SMED30015520

Overview
NameSMED30015520
Smed IDSMED30015520
Length (bp)869
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015520 (SMED30015520) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015520 (SMED30015520) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015520 (SMED30015520) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015520 (SMED30015520) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015520

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015520SMESG000047158.1 SmedASXL_010121SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30015520SMESG000047158.1 dd_Smed_v4_22739_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015520 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000745:66254..67867 +4242
Homology
BLAST of SMED30015520 vs. Ensembl Zebrafish
Match: tceanc2 (transcription elongation factor A (SII) N-terminal and central domain containing 2 [Source:NCBI gene;Acc:567698])

HSP 1 Score: 52.7582 bits (125), Expect = 7.872e-8
Identity = 47/198 (23.74%), Postives = 95/198 (47.98%), Query Frame = 3
Query:  162 KQVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYY-RHTIDDMYRANVRAACRIIENLSPEFYKRSNPLEIPTEIWVQ 752
            KQ T+ESL+  +  +DI+   S+ +        +   +++  +K+P++ +L++T I + + NL     D E++ LA  +   WR+    I+    K  I+V CD +T  +R  AK          L+ ++E+  + E      L E +E+ +++     +   YR  VRA    +++  PE   +    ++P  ++V+
Sbjct:   25 KQATLESLRRVVVIEDIERYKSILELPGQPKENMIEALKELDKKVPSREVLKSTRIGHTVNNLRKHSDDPEIKSLAKEVYKHWRT---FIEEHANKPSIEVRCDKQTESLRSNAK--------KLLSEAIEMKVDHE------LVENIEREVFHQSSRLVSGAYRRTVRALVFALKH-KPELRVQVKDGKLPVNVFVK 204          
BLAST of SMED30015520 vs. UniProt/SwissProt
Match: sp|B0UYI1|TEAN2_DANRE (Transcription elongation factor A N-terminal and central domain-containing protein 2 OS=Danio rerio OX=7955 GN=tceanc2 PE=3 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 5.943e-7
Identity = 47/198 (23.74%), Postives = 95/198 (47.98%), Query Frame = 3
Query:  162 KQVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYY-RHTIDDMYRANVRAACRIIENLSPEFYKRSNPLEIPTEIWVQ 752
            KQ T+ESL+  +  +DI+   S+ +        +   +++  +K+P++ +L++T I + + NL     D E++ LA  +   WR+    I+    K  I+V CD +T  +R  AK          L+ ++E+  + E      L E +E+ +++     +   YR  VRA    +++  PE   +    ++P  ++V+
Sbjct:   25 KQATLESLRRVVVIEDIERYKSILELPGQPKENMIEALKELDKKVPSREVLKSTRIGHTVNNLRKHSDDPEIKSLAKEVYKHWRT---FIEEHANKPSIEVRCDKQTESLRSNAK--------KLLSEAIEMKVDHE------LVENIEREVFHQSSRLVSGAYRRTVRALVFALKH-KPELRVQVKDGKLPVNVFVK 204          
BLAST of SMED30015520 vs. TrEMBL
Match: A0A210QGJ3 (Transcription elongation factor A N-terminal and central domain-containing protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08793 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.670e-8
Identity = 48/172 (27.91%), Postives = 92/172 (53.49%), Query Frame = 3
Query:  162 KQVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIE---KFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYY-YRHTIDDMYRANVR 665
            KQ TIESLKG +  +DI     +   L+ N+   + ++E   +  +K+P ++++++T I  ++  L   H+DS +R+ A  +  KW+SH+E ++    +  I+V CD RT R+R   +  L+ SL              ED+    L E++E+  ++ ++  +++ YR  +R
Sbjct:   25 KQSTIESLKGVVVIEDIHR---IQAKLRLNSTTQEEMVECLRELGKKIPPRNVMKDTKIGKVVNKLRQ-HEDSVIRKEAKKVYIKWKSHFENLQD---RQQIEVKCDARTERLRSSGQRLLSESLG-------------EDN---TLPEVIERDTFHLFKRMVNNNYRRTIR 173          
BLAST of SMED30015520 vs. TrEMBL
Match: A0A3B3SFB3 (Transcription elongation factor A (SII) N-terminal and central domain containing 2 OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.974e-8
Identity = 44/151 (29.14%), Postives = 82/151 (54.30%), Query Frame = 3
Query:   81 LDKFVVKRDIXXXXXXXXXXXXXXXIKKQVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNV 533
            +DKFVVK        L         I +QVTIESL+  +  +DI+   S+ +        + T +++  +K+P+K +L +T I + +  +   H D++VRRLAG + + WRS   +++ +  +  I+V CD ++  +R+ A+  LA ++ +
Sbjct:    1 MDKFVVK---LPKGELKKESKSEGKIYRQVTIESLRRVVVIEDIERFKSMLELPGQTKENIMTALKELGKKIPSKEVLRSTKIGHTVNKMRK-HTDTDVRRLAGQVYTMWRS---SVEENSSRPSIEVRCDRQSEGLRQNARKLLAEAMGL 144          
BLAST of SMED30015520 vs. TrEMBL
Match: A0A0K8RVN9 (Transcription elongation factor A N-terminal and central domain-containing protein 2-like OS=Crotalus horridus OX=35024 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.047e-7
Identity = 69/231 (29.87%), Postives = 113/231 (48.92%), Query Frame = 3
Query:   81 LDKFVVKRDIXXXXXXXXXXXXXXXIKKQVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIEKFIE---KLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYY-RHTIDDMYRANVRAACRIIENLSPEFYKRSNPLEIPTEIWVQFRK 761
            +DKFVV+      +  ++     K I KQ TIESLK  +  +D+    S+   L+ +    + +IE  +E   K+P+K IL +T I + +  +   H D +V  LA  + ++WRS    IK    + +I+V C+ RT  +R+ A+  LA +L V            E   L  LAE +EQ  +Y   H ++  YR  VRA    +++ +PE   +     +P ++ VQ  K
Sbjct:    2 MDKFVVR--TPRTKGETTKSNPGKKIYKQATIESLKRVVVVEDLKRWKSV---LELSIQPKENLIEALMELRKKIPSKEILLSTKIGHTVNKMRK-HPDQDVATLAKEVYTEWRSF---IKNQSNRPLIEVRCNPRTESLRQNARKLLAEALEV------------EIGHL--LAENIEQEAFYLSSHLVNTSYRRTVRALVFSLKH-NPETRAQVQNGVLPVKMLVQSHK 208          
BLAST of SMED30015520 vs. TrEMBL
Match: A0A5A9PAN3 (Transcription elongation factor A N-terminal and central domain-containing protein 2 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti007664 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.582e-7
Identity = 46/170 (27.06%), Postives = 86/170 (50.59%), Query Frame = 3
Query:  162 KQVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYY-RHTIDDMYRANVRA 668
            KQ T+ESL+  +  +DI+   S+ +        +   + +  +K+P+K +L+ T I + + NL  + +D+EV+ LAG + + WR+    I+    K  I+V CD +T  +R  A+  L+ +L + +          ED  +EN    +E+ +++     +   YR  VRA
Sbjct:   25 KQATLESLRRVVVIEDIERYKSILELPGQTKENILEALRELDKKVPSKEVLKTTKIGHTVNNLRKYSEDAEVKSLAGEVYTHWRTF---IEEHANKPSIEVRCDKQTEGLRSNARKLLSEALELKM----------EDGLVEN----IEREVFHQSSRLVSGAYRRTVRA 177          
BLAST of SMED30015520 vs. TrEMBL
Match: R7UMP4 (TFIIS N-terminal domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_4346 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.689e-7
Identity = 48/169 (28.40%), Postives = 82/169 (48.52%), Query Frame = 3
Query:  165 QVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYY-RHTIDDMYRANVRA 668
            Q TI SLKG +  +D+    ++ +     T  L   + +  EK+P + IL+ T I + I+ L+  H D  V  LA  +  +W+ H++       + +I+V CD +T  +R  A+  L  +          LD+N E S +  L+EI E+  +   ++ +   YR  VRA
Sbjct:   28 QTTIRSLKGVVVIEDVQRLKAILRLPSQPTEVLLRALNEAREKIPPRHILQETKIGHTIKRLTK-HDDEAVATLAAEIVKEWKQHFQ---EKLNRPLIEVRCDKKTEELRSTARRHLRKA----------LDSNAEGSYIRKLSEICEREAFRQNKNLVSKNYRRTVRA 182          
BLAST of SMED30015520 vs. Ensembl Cavefish
Match: tceanc2 (transcription elongation factor A N-terminal and central domain containing 2 [Source:NCBI gene;Acc:103028486])

HSP 1 Score: 52.7582 bits (125), Expect = 6.380e-8
Identity = 48/173 (27.75%), Postives = 88/173 (50.87%), Query Frame = 3
Query:  156 IKKQVTIESLKGFINAKDIDNGLSLFKDLKANTFR-LQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYY-RHTIDDMYRANVRA 668
            + +Q T+ESLK  +  +DI+   ++  +L A T   +   + +  +K+P+K +L +T I + + N+   H D+EV+ LA  + + WR+    I+ +  K  I+V  D +T  +R  A   LA S+             PE S  + L E +E+ +++     I+ +YR  +RA
Sbjct:   25 VYRQATVESLKRVVVIEDIERFKAML-ELPAQTKENMLMALMELDKKVPSKEVLRSTRIGHTVNNVRKQHPDAEVKALAREVYTHWRTF---IEENANKPSIEVRSDKQTEGLRSNAVKLLAESI------------GPEVS--DGLVENMEREVFHQSSRLINVVYRRTIRA 179          
BLAST of SMED30015520 vs. Ensembl Nematostella
Match: EDO32756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU38])

HSP 1 Score: 51.2174 bits (121), Expect = 9.185e-8
Identity = 49/171 (28.65%), Postives = 86/171 (50.29%), Query Frame = 3
Query:  162 KQVTIESLKGFINAKDIDN-GLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYY-YRHTIDDMYRANVRA 668
            KQVTIESL   +  +D+    L L  DL +    + + +++   K P+K++L +T I + I +L   H   +V +LA  +  KW+ H+  ++ + +K  IDV CDL+T  +R +A+  L  +L                 E   L+E +E+ +++     ID+ YR  +R 
Sbjct:   26 KQVTIESLPKVVVVEDVKRLKLQLESDL-STPEDILSALQELKAKTPSKAVLLSTQIGHTINSLRK-HTCQDVCQLAKEIFRKWK-HF-IVEEEKEKPAIDVKCDLKTETMRNKAREFLVKALQ---------------DEEGKLSEQIERTVFFNSNRKIDNFYRRKMRT 177          
BLAST of SMED30015520 vs. Ensembl Medaka
Match: tceanc2 (transcription elongation factor A N-terminal and central domain containing 2 [Source:NCBI gene;Acc:101170660])

HSP 1 Score: 55.8398 bits (133), Expect = 6.221e-9
Identity = 52/173 (30.06%), Postives = 85/173 (49.13%), Query Frame = 3
Query:  162 KQVTIESLKGFINAKDI---DNGLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYY-RHTIDDMYRANVRA 668
            +Q TIESL+  +  +DI      L L    K N   L TV+ +  +K+P++ +L +T I +++  L   HQD EV   A  L S WR+    I+ +  K  I+V  D ++  +R  A+  L+A+L V            EDS    L++ +E+ +++     +   YR  VRA
Sbjct:   30 RQTTIESLRRVVVVEDIMRYKATLELPAQTKEN---LLTVLTELSKKMPSREVLRSTRIGHVVNRLRR-HQDPEVSSAAARLYSDWRTF---IQENSNKPCIEVRSDRQSEGLRSSARRLLSAALQVQ-----------EDS---GLSDSIEREVFHQGSRLVSASYRRTVRA 181          
BLAST of SMED30015520 vs. Ensembl Medaka
Match: tceanc2 (transcription elongation factor A N-terminal and central domain containing 2 [Source:NCBI gene;Acc:101170660])

HSP 1 Score: 55.0694 bits (131), Expect = 1.397e-8
Identity = 49/172 (28.49%), Postives = 82/172 (47.67%), Query Frame = 3
Query:  162 KQVTIESLKGFINAKDI---DNGLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLT-------CSVELDTNPEDSELENLAEILEQPIYYYRHTIDDM 647
            +Q TIESL+  +  +DI      L L    K N   L TV+ +  +K+P++ +L +T I +++  L   HQD EV   A  L S WR+    I+ +  K  I+V  D ++  +R  A+  L+A+L V +        CS  +     +  + N+A  +  P+   R  +  M
Sbjct:   25 RQTTIESLRRVVVVEDIMRYKATLELPAQTKEN---LLTVLTELSKKMPSREVLRSTRIGHVVNRLRR-HQDPEVSSAAARLYSDWRTF---IQENSNKPCIEVRSDRQSEGLRSSARRLLSAALQVQVGGAADAAECSPAMRIPVTEMRIPNMA--MRIPVTAMRIPVTAM 187          
BLAST of SMED30015520 vs. Planmine SMEST
Match: SMESG000047158.1 (SMESG000047158.1)

HSP 1 Score: 461.84 bits (1187), Expect = 1.757e-166
Identity = 245/246 (99.59%), Postives = 245/246 (99.59%), Query Frame = 3
Query:   54 MPSFKRQTKLDKFVVKRDIXXXXXXXXXXXXXXXIKKQVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYYRHTIDDMYRANVRAACRIIENLSPEFYKRSNPLEIPTEIWVQFRKDNLISEKWNI 791
            MPSFKRQTKLDKFVVKRDISSYQSLSSSFLRSKSIKKQVTIESLKGFINAKDIDNGLSLFKD KANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYYRHTIDDMYRANVRAACRIIENLSPEFYKRSNPLEIPTEIWVQFRKDNLISEKWNI
Sbjct:    1 MPSFKRQTKLDKFVVKRDISSYQSLSSSFLRSKSIKKQVTIESLKGFINAKDIDNGLSLFKDPKANTFRLQTVIEKFIEKLPTKSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKLIIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEILEQPIYYYRHTIDDMYRANVRAACRIIENLSPEFYKRSNPLEIPTEIWVQFRKDNLISEKWNI 246          
The following BLAST results are available for this feature:
BLAST of SMED30015520 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015520 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015520 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015520 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tceanc27.872e-823.74transcription elongation factor A (SII) N-terminal... [more]
back to top
BLAST of SMED30015520 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015520 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015520 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|B0UYI1|TEAN2_DANRE5.943e-723.74Transcription elongation factor A N-terminal and c... [more]
back to top
BLAST of SMED30015520 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QGJ31.670e-827.91Transcription elongation factor A N-terminal and c... [more]
A0A3B3SFB31.974e-829.14Transcription elongation factor A (SII) N-terminal... [more]
A0A0K8RVN91.047e-729.87Transcription elongation factor A N-terminal and c... [more]
A0A5A9PAN31.582e-727.06Transcription elongation factor A N-terminal and c... [more]
R7UMP41.689e-728.40TFIIS N-terminal domain-containing protein OS=Capi... [more]
back to top
BLAST of SMED30015520 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tceanc26.380e-827.75transcription elongation factor A N-terminal and c... [more]
back to top
BLAST of SMED30015520 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015520 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015520 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO327569.185e-828.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30015520 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tceanc26.221e-930.06transcription elongation factor A N-terminal and c... [more]
tceanc21.397e-828.49transcription elongation factor A N-terminal and c... [more]
back to top
BLAST of SMED30015520 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000047158.11.757e-16699.59SMESG000047158.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015520 ID=SMED30015520|Name=SMED30015520|organism=Schmidtea mediterranea sexual|type=transcript|length=869bp
AAAATCAAATCAAGGTTTTCATAATTAATTTAAATATCAAACGTTTGAAT
ATAATGCCATCATTTAAACGTCAAACTAAACTTGATAAATTTGTTGTAAA
AAGAGACATTTCATCTTACCAATCTCTTTCTTCTAGTTTTCTTAGAAGCA
AATCTATTAAAAAGCAAGTTACAATAGAATCTCTAAAGGGATTTATAAAC
GCCAAAGATATTGATAATGGACTGAGTCTTTTTAAAGATCTAAAAGCAAA
TACTTTTCGTTTACAAACGGTAATTGAAAAATTCATTGAAAAATTACCTA
CTAAGTCAATATTAGAAAATACTGATATATTAAATCTAATTGAGAACTTA
AGCAGCTTTCATCAAGATAGCGAGGTTAGACGTTTAGCTGGATTGTTGAA
CAGCAAATGGAGATCCCACTATGAGACAATAAAAACAGATTGTAAGAAAC
TTATCATCGATGTTGCTTGTGATTTAAGAACGACTCGAGTACGAAAAGAA
GCGAAAATCAGATTGGCGGCTTCATTAAATGTTTATTTAACTTGCTCTGT
TGAGTTAGACACGAATCCAGAAGATTCTGAACTGGAAAATTTAGCAGAAA
TTTTGGAGCAGCCAATTTATTACTATCGTCATACAATTGACGATATGTAT
AGAGCAAATGTTCGTGCTGCGTGTAGAATTATTGAAAATCTTTCACCTGA
GTTTTATAAACGCTCAAATCCTTTGGAAATACCCACTGAAATTTGGGTGC
AATTTCGAAAGGATAATTTAATATCTGAAAAATGGAATATTTGATGTGTA
GCTTTTGTTAATATTGTTTAATATATATTATTTATTTTTCTATAAAATTG
GAAATTTTCGTTAAAAAAA
back to top

protein sequence of SMED30015520-orf-1

>SMED30015520-orf-1 ID=SMED30015520-orf-1|Name=SMED30015520-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
NQIKVFIINLNIKRLNIMPSFKRQTKLDKFVVKRDISSYQSLSSSFLRSK
SIKKQVTIESLKGFINAKDIDNGLSLFKDLKANTFRLQTVIEKFIEKLPT
KSILENTDILNLIENLSSFHQDSEVRRLAGLLNSKWRSHYETIKTDCKKL
IIDVACDLRTTRVRKEAKIRLAASLNVYLTCSVELDTNPEDSELENLAEI
LEQPIYYYRHTIDDMYRANVRAACRIIENLSPEFYKRSNPLEIPTEIWVQ
FRKDNLISEKWNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035441TFIIS/LEDGF_dom_sf
IPR017923TFIIS_N
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003746translation elongation factor activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006414translational elongation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035441TFIIS/LEDGF domain superfamilySUPERFAMILYSSF47676Conserved domain common to transcription factors TFIIS, elongin A, CRSP70coord: 81..142