL+TI+N +++  I N+A  + +  YW+ GND  KEG WV+     L++  W QGEPN   NE+C+ G  + N  WND +C  +N  I   +E   +  E+
Sbjct:   17 KERMNYNSAINYCKMQKMDMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEK--------TIQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNG-QRRENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TKQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNVEFGYH--------LNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNV------EFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQK--------SKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEI 865          

HSP 3 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 319/882 (36.17%), Postives = 486/882 (55.10%), Query Frame = 1
Query:  934 KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKT 3579
            KER+ Y  A + CK Q   +V I+D   N  V++ AV+ N+G+YWI+ ND   EG + DS KN +++  W +GEPN  + E+C+HGL+Y N LWNDI C    AVIC K I +  F           + +EK+ +  A   CK    E++ I+   IN  ++D AVK+N+G YWI+ NDI  E  ++ S +  + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K   N       +  Y++++  + Y  AIN+C      +V IS+   NK +++ +    +G++WINGND   EG W+DS+ N L Y NW   EP     E+C+ G FYPNG WNDI C T +Y +   ++    E    + + ++NY  A+  CK +  +++ I +  INK V+D+A K  +GQYWIN ND+  EG ++ S    + Y+N+  GEPN Q  E+C+HGLFY NGLWNDI C    +V+C K  +  +             Y ++  R+ Y  A+ +C   +  +V I N+ ++  + ++A K  +  YW++GND  KEG+W++   N L+Y NW  GEP+    E+C+ G +++NG WND  C+  N+ I      I +     +  +++T+  A + C ++   L+ I N   N+ ++++A+K KIG YWID ND  +EG +VDS  + ++Y  +  GEPN    E+CVHGLYY  G WNDI+CN+ N+ IC K      F++    Y I    + Y  AV  C  +   L+ ++N  I+  +  +++ Y L  YWI G D   +G W  S    L FK W     P+   N NC++     +  W   +C  +N VIC +P +      E+ K+
Sbjct:   17 KERMNYNSAINYCKMQKMDMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYH--------LNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNV------EFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPC-TMSYAVICEKTKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFG-----------YHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVE--YGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGE-PNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC-EPMEKSPADPEICKS 868          

HSP 4 Score: 577.015 bits (1486), Expect = 1.458e-180
Identity = 311/885 (35.14%), Postives = 489/885 (55.25%), Query Frame = 1
Query: 1288 FEISNKEIV--IFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL--EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFEFIDE 3924
            F + N E    + +E++ +  A   CK    +++ I+   IN  ++D AVK+N+G YWI+ ND   E  ++ S    + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K I N       +  Y++++  + Y  AIN+C      +V I++   NK +++ +    +G++WINGNDI  EG W+DS+ N L Y NW   EPN    E+C+ G FYPNG WNDI C T +Y +   ++    E    + + K+NY  A+  CK +  +++ I +  INK V+D+A K  +GQYWIN ND  +EG ++ S    + Y+N+  GEP  Q  E+C+HGLFY NGLWNDI C    +V+C K  +  +             Y ++  R+ Y  A+ +C+     +VTI ++ ++  + ++A K+ +  YW++GND+ KEG W++   N L+Y NW  GEPN    E+C+ G ++ NG WND  C+   + I    E  I   E    + KER+ +  A N C  +   +V I N   N+ ++D+A+K  +GQYWI+ ND A EGK++DS N+ L+Y  +  GEP+    E+C+ GL+YSNG WNDI CN  N+ IC K+  PII  D    Y + + K+TY  AV  C+ +   L+ + N  ++  V  ++++YK+  YWIDG D+  +G W  S    + +KNW++   P+ K   NC++     +G W   SC + N+VIC K  K      +  +  Y I    + +  A+ FC E+  +L+ + N   N  ++ ++   ++  YW+ GND   EG+W+DS    L F  W  G+ N  + +NC+ G    +  W DV+C ++N    E +++
Sbjct:    4 FPVQNVEFGYHLNKERMNYNSAINYCKMQKMDMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNV------EFGYHLNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPC-TMSYAVICEKTKQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNVEFG-----------YHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVI---CEKTIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKF--PIIKTD--YGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGE-PNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKK----SQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEK 858          

HSP 5 Score: 556.599 bits (1433), Expect = 4.965e-173
Identity = 300/800 (37.50%), Postives = 451/800 (56.38%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEK--EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            ++ E+C+HGL+YPN LWND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ NDI  EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K  Q         LN+      EK  Y +AI +CK +  +++ I D  +N  V+++AV+Y +G+YWI+ ND   EG+++ S    + Y+ +  GEP   Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T  N E    + KER+ Y  A + CK Q  ++V I D   N  V++ AV+ N+G+YWI+ ND+  EG + DS  N +++  W +GEPN  + E+C+HGL+Y N LWNDI C    AVIC K I +  F           + +E++ +  A   C     E++ I +  IN  ++D A+K N+G YWI+ ND   E  ++ S +  + Y+ W  GEP+    E+C+ GL+Y NGLWNDI C++ N+VIC K  +     IK    Y V+   +TY  A++FC + N  ++ I N   NK ++  +   KIG +WI+GND   EG WVDSK N + Y NW   EPN    E+C+ G +YP G WNDISC T N +I +      +  E    I +  ++Y  A++ C  K   L+ I+NE+INK ++++A    +G YWI  ND + EG ++ S   ++ ++ +  GEPN   NE+C+HGL Y N  WND++C   N V+C
Sbjct:   94 KRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQ--NVEFGYHLNK------EKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKG-QRQENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYH--------LNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPI-----IKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC 853          

HSP 6 Score: 473.396 bits (1217), Expect = 1.796e-142
Identity = 259/696 (37.21%), Postives = 387/696 (55.60%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEI--SNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEY--ESTAEKEITIEIME 2070
            Q+ E+C+HGL+YPN LWND  C    AVIC K T+  +     L        +EK  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ ND  +EG++       ++Y  +  GEP   R E+C+HG+FY +G WNDI C  + +VIC K  Q         LN+      E+  Y +A+ +CK +  +++ I D  +N  V+++AV+Y +G+YWI+ NDM  EGN++ S    + Y+ +  GEPN  Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T+ N E    + KER+ Y  A + C  Q  ++V I +   N  V++ A++ N+G+YWI+ ND   EG + DS  N +++  W +GEP+  + E+C+ GL+Y N LWNDI C   NAVIC          KF I  ++   V+  +K+ +  A   CK    ELL I +  +N  +++ A+K+ IG YWID ND   E  +V S    + Y+ W  GEPN    E+CVHGLYY  GLWNDI C+  N+VIC K    S      +  Y + +  + Y+ A+ FC + N R++ I N + NK I+  +    +G +WI GND   EG WVDS+   L +  W + EPN   NE+C+ G  Y N  WND++C  +N +I E   +S A+ EI    +E
Sbjct:  215 QRRENCIHGLFYPNGLWNDIPCTMSYAVICEK-TKQNVEFGYHLN-------KEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQ--NVEFGYHLNK------ERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNG-QRRENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVIC---------LKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFV---EYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEICKSFLE 871          

HSP 7 Score: 189.504 bits (480), Expect = 3.791e-48
Identity = 112/367 (30.52%), Postives = 193/367 (52.59%), Query Frame = 1
Query: 2830 KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPD--GKWRDVSCDDKNPFFFEFIDE 3924
            +E++T++ A   C+ +  +LV IDNE TN+ ++DL+++  I  YWI+ ND   EG +VDSNN+ L Y+ +   EP+    E+C+  L Y++GFWND+ C+  NS IC     P+        Y I  +++ + +AV+ C+     LI +EN   + IV  L  +    +YW++G D+  +G W  +D +++++KNW     P   +  NC+     ++G W   +C S   VIC +P +  +  +    + +Y     +    A +FC  R  +++ +DN   N      + K ++  +W++G D  NEG W+D   +KL++ NW + K +  K +NC+    D  G W D  C   N    E I++
Sbjct:  960 REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE----PMRHTTN--KYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKE-PQGYKKENCI-QGLRINGLWNDVTCDSLGEVIC-QPIQ--NKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICEPIND 1315          
BLAST of Mannose-binding protein C vs. Planmine SMEST
Match: SMESG000053708.1 (SMESG000053708.1)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 416/1310 (31.76%), Postives = 680/1310 (51.91%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIF---KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFEF 3915
            Q+ E+C+HGL+YPN LWND  C    AVIC K T+  +     L        +E+  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ ND+  EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K         I+ +     + +E+  Y +A+ +C  +  +++ I +  +N  V+++A+++ +G+YWI+ ND   EG ++ S    + Y+ +  GEP+  Q+ E+C+ GL+YSN LWNDI C  SNAVIC K   I+        +   V+  +++TY +A   CK Q  +L+ I +   N  V+N A++  IG YWID ND  +EG + DS  N +++  W +GEPN  + E+CVHGLYY   LWNDI C   N VIC K+     F ++       +I +E + +  A   C      LL I +++IN  I++ AV +N+GTYWI  ND   E ++V S +  + ++KWY GEPN   NE+C+HGL Y N  WND+ C  +N VIC             ++     E+  ++ E    C  +N +I KI      +I  ++ ++M   +        +T  K +D+  +K  Y        + Y +   L   +     W +    T   ++ + + T E          K+ Y  A++ C ++  +L+ I+NE  NK+V+D++ +  +  YWIN ND+  EG ++ S+   +SY N+ + EP+    E+C+  L Y +G WND+ C+  NSV+C +P            +  T+KY +   R+ + +A+ +C+  +  L+ IEN   + +++ L +K     YW++GND  +EG W+N D  ++ Y NW+  EP  Y  E+C+ G    NG WND +C +    I   I+N        +F    E++    A+  C  +   +V+IDN   N      A+K+ +  +WID  D A EG +VD  +  L Y  +   +P+    E+CV     +NG W+D  C S NS IC     PI   D    + I   K+ +  AV  C+ +   L+K++   ++  V+ LS+ + L  YWI+G D++ +G+W  S    L+FK W   S P   +N NC+  +      W    C S NSVIC    + I  G     +KY++      +++ + +CK ++  L+ + +   N ++++L+ K  +  +W+NGND  NEG W+D+D + LT+ NW   + N  K +NC+QG    DG W +V CD KN    E 
Sbjct:  339 QRQENCIHGLFYPNGLWNDIPCTMSYAVICEK-TKQNVEFGYHLN-------KERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEK--------TIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSG-QRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKT-------DYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEYGY-----LITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEP----------MEKSPADPEICKSFLE---LC--YNSKIRKIC-----QITCKFWQSMTTKKI------SVTTSKSLDNISDKEFY--------DKYCSVRFLANLYQKICGWMEKEMTTVAPVVQKLKDTVE--FGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC-EPM-----------RHTTNKYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYKKENCIQG-LRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICE----PIN--DMKNGFHITSVKMKFDTAVKYCRDKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWH-KSEPKGGQNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYGP----SKYHMSESKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNEALTYLNWNIRQPNGGKKENCIQGLYFSDGTWNNVKCDMKNKVICEL 1555          

HSP 2 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 328/890 (36.85%), Postives = 508/890 (57.08%), Query Frame = 1
Query:  157 QEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL 2820
            +E+  +  A   C+ +  +++ I D   N QV+++A++Y+ G++WI+ ND   EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K         I+ +     + +EK  Y +AI +CK +  +++ I+D  +N  V+++AV+Y +G+YWI+ ND+  EGN++ S    + Y+ +  GEPN  Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T  N E    + KE++ Y  A + CK Q  ++V I D   N  V++ AV+ N+G+YWI+ ND  IEG++ DS  N +++  W +GEP   + E+C+HGL+Y N LWNDI C    AVIC K   +  F           + +E++ +  A   CK    E++ I    IN  ++D AVK+N+G YWI+ ND+  E  ++ S +  + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K I N       +  Y++++  + Y  A+N+CN  N  +V I N   NK +++ +    +G++WINGND   EGKW+DS+ N L Y NW   EP+    E+C++G FY NG WNDI C   N +I       + +    +   K+ Y +A+  CK +  +L+ I N  +NK V+++A K K+G YWI+ ND  +EG ++ S    + Y+N+  GEPN +  E+CVHGL+Y  GLWNDISCN+ N+V+C K         K++ +     Y +    + Y+ A++FC   + RL+TI+N +++  I N+A  + +  YW+ GND  KEG WV+     L++  W QGEPN   NE+C+ G  + N  WND +C  +N  I   +E   +  E+
Sbjct:   20 KERMNYNSAINYCKMQKMDMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEK--------TIQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNG-QRRENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TKQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNVEFGYH--------LNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNV------EFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQK--------SKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEI 868          

HSP 3 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 319/882 (36.17%), Postives = 486/882 (55.10%), Query Frame = 1
Query:  934 KERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKT 3579
            KER+ Y  A + CK Q   +V I+D   N  V++ AV+ N+G+YWI+ ND   EG + DS KN +++  W +GEPN  + E+C+HGL+Y N LWNDI C    AVIC K I +  F           + +EK+ +  A   CK    E++ I+   IN  ++D AVK+N+G YWI+ NDI  E  ++ S +  + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K   N       +  Y++++  + Y  AIN+C      +V IS+   NK +++ +    +G++WINGND   EG W+DS+ N L Y NW   EP     E+C+ G FYPNG WNDI C T +Y +   ++    E    + + ++NY  A+  CK +  +++ I +  INK V+D+A K  +GQYWIN ND+  EG ++ S    + Y+N+  GEPN Q  E+C+HGLFY NGLWNDI C    +V+C K  +  +             Y ++  R+ Y  A+ +C   +  +V I N+ ++  + ++A K  +  YW++GND  KEG+W++   N L+Y NW  GEP+    E+C+ G +++NG WND  C+  N+ I      I +     +  +++T+  A + C ++   L+ I N   N+ ++++A+K KIG YWID ND  +EG +VDS  + ++Y  +  GEPN    E+CVHGLYY  G WNDI+CN+ N+ IC K      F++    Y I    + Y  AV  C  +   L+ ++N  I+  +  +++ Y L  YWI G D   +G W  S    L FK W     P+   N NC++     +  W   +C  +N VIC +P +      E+ K+
Sbjct:   20 KERMNYNSAINYCKMQKMDMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYH--------LNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNV------EFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPC-TMSYAVICEKTKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFG-----------YHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVE--YGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGE-PNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC-EPMEKSPADPEICKS 871          

HSP 4 Score: 577.015 bits (1486), Expect = 1.272e-180
Identity = 311/885 (35.14%), Postives = 489/885 (55.25%), Query Frame = 1
Query: 1288 FEISNKEIV--IFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL--EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFEFIDE 3924
            F + N E    + +E++ +  A   CK    +++ I+   IN  ++D AVK+N+G YWI+ ND   E  ++ S    + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K I N       +  Y++++  + Y  AIN+C      +V I++   NK +++ +    +G++WINGNDI  EG W+DS+ N L Y NW   EPN    E+C+ G FYPNG WNDI C T +Y +   ++    E    + + K+NY  A+  CK +  +++ I +  INK V+D+A K  +GQYWIN ND  +EG ++ S    + Y+N+  GEP  Q  E+C+HGLFY NGLWNDI C    +V+C K  +  +             Y ++  R+ Y  A+ +C+     +VTI ++ ++  + ++A K+ +  YW++GND+ KEG W++   N L+Y NW  GEPN    E+C+ G ++ NG WND  C+   + I    E  I   E    + KER+ +  A N C  +   +V I N   N+ ++D+A+K  +GQYWI+ ND A EGK++DS N+ L+Y  +  GEP+    E+C+ GL+YSNG WNDI CN  N+ IC K+  PII  D    Y + + K+TY  AV  C+ +   L+ + N  ++  V  ++++YK+  YWIDG D+  +G W  S    + +KNW++   P+ K   NC++     +G W   SC + N+VIC K  K      +  +  Y I    + +  A+ FC E+  +L+ + N   N  ++ ++   ++  YW+ GND   EG+W+DS    L F  W  G+ N  + +NC+ G    +  W DV+C ++N    E +++
Sbjct:    7 FPVQNVEFGYHLNKERMNYNSAINYCKMQKMDMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNV------EFGYHLNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPC-TMSYAVICEKTKQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNVEFG-----------YHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVI---CEKTIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKF--PIIKTD--YGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGE-PNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKK----SQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEK 861          

HSP 5 Score: 556.984 bits (1434), Expect = 4.601e-173
Identity = 300/800 (37.50%), Postives = 451/800 (56.38%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEK--EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            ++ E+C+HGL+YPN LWND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ NDI  EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K  Q         LN+      EK  Y +AI +CK +  +++ I D  +N  V+++AV+Y +G+YWI+ ND   EG+++ S    + Y+ +  GEP   Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T  N E    + KER+ Y  A + CK Q  ++V I D   N  V++ AV+ N+G+YWI+ ND+  EG + DS  N +++  W +GEPN  + E+C+HGL+Y N LWNDI C    AVIC K I +  F           + +E++ +  A   C     E++ I +  IN  ++D A+K N+G YWI+ ND   E  ++ S +  + Y+ W  GEP+    E+C+ GL+Y NGLWNDI C++ N+VIC K  +     IK    Y V+   +TY  A++FC + N  ++ I N   NK ++  +   KIG +WI+GND   EG WVDSK N + Y NW   EPN    E+C+ G +YP G WNDISC T N +I +      +  E    I +  ++Y  A++ C  K   L+ I+NE+INK ++++A    +G YWI  ND + EG ++ S   ++ ++ +  GEPN   NE+C+HGL Y N  WND++C   N V+C
Sbjct:   97 KRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQ--NVEFGYHLNK------EKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKG-QRQENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYH--------LNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPI-----IKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC 856          

HSP 6 Score: 473.396 bits (1217), Expect = 1.682e-142
Identity = 259/696 (37.21%), Postives = 387/696 (55.60%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEI--SNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEY--ESTAEKEITIEIME 2070
            Q+ E+C+HGL+YPN LWND  C    AVIC K T+  +     L        +EK  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ ND  +EG++       ++Y  +  GEP   R E+C+HG+FY +G WNDI C  + +VIC K  Q         LN+      E+  Y +A+ +CK +  +++ I D  +N  V+++AV+Y +G+YWI+ NDM  EGN++ S    + Y+ +  GEPN  Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T+ N E    + KER+ Y  A + C  Q  ++V I +   N  V++ A++ N+G+YWI+ ND   EG + DS  N +++  W +GEP+  + E+C+ GL+Y N LWNDI C   NAVIC          KF I  ++   V+  +K+ +  A   CK    ELL I +  +N  +++ A+K+ IG YWID ND   E  +V S    + Y+ W  GEPN    E+CVHGLYY  GLWNDI C+  N+VIC K    S      +  Y + +  + Y+ A+ FC + N R++ I N + NK I+  +    +G +WI GND   EG WVDS+   L +  W + EPN   NE+C+ G  Y N  WND++C  +N +I E   +S A+ EI    +E
Sbjct:  218 QRRENCIHGLFYPNGLWNDIPCTMSYAVICEK-TKQNVEFGYHLN-------KEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQ--NVEFGYHLNK------ERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNG-QRRENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVIC---------LKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFV---EYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEICKSFLE 874          

HSP 7 Score: 189.504 bits (480), Expect = 3.489e-48
Identity = 112/367 (30.52%), Postives = 193/367 (52.59%), Query Frame = 1
Query: 2830 KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPD--GKWRDVSCDDKNPFFFEFIDE 3924
            +E++T++ A   C+ +  +LV IDNE TN+ ++DL+++  I  YWI+ ND   EG +VDSNN+ L Y+ +   EP+    E+C+  L Y++GFWND+ C+  NS IC     P+        Y I  +++ + +AV+ C+     LI +EN   + IV  L  +    +YW++G D+  +G W  +D +++++KNW     P   +  NC+     ++G W   +C S   VIC +P +  +  +    + +Y     +    A +FC  R  +++ +DN   N      + K ++  +W++G D  NEG W+D   +KL++ NW + K +  K +NC+    D  G W D  C   N    E I++
Sbjct:  963 REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE----PMRHTTN--KYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKE-PQGYKKENCI-QGLRINGLWNDVTCDSLGEVIC-QPIQ--NKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICEPIND 1318          
BLAST of Mannose-binding protein C vs. Planmine SMEST
Match: SMESG000053708.1 (SMESG000053708.1)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 418/1310 (31.91%), Postives = 679/1310 (51.83%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIF---KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFEF 3915
            Q+ E+C+HGL+YPN LWND  C    AVIC K T+  +     L        +E+  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ ND+  EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K  Q         LN+E      +  Y +A+ +C  +  +++ I +  +N  V+++A+++ +G+YWI+ ND   EG ++ S    + Y+ +  GEP+  Q+ E+C+ GL+YSN LWNDI C  SNAVIC K   I+        +   V+  +++TY +A   CK Q  +L+ I +   N  V+N A++  IG YWID ND  +EG + DS  N +++  W +GEPN  + E+CVHGLYY   LWNDI C   N VIC K+     F ++       +I +E + +  A   C      LL I +++IN  I++ AV +N+GTYWI  ND   E ++V S +  + ++KWY GEPN   NE+C+HGL Y N  WND+ C  +N VIC             ++     E+  ++ E    C  +N +I KI      +I  ++ ++M   +        +T  K +D+  +K  Y        + Y +   L   +     W +    T   ++ + + T E          K+ Y  A++ C ++  +L+ I+NE  NK+V+D++ +  +  YWIN ND+  EG ++ S+   +SY N+ + EP+    E+C+  L Y +G WND+ C+  NSV+C +P            +  T+KY +   R+ + +A+ +C+  +  L+ IEN   + +++ L +K     YW++GND  +EG W+N D  ++ Y NW+  EP  Y  E+C+ G    NG WND +C +    I   I+N        +F    E++    A+  C  +   +V+IDN   N      A+K+ +  +WID  D A EG +VD  +  L Y  +   +P+    E+CV     +NG W+D  C S NS IC     PI   D    + I   K+ +  AV  C+ +   L+K++   ++  V+ LS+ + L  YWI+G D++ +G+W  S    L+FK W   S P   +N NC+  +      W    C S NSVIC    + I  G     +KY++      +++ + +CK ++  L+ + +   N ++++L+ K  +  +W+NGND  NEG W+D+D + LT+ NW   + N  K +NC+QG    DG W +V CD KN    E 
Sbjct:  306 QRQENCIHGLFYPNGLWNDIPCTMSYAVICEK-TKQNVEFGYHLN-------KERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQ--NVEFGYHLNKE------RMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSG-QRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKT-------DYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEYGY-----LITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEP----------MEKSPADPEICKSFLE---LC--YNSKIRKIC-----QITCKFWQSMTTKKI------SVTTSKSLDNISDKEFY--------DKYCSVRFLANLYQKICGWMEKEMTTVAPVVQKLKDTVE--FGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC-EPM-----------RHTTNKYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYKKENCIQG-LRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICE----PIN--DMKNGFHITSVKMKFDTAVKYCRDKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWH-KSEPKGGQNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYGP----SKYHMSESKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNEALTYLNWNIRQPNGGKKENCIQGLYFSDGTWNNVKCDMKNKVICEL 1522          

HSP 2 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 327/872 (37.50%), Postives = 499/872 (57.22%), Query Frame = 1
Query:  211 NLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL 2820
            +++ I D   N QV+++A++Y+ G++WI+ ND   EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K  Q         LN+E      K  Y +AI +CK +  +++ I+D  +N  V+++AV+Y +G+YWI+ ND+  EGN++ S    + Y+ +  GEPN  Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T  N E    + KE++ Y  A + CK Q  ++V I D   N  V++ AV+ N+G+YWI+ ND  IEG++ DS  N +++  W +GEP   + E+C+HGL+Y N LWNDI C    AVIC K   +  F           + +E++ +  A   CK    E++ I    IN  ++D AVK+N+G YWI+ ND+  E  ++ S +  + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K I N       +  Y++++  + Y  A+N+CN  N  +V I N   NK +++ +    +G++WINGND   EGKW+DS+ N L Y NW   EP+    E+C++G FY NG WNDI C   N +I       + +    +   K+ Y +A+  CK +  +L+ I N  +NK V+++A K K+G YWI+ ND  +EG ++ S    + Y+N+  GEPN +  E+CVHGL+Y  GLWNDISCN+ N+V+C K         K++ +     Y +    + Y+ A++FC   + RL+TI+N +++  I N+A  + +  YW+ GND  KEG WV+     L++  W QGEPN   NE+C+ G  + N  WND +C  +N  I   +E   +  E+
Sbjct:    5 DMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQ--NVEFGYHLNKE------KMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNG-QRRENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TKQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNVEFGYH--------LNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNV------EFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQK--------SKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEI 835          

HSP 3 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 312/867 (35.99%), Postives = 477/867 (55.02%), Query Frame = 1
Query:  979 QGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKT 3579
            Q   +V I+D   N  V++ AV+ N+G+YWI+ ND   EG + DS KN +++  W +GEPN  + E+C+HGL+Y N LWNDI C    AVIC K I +  F           + +EK+ +  A   CK    E++ I+   IN  ++D AVK+N+G YWI+ NDI  E  ++ S +  + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K   N       +  Y++++  + Y  AIN+C      +V IS+   NK +++ +    +G++WINGND   EG W+DS+ N L Y NW   EP     E+C+ G FYPNG WNDI C T +Y +   ++    E    + + ++NY  A+  CK +  +++ I +  INK V+D+A K  +GQYWIN ND+  EG ++ S    + Y+N+  GEPN Q  E+C+HGLFY NGLWNDI C    +V+C K  +  +             Y ++  R+ Y  A+ +C   +  +V I N+ ++  + ++A K  +  YW++GND  KEG+W++   N L+Y NW  GEP+    E+C+ G +++NG WND  C+  N+ I      I +     +  +++T+  A + C ++   L+ I N   N+ ++++A+K KIG YWID ND  +EG +VDS  + ++Y  +  GEPN    E+CVHGLYY  G WNDI+CN+ N+ IC K      F++    Y I    + Y  AV  C  +   L+ ++N  I+  +  +++ Y L  YWI G D   +G W  S    L FK W     P+   N NC++     +  W   +C  +N VIC +P +      E+ K+
Sbjct:    2 QKMDMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYH--------LNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNV------EFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPC-TMSYAVICEKTKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFG-----------YHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVE--YGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGE-PNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC-EPMEKSPADPEICKS 838          

HSP 4 Score: 572.392 bits (1474), Expect = 3.837e-179
Identity = 304/854 (35.60%), Postives = 476/854 (55.74%), Query Frame = 1
Query: 1375 ELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFXXXXXXXXXXGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGNEDCLLGNYFANGKWNDFSCSTKNSFIYYYIENIISTKEL--EIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSCDDKNPFFFEFIDE 3924
            +++ I+   IN  ++D AVK+N+G YWI+ ND   E  ++ S    + Y+ W  GEPN    E+C+HGL+Y NGLWNDI C    +VIC K I N       +  Y++++  + Y  AIN+C      +V I++   NK +++ +    +G++WINGNDI  EG W+DS+ N L Y NW   EPN    E+C+ G FYPNG WNDI C T +Y +   ++    E    + + K+NY  A+  CK +  +++ I +  INK V+D+A K  +GQYWIN ND  +EG ++ S    + Y+N+  GEP  Q  E+C+HGLFY NGLWNDI C    +V+C K  +  +             Y ++  R+ Y  A+ +C+     +VTI ++ ++  + ++A K+ +  YW++GND+ KEG W++   N L+Y NW  GEPN    E+C+ G ++ NG WND  C+   + I    E  I   E    + KER+ +  A N C  +   +V I N   N+ ++D+A+K  +GQYWI+ ND A EGK++DS N+ L+Y  +  GEP+    E+C+ GL+YSNG WNDI CN  N+ IC K+  PII  D    Y + + K+TY  AV  C+ +   L+ + N  ++  V  ++++YK+  YWIDG D+  +G W  S    + +KNW++   P+ K   NC++     +G W   SC + N+VIC K  K      +  +  Y I    + +  A+ FC E+  +L+ + N   N  ++ ++   ++  YW+ GND   EG+W+DS    L F  W  G+ N  + +NC+ G    +  W DV+C ++N    E +++
Sbjct:    5 DMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNV------EFGYHLNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPC-TMSYAVICEKTKQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNVEFG-----------YHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVI---CEKTIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKF--PIIKTD--YGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGE-PNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKK----SQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEK 828          

HSP 5 Score: 556.984 bits (1434), Expect = 2.192e-173
Identity = 300/800 (37.50%), Postives = 451/800 (56.38%), Query Frame = 1
Query:    1 QKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISAEIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRNEDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHVIKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYKESKIEVLKKITVLNKELV--IFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQNEDCVHGLYYKNALWNDIKCEDLNAVICYKNIGSRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYENEDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNSNETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNVETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNYNNEDCLEGNFYPNGEWNDISCKTKNYLIYEYESTAEK--EITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNNQNNEDCVHGLFYTNGLWNDISCNSINSVLC 2388
            ++ E+C+HGL+YPN LWND  C    AVIC K  +      +E       + +EK  +  A   C+ +   ++ I D   N QV+++A++Y+ G++WI+ NDI  EG +       ++Y  +  GEPN  R E+C+HG+FY +G WNDI C  + +VIC K  Q         LN+      EK  Y +AI +CK +  +++ I D  +N  V+++AV+Y +G+YWI+ ND   EG+++ S    + Y+ +  GEP   Q+ E+C+HGL+Y N LWNDI C  S AVIC K          T  N E    + KER+ Y  A + CK Q  ++V I D   N  V++ AV+ N+G+YWI+ ND+  EG + DS  N +++  W +GEPN  + E+C+HGL+Y N LWNDI C    AVIC K I +  F           + +E++ +  A   C     E++ I +  IN  ++D A+K N+G YWI+ ND   E  ++ S +  + Y+ W  GEP+    E+C+ GL+Y NGLWNDI C++ N+VIC K  +     IK    Y V+   +TY  A++FC + N  ++ I N   NK ++  +   KIG +WI+GND   EG WVDSK N + Y NW   EPN    E+C+ G +YP G WNDISC T N +I +      +  E    I +  ++Y  A++ C  K   L+ I+NE+INK ++++A    +G YWI  ND + EG ++ S   ++ ++ +  GEPN   NE+C+HGL Y N  WND++C   N V+C
Sbjct:   64 KRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQ-----NVEFGYH---LNKEKMNYNSAINYCKMQKMEMVTINDATINKQVFDIAVKYNLGQYWINGNDIAKEGNWLDSRNNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQ--NVEFGYHLNK------EKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKG-QRQENCIHGLFYPNGLWNDIPCTMSYAVICEK----------TKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYH--------LNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPI-----IKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVIC 823          

HSP 6 Score: 189.119 bits (479), Expect = 3.966e-48
Identity = 112/367 (30.52%), Postives = 193/367 (52.59%), Query Frame = 1
Query: 2830 KERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGNEDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPIIFIDEHMSYKIFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTASLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKPSKTIDTGKEVKKTKYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQGNPD--GKWRDVSCDDKNPFFFEFIDE 3924
            +E++T++ A   C+ +  +LV IDNE TN+ ++DL+++  I  YWI+ ND   EG +VDSNN+ L Y+ +   EP+    E+C+  L Y++GFWND+ C+  NS IC     P+        Y I  +++ + +AV+ C+     LI +EN   + IV  L  +    +YW++G D+  +G W  +D +++++KNW     P   +  NC+     ++G W   +C S   VIC +P +  +  +    + +Y     +    A +FC  R  +++ +DN   N      + K ++  +W++G D  NEG W+D   +KL++ NW + K +  K +NC+    D  G W D  C   N    E I++
Sbjct:  930 REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE----PMRHTTN--KYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKE-PQGYKKENCI-QGLRINGLWNDVTCDSLGEVIC-QPIQ--NKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICEPIND 1285          

HSP 7 Score: 63.1586 bits (152), Expect = 1.515e-9
Identity = 27/84 (32.14%), Postives = 53/84 (63.10%), Query Frame = 1
Query: 3640 RRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVNIQKTQNCLQG--NPDGKWRDVSC 3885
            ++  ++ +++   N  +++++ K ++ +YW+NGND   EG W+DS K  L + NW +G+ N ++ +NC+ G   P+G W D+ C
Sbjct:    2 QKMDMVTINDATINKQVFDIAVKYNLGQYWINGNDFVKEGNWLDSRKNPLQYKNWKSGEPNGKRQENCIHGLFYPNGLWNDIPC 85          
The following BLAST results are available for this feature:
BLAST of Mannose-binding protein C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRC11.875e-5622.60mannose receptor C-type 1 [Source:HGNC Symbol;Acc:... [more]
MRC21.640e-3219.66mannose receptor C type 2 [Source:HGNC Symbol;Acc:... [more]
LY75-CD3023.141e-1520.79LY75-CD302 readthrough [Source:HGNC Symbol;Acc:HGN... [more]
MBL23.967e-1537.93mannose binding lectin 2 [Source:HGNC Symbol;Acc:H... [more]
PLA2R11.268e-1419.79phospholipase A2 receptor 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Mannose-binding protein C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clec-1873.690e-822.01C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9XUA7... [more]
clec-515.368e-821.40C-type LECtin [Source:UniProtKB/TrEMBL;Acc:W6RTE8... [more]
clec-44.343e-724.81C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9NAK5... [more]
clec-505.266e-722.37C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q9XUL7... [more]
clec-535.539e-721.48C-type LECtin [Source:UniProtKB/TrEMBL;Acc:P91429... [more]
back to top
BLAST of Mannose-binding protein C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG153581.549e-831.19gene:FBgn0031373 transcript:FBtr0473589[more]
CG153581.549e-831.19gene:FBgn0031373 transcript:FBtr0473590[more]
tfc1.991e-731.90gene:FBgn0035199 transcript:FBtr0072661[more]
tfc1.991e-731.90gene:FBgn0035199 transcript:FBtr0072660[more]
tfc3.778e-733.93gene:FBgn0035199 transcript:FBtr0072659[more]
back to top
BLAST of Mannose-binding protein C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1a3.816e-6123.01mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-G... [more]
mrc1b1.397e-4020.83mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
mrc23.548e-3920.74mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
mrc24.653e-3920.82mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
si:dkey-11o15.71.767e-3721.46si:dkey-11o15.7 [Source:ZFIN;Acc:ZDB-GENE-091204-3... [more]
back to top
BLAST of Mannose-binding protein C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orc32.132e-4720.40origin recognition complex subunit 3 [Source:Xenba... [more]
orc31.905e-4620.65origin recognition complex subunit 3 [Source:Xenba... [more]
orc35.276e-4421.50origin recognition complex subunit 3 [Source:Xenba... [more]
orc31.566e-4321.49origin recognition complex subunit 3 [Source:Xenba... [more]
orc37.971e-4320.35origin recognition complex subunit 3 [Source:Xenba... [more]
back to top
BLAST of Mannose-binding protein C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mrc13.704e-5421.81mannose receptor, C type 1 [Source:MGI Symbol;Acc:... [more]
Mrc21.920e-3119.56mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Mrc21.239e-2321.22mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Ly755.708e-1820.31lymphocyte antigen 75 [Source:MGI Symbol;Acc:MGI:1... [more]
Ly756.589e-1820.29lymphocyte antigen 75 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Mannose-binding protein C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22897|MRC1_HUMAN9.004e-5622.60Macrophage mannose receptor 1 OS=Homo sapiens OX=9... [more]
sp|Q61830|MRC1_MOUSE2.591e-5321.81Macrophage mannose receptor 1 OS=Mus musculus OX=1... [more]
sp|Q4TU93|MRC2_RAT5.375e-3419.96C-type mannose receptor 2 OS=Rattus norvegicus OX=... [more]
sp|Q9UBG0|MRC2_HUMAN7.876e-3219.66C-type mannose receptor 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q64449|MRC2_MOUSE1.343e-3019.56C-type mannose receptor 2 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Mannose-binding protein C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8WSX23.044e-17331.10Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN... [more]
Q8WSX13.322e-10932.32Lectin 2a OS=Girardia tigrina OX=6162 GN=lec2a PE=... [more]
Q8WSW91.300e-10732.49Lectin 2c OS=Girardia tigrina OX=6162 GN=lec2c PE=... [more]
Q8WSX01.130e-10432.28Lectin 2b OS=Girardia tigrina OX=6162 GN=lec2b PE=... [more]
A0A2U9CI733.652e-7522.68Putative macrophage mannose receptor 1-like OS=Sco... [more]
back to top
BLAST of Mannose-binding protein C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1a2.242e-5322.08mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1a4.457e-5021.59mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000045912.14.446e-4623.99macrophage mannose receptor 1-like [Source:NCBI ge... [more]
mrc1b2.077e-4221.23mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
mrc1b3.074e-4221.23mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Mannose-binding protein C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5