G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30015514
Length (bp)1191
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30015514) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30015514) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30015514) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30015514) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015514

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015514SMESG000042465.1 SmedASXL_005133SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015514SMESG000042465.1 dd_Smed_v6_29610_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30015514SMESG000042465.1 SMED30015514smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GPR4 (G protein-coupled receptor 4 [Source:HGNC Symbol;Acc:HGNC:4497])

HSP 1 Score: 58.5362 bits (140), Expect = 8.384e-9
Identity = 34/120 (28.33%), Postives = 60/120 (50.00%), Query Frame = 3
Query:  132 FVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIV 491
            F  S    +I +G+P NC++L+  YR    RN     ++ LSI D  +L    L  W+    ++D  I+    CK  GF+   +   ++  LC I+V+R++ V++P +   L  + T + 
Sbjct:   19 FPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLSIAD--LLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVA 136          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 51.9878 bits (123), Expect = 9.903e-7
Identity = 79/338 (23.37%), Postives = 142/338 (42.01%), Query Frame = 3
Query:  153 LLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAV--------LLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSK-SLVTIFTVIVGMIGFSFGVICKNICIIYL----YNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYI----YIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLK--AQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQRKTGKRFEA 1109
            L+ FL +  N +  +++ R+K     T   ++ L+I D  V        LL  ++  W           + N +CK  G +  IS   +V TL AIAV+RF  V YP K K ++ T F +I+ +   +  ++  +  ++++    Y  V +N       +  C+     W +    K+         Y  + F NIY+     I +   RI ++     +P   + N     +    V+ +K+  + IIK+L  ++L+  ++ LP      L   A L   +   ++  I      L F N+++N   Y F +  FR+ F +       +K  K  EA
Sbjct:   57 LIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWP----------FGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCR---EDWPNQEMRKI---------YTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN-----QEQWHVVSRKK--QKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEA 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 51.9878 bits (123), Expect = 1.145e-6
Identity = 79/338 (23.37%), Postives = 142/338 (42.01%), Query Frame = 3
Query:  153 LLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAV--------LLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSK-SLVTIFTVIVGMIGFSFGVICKNICIIYL----YNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYI----YIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLK--AQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQRKTGKRFEA 1109
            L+ FL +  N +  +++ R+K     T   ++ L+I D  V        LL  ++  W           + N +CK  G +  IS   +V TL AIAV+RF  V YP K K ++ T F +I+ +   +  ++  +  ++++    Y  V +N       +  C+     W +    K+         Y  + F NIY+     I +   RI ++     +P   + N     +    V+ +K+  + IIK+L  ++L+  ++ LP      L   A L   +   ++  I      L F N+++N   Y F +  FR+ F +       +K  K  EA
Sbjct:   54 LIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWP----------FGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCR---EDWPNQEMRKI---------YTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN-----QEQWHVVSRKK--QKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEA 362          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GPR68 (G protein-coupled receptor 68 [Source:HGNC Symbol;Acc:HGNC:4519])

HSP 1 Score: 51.2174 bits (121), Expect = 1.536e-6
Identity = 32/124 (25.81%), Postives = 60/124 (48.39%), Query Frame = 3
Query:   90 SEDNSPNT----NIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYP 449
            + DNS  +    + I +T        ++ +G P NC+SLY  Y     RN     +  L++ D  +     L +W++    +D   + +  C+  G L+  +   +VG LC I+V+R++ V++P
Sbjct:    5 TADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTVAD--LFYICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRYLAVAHP 126          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GPR68 (G protein-coupled receptor 68 [Source:HGNC Symbol;Acc:HGNC:4519])

HSP 1 Score: 51.2174 bits (121), Expect = 1.536e-6
Identity = 32/124 (25.81%), Postives = 60/124 (48.39%), Query Frame = 3
Query:   90 SEDNSPNT----NIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYP 449
            + DNS  +    + I +T        ++ +G P NC+SLY  Y     RN     +  L++ D  +     L +W++    +D   + +  C+  G L+  +   +VG LC I+V+R++ V++P
Sbjct:    5 TADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTVAD--LFYICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRYLAVAHP 126          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: AstA-R1 (gene:FBgn0266429 transcript:FBtr0333798)

HSP 1 Score: 48.1358 bits (113), Expect = 8.172e-6
Identity = 72/349 (20.63%), Postives = 143/349 (40.97%), Query Frame = 3
Query:   66 NFSILEKSSEDNSPNTNIIME-------------TFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICC 1073
            N++   + ++ +  N N  ME             T V  F  ++ F G+  N + + V+  ++  R+TT  L+I L++ D  +L       +    +      + N  CK   +++ ++   +V TL  ++ +RF+ V +P  S SL T     + ++     ++   I +   +++      GN  T      +   W   GF     L+  V P  ++ F    +Y+ +      L + +++ P  +            P    ++    + +++  + L  AI  LP  +   LKA L +     +  +IQ    ++ +TN+ IN   Y F S  FR+ F  V+ C
Sbjct:   41 NYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSD--ILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICF----LYMGM------LARLWKSAPGCK------------PSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKA-LNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: AstA-R1 (gene:FBgn0266429 transcript:FBtr0070575)

HSP 1 Score: 48.1358 bits (113), Expect = 8.172e-6
Identity = 72/349 (20.63%), Postives = 143/349 (40.97%), Query Frame = 3
Query:   66 NFSILEKSSEDNSPNTNIIME-------------TFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICC 1073
            N++   + ++ +  N N  ME             T V  F  ++ F G+  N + + V+  ++  R+TT  L+I L++ D  +L       +    +      + N  CK   +++ ++   +V TL  ++ +RF+ V +P  S SL T     + ++     ++   I +   +++      GN  T      +   W   GF     L+  V P  ++ F    +Y+ +      L + +++ P  +            P    ++    + +++  + L  AI  LP  +   LKA L +     +  +IQ    ++ +TN+ IN   Y F S  FR+ F  V+ C
Sbjct:   41 NYAFTSEHTDHSDHNANDSMEYDAESVALERIVSTIVPVFFGIIGFAGLLGNGLVILVVVANQQMRSTTNLLIINLAVSD--ILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRIYQYHGNAGTACVFSTEEEIWSLVGFQVSFFLSSYVAPLTLICF----LYMGM------LARLWKSAPGCK------------PSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKA-LNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gpr4 (G protein-coupled receptor 4 [Source:ZFIN;Acc:ZDB-GENE-101202-1])

HSP 1 Score: 55.8398 bits (133), Expect = 4.221e-8
Identity = 33/112 (29.46%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  120 IMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQK 455
            I + F  +   ++I LG P NC++L+  Y     +N     ++ LSI D  +L    L  WI    ++D  I+    CK  GF+   +   ++  LC I+V+R++ V++P K
Sbjct:   23 IDQFFQPTLYIIVIVLGFPTNCMALWAAYMQVKQKNELGIYLMNLSIAD--LLYITTLPLWIDYFVHHDNWIHGQVSCKLFGFIFYTNIYVSIAFLCCISVDRYLAVAHPLK 132          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: GPR68 (ovarian cancer G-protein coupled receptor 1-like [Source:NCBI gene;Acc:799203])

HSP 1 Score: 52.7582 bits (125), Expect = 3.700e-7
Identity = 45/185 (24.32%), Postives = 88/185 (47.57%), Query Frame = 3
Query:   87 SSEDNSPNTNIIMETFVKSFAALLIFL-GIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSL-----VTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSW 623
            S E  +   N  +  ++ S A LL+ L G+P N  SLY  +     RN     ++ L+I D  +L    L  W++  F  D    + ++C+  GFL+  +   ++G LC I+++R++ V YP +  +       T+ + +V +   + GV      + +L+    ++R  +NQ++      + +W
Sbjct:   12 SEEQINCTINHDIHQYLFSVAYLLVLLVGLPANAYSLYHAWLQLKARNELGVYLLNLTISD--LLYLGSLPLWLQYIFQGDNWSGSEWLCQLCGFLLYENIYVSIGFLCCISIDRYLAVVYPFRFSAFRTVRAATLVSTVVWLKELAVGV------VFFLHK--ELSRDKHNQSVCFEHYPMKTW 186          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: CU915819.2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 50.447 bits (119), Expect = 2.266e-6
Identity = 90/364 (24.73%), Postives = 155/364 (42.58%), Query Frame = 3
Query:   60 NGNFSILEKSSEDNSPNTNI-----------IMETFVKSFAALLIFL-GIPFNCISLYVLYRDKSNRNTTRFLMILLSICD--------NAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIG-FSFGVICKNICIIYLYNIVSIN--RGGNNQT-ILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIY------IYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNP--SMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNF 1055
            +GN++ +  SSE   P  NI           +   F+ S+  LLIFL  +  N +  +++ R K+ R  T   ++ L+I D           LL  ++  W           + + VCK  G +  IS   +V TL AIAV+RF  + YP K K  ++  T I+ +I   +  ++C +  ++ +    +I   RG N  +    C+    +W +    K+         Y  + F NIY      I I   +  I L KT   +P   +       +    V  KK+R   +IK+L  ++L+  ++ LP      L   +K+ ++    ++  I      L F N+++N   Y F +  FR+ F
Sbjct:   14 DGNWTFINGSSEFFLPLNNITYVGYYLHQPSVAAVFIVSY--LLIFLVCMIGNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWP----------FGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTATFIIVIIWVLAVSIMCPSGVMLQVTKEQNIRVFRGNNRSSPFYWCR---ENWPNQEMRKI---------YTTVLFANIYLAPLSLIVIMYARIGITLFKT--AMPAGGK----HGHDNRHSVSKKKQR---VIKMLLIVALLFILSWLPLWTLMMLTDYVKLTEHQYRVINIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGF 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: AL929374.1 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 50.447 bits (119), Expect = 2.266e-6
Identity = 90/364 (24.73%), Postives = 155/364 (42.58%), Query Frame = 3
Query:   60 NGNFSILEKSSEDNSPNTNI-----------IMETFVKSFAALLIFL-GIPFNCISLYVLYRDKSNRNTTRFLMILLSICD--------NAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIG-FSFGVICKNICIIYLYNIVSIN--RGGNNQT-ILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIY------IYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNP--SMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNF 1055
            +GN++ +  SSE   P  NI           +   F+ S+  LLIFL  +  N +  +++ R K+ R  T   ++ L+I D           LL  ++  W           + + VCK  G +  IS   +V TL AIAV+RF  + YP K K  ++  T I+ +I   +  ++C +  ++ +    +I   RG N  +    C+    +W +    K+         Y  + F NIY      I I   +  I L KT   +P   +       +    V  KK+R   +IK+L  ++L+  ++ LP      L   +K+ ++    ++  I      L F N+++N   Y F +  FR+ F
Sbjct:   14 DGNWTFINGSSEFFLPLNNITYVGYYLHQPSVAAVFIVSY--LLIFLVCMIGNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWP----------FGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTATFIIVIIWVLAVSIMCPSGVMLQVTKEQNIRVFRGNNRSSPFYWCR---ENWPNQEMRKI---------YTTVLFANIYLAPLSLIVIMYARIGITLFKT--AMPAGGK----HGHDNRHSVSKKKQR---VIKMLLIVALLFILSWLPLWTLMMLTDYVKLTEHQYRVINIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGF 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: NPFFR2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 50.447 bits (119), Expect = 2.266e-6
Identity = 90/364 (24.73%), Postives = 155/364 (42.58%), Query Frame = 3
Query:   60 NGNFSILEKSSEDNSPNTNI-----------IMETFVKSFAALLIFL-GIPFNCISLYVLYRDKSNRNTTRFLMILLSICD--------NAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIG-FSFGVICKNICIIYLYNIVSIN--RGGNNQT-ILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIY------IYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNP--SMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNF 1055
            +GN++ +  SSE   P  NI           +   F+ S+  LLIFL  +  N +  +++ R K+ R  T   ++ L+I D           LL  ++  W           + + VCK  G +  IS   +V TL AIAV+RF  + YP K K  ++  T I+ +I   +  ++C +  ++ +    +I   RG N  +    C+    +W +    K+         Y  + F NIY      I I   +  I L KT   +P   +       +    V  KK+R   +IK+L  ++L+  ++ LP      L   +K+ ++    ++  I      L F N+++N   Y F +  FR+ F
Sbjct:   14 DGNWTFINGSSEFFLPLNNITYVGYYLHQPSVAAVFIVSY--LLIFLVCMIGNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWP----------FGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTATFIIVIIWVLAVSIMCPSGVMLQVTKEQNIRVFRGNNRSSPFYWCR---ENWPNQEMRKI---------YTTVLFANIYLAPLSLIVIMYARIGITLFKT--AMPAGGK----HGHDNRHSVSKKKQR---VIKMLLIVALLFILSWLPLWTLMMLTDYVKLTEHQYRVINIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGF 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000032590.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:71853412:71854811:1 gene:ENSXETG00000008365.1 transcript:ENSXETT00000032590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 2.090e-8
Identity = 35/135 (25.93%), Postives = 68/135 (50.37%), Query Frame = 3
Query:   87 SSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIV 491
            ++E+N    + I +T        ++ +G+P NC+SLY  Y     +N     +  L++ D  +L    L +WI+    +D   YN  +CK  G L+  +   ++  LC I+V+R++ + +P +   L T+ T ++
Sbjct:    8 TTEENCTLDHTIHQTLFPVVYITVLVVGLPANCLSLYYGYLQIKAKNELGIYLCNLTVAD--LLYIFSLPFWIQYVLQHDNWTYNEMMCKICGILLYENIYISIAFLCCISVDRYLALVHPFRFYKLRTMKTALL 140          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: foxd4l1.2 (forkhead box D4 like 1, gene 2 [Source:Xenbase;Acc:XB-GENE-876578])

HSP 1 Score: 51.6026 bits (122), Expect = 1.136e-6
Identity = 32/113 (28.32%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  165 LGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTI-FTVIVGMI 500
            +G+P NC+SLY  Y     +N     +  L++ D  +L    L +W++     D   YN  +C+  G L+  +   ++G LC I+V+R++ + +P +   L T+   ++V MI
Sbjct:   34 VGLPANCLSLYYGYLQIKAKNELGIYLCNLTVAD--LLYIFSLPFWLQYVLQQDNWTYNETMCRICGILLYENIYISIGFLCCISVDRYLALVHPFRFHKLRTMKAALVVSMI 144          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: kiss1r (KISS1 receptor [Source:NCBI gene;Acc:100316929])

HSP 1 Score: 50.0618 bits (118), Expect = 4.280e-6
Identity = 37/131 (28.24%), Postives = 64/131 (48.85%), Query Frame = 3
Query:   66 NFSILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKS 458
            N S LEK  +   P   ++    V  F A+L+ +G+  N + +YV+ + K  R  T F +  L+  D   L++ V   +  A +     I+  F+CK   ++  +S      TL A++V+R+ V  YP +S
Sbjct:   23 NMSDLEKYGDPPRP-PQLVDAWLVPLFFAMLMLVGLTGNSLVIYVISKHKQMRTVTNFYIANLAATDIIFLVSCVP--FTAALYPLPGWIFGEFMCKFVNYIQQVSVQATCVTLTAMSVDRWYVTVYPLQS 150          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: GPR65 (G protein-coupled receptor 65 [Source:HGNC Symbol;Acc:HGNC:4517])

HSP 1 Score: 49.6766 bits (117), Expect = 4.480e-6
Identity = 53/207 (25.60%), Postives = 92/207 (44.44%), Query Frame = 3
Query:  156 LIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKP--KLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKL 770
            +I + IP NCISLYV       +N     +  LS  D  +L T +L  W+  + +++  + +  VC    FL+  +   + G L  I+++R++ V +P K   L TI T I  ++ F   +I      I L      N  G+    L C     +  W S  F  + +    +LP  I+  C   I+  ++ ++   ++  Q I +L
Sbjct:   26 VIVISIPTNCISLYVSCLQIKKKNELGIYLFNLSFSD--LLYTLILPLWVYYSLSHNNWMLSEHVCSLVAFLLHTNLYSSAGFLTCISLDRYLAVVHPLKFSHLRTIRTAI--LVSFVVWLIQHLSNAIILTQHELFNSSGD----LTCYDIFPMEPWKS-SFNIIHICIGHLLPLFIMVLCYQRIFAAVKTNQATADRDKQKIKQL 223          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Gpr4 (G protein-coupled receptor 4 [Source:MGI Symbol;Acc:MGI:2441992])

HSP 1 Score: 55.4546 bits (132), Expect = 5.968e-8
Identity = 37/139 (26.62%), Postives = 64/139 (46.04%), Query Frame = 3
Query:   96 DNSPNTNI-------IMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIV 491
            DNS  T         +   F  S    +I +G+P NC++L+  YR     N     ++ LSI D  +L    L  W+    ++D  I+    CK  GF+   +   ++  LC I+V+R++ V++P +   L  + T + 
Sbjct:    2 DNSTGTGEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQHNELGVYLMNLSIAD--LLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVA 138          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Gpr68 (G protein-coupled receptor 68 [Source:MGI Symbol;Acc:MGI:2441763])

HSP 1 Score: 54.299 bits (129), Expect = 1.370e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:   75 ILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYP 449
            I  ++S  + P  + I +T        ++ +G P NC+SLY  Y     RN     +  L+I D  +     L +W++    +D   + +  C+  G L+  +   +VG LC I+++R++ V++P
Sbjct:    4 ITTENSSLSCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTIAD--LFYICSLPFWLQYVLQHDDWSHGDLSCQVCGILLYENIYISVGFLCCISIDRYLAVAHP 126          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Gpr68 (G protein-coupled receptor 68 [Source:MGI Symbol;Acc:MGI:2441763])

HSP 1 Score: 54.299 bits (129), Expect = 1.370e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:   75 ILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYP 449
            I  ++S  + P  + I +T        ++ +G P NC+SLY  Y     RN     +  L+I D  +     L +W++    +D   + +  C+  G L+  +   +VG LC I+++R++ V++P
Sbjct:    4 ITTENSSLSCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTIAD--LFYICSLPFWLQYVLQHDDWSHGDLSCQVCGILLYENIYISVGFLCCISIDRYLAVAHP 126          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Gpr68 (G protein-coupled receptor 68 [Source:MGI Symbol;Acc:MGI:2441763])

HSP 1 Score: 54.299 bits (129), Expect = 1.370e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:   75 ILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYP 449
            I  ++S  + P  + I +T        ++ +G P NC+SLY  Y     RN     +  L+I D  +     L +W++    +D   + +  C+  G L+  +   +VG LC I+++R++ V++P
Sbjct:    4 ITTENSSLSCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTIAD--LFYICSLPFWLQYVLQHDDWSHGDLSCQVCGILLYENIYISVGFLCCISIDRYLAVAHP 126          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Npffr2 (neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:MGI:1860130])

HSP 1 Score: 50.447 bits (119), Expect = 2.180e-6
Identity = 84/363 (23.14%), Postives = 151/363 (41.60%), Query Frame = 3
Query:  120 IMETFVKSFAALLIF-LGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAV--------LLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSK-SLVTIFTVIVGMIGFSFGVICKNICIIYL----YNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIY------IYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPS--MHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDV--IC---CVPQRKTGKRFEAEMIVNS 1127
            +   F+ S+  LLIF L +  N +  +++ R++     T F ++ L+I D  V        LL  ++  W           + + +CK  G +  IS   +V TL AIAV+RF  V YP K K ++ T F  IV + G +  ++  +  ++++    Y  V ++      T+  C+        W   ++  +      Y  + F  IY      I I   +    L KT  +          T ++ P+     K++ + +IK+L  ++L+  ++ LP      L     +  N    ++  I      L F N+++N   Y F +  FR  F D   IC     PQ     R +  +++N+
Sbjct:   44 VAAVFISSY--LLIFVLCMVGNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWP----------FGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAIMLHVQEEKYYRVRLSSHNKTSTVYWCRE------DWPRHEMRRI------YTTVLFATIYLAPLSLIVIMYARIGASLFKTAAH---------CTGKQRPVQWHVSKKK-QKVIKMLLTVALLFILSWLPLWTLMMLSDYTDLSPNKLRIINIYIYPFAHWLAFCNSSVNPIIYGFFNENFRNGFQDAFQICQKKAKPQEAYSLRAKRNIVINT 372          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P46093|GPR4_HUMAN (G-protein coupled receptor 4 OS=Homo sapiens OX=9606 GN=GPR4 PE=2 SV=2)

HSP 1 Score: 58.5362 bits (140), Expect = 4.026e-8
Identity = 34/120 (28.33%), Postives = 60/120 (50.00%), Query Frame = 3
Query:  132 FVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIV 491
            F  S    +I +G+P NC++L+  YR    RN     ++ LSI D  +L    L  W+    ++D  I+    CK  GF+   +   ++  LC I+V+R++ V++P +   L  + T + 
Sbjct:   19 FPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLSIAD--LLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVA 136          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P50132|GPR4_PIG (G-protein coupled receptor 4 OS=Sus scrofa OX=9823 GN=GPR4 PE=3 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 5.413e-8
Identity = 42/168 (25.00%), Postives = 78/168 (46.43%), Query Frame = 3
Query:  132 FVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFT-VIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISW 632
            F  S    +I +G+P NC+ L+  YR    RN     ++ LSI D  +L    L  W+    ++D  I+    CK  GF+   +   ++  LC I+V+R++ V++P +   L  + T V V  + ++  +   ++ + +      + R   N T    K  +  W++W
Sbjct:   19 FPPSLYIFVIGVGLPTNCLRLWAAYRQVRQRNELGVYLMNLSIAD--LLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANSVPLFH----DELFRDRYNHTFCFEKFPMEGWVAW 180          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q1JQB3|GPR4_BOVIN (G-protein coupled receptor 4 OS=Bos taurus OX=9913 GN=GPR4 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 5.816e-8
Identity = 34/120 (28.33%), Postives = 60/120 (50.00%), Query Frame = 3
Query:  132 FVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIV 491
            F  S    +I +G+P NC++L+  YR    RN     ++ LSI D  +L    L  W+    ++D  I+    CK  GF+   +   ++  LC I+V+R++ V++P +   L  + T + 
Sbjct:   19 FPPSLYIFVIGVGLPTNCLALWAAYRQVRQRNELGVYLMNLSIAD--LLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVA 136          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4KLH9|GPR4_RAT (G-protein coupled receptor 4 OS=Rattus norvegicus OX=10116 GN=Gpr4 PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 8.338e-8
Identity = 38/139 (27.34%), Postives = 66/139 (47.48%), Query Frame = 3
Query:   96 DNSPNT-------NIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIV 491
            DNS  T       + +   F  S    +I +G+P NC++L+  YR    RN     ++ LSI D  +L    L  W+    ++D  I+    CK  GF+   +   ++  LC I+V+R++ V++P +   L  + T + 
Sbjct:    2 DNSTGTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQRNELGVYLMNLSIAD--LLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVA 138          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BUD0|GPR4_MOUSE (G-protein coupled receptor 4 OS=Mus musculus OX=10090 GN=Gpr4 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.175e-7
Identity = 37/139 (26.62%), Postives = 64/139 (46.04%), Query Frame = 3
Query:   96 DNSPNTNI-------IMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIV 491
            DNS  T         +   F  S    +I +G+P NC++L+  YR     N     ++ LSI D  +L    L  W+    ++D  I+    CK  GF+   +   ++  LC I+V+R++ V++P +   L  + T + 
Sbjct:    2 DNSTGTGEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQHNELGVYLMNLSIAD--LLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVA 138          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3UHX3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6979 PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.002e-67
Identity = 134/372 (36.02%), Postives = 207/372 (55.65%), Query Frame = 3
Query:   87 SSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQ--TILACKPKLNSWISWG--FFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIP---------------------------------------KKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICC 1073
             SE+ SP   +  E  ++ + +LL+ +G+P N IS Y++  D++NR TTR LM++++  D AVLLTAV RYW     N D R Y++++CKTH F V+  +DFAVG LCA+AVERF+VV++PQ++ ++ +  TV  GM+ F+  +  KN  I +L  I+ + R    Q  T+  C P    +  W   F K+D +++A+LPY+ILF CN+YI+  LR+ R +L+    N  + Q++ L+ N  +    +P                                       KKR+ E +IKVLTAL+++H + +LP  I+  L   + ++       V    L++L+FTNNAIN FAYL SS  FR  F ++  C
Sbjct:    5 DSENESPT--LFFELALQIYTSLLLLIGLPGNAISGYIMANDRTNRVTTRILMVIIAAADTAVLLTAVTRYWALEVLNTDFRNYSDWICKTHVFAVAFFTDFAVGALCAVAVERFLVVAFPQRANAVASTLTVTTGMLAFAVILSAKN-GIHFL--IMGLRRMTTEQNVTVFVCTPD-EDYTKWTRLFMKIDFISFAILPYVILFSCNLYIFCVLRRQRKLLSAAI-NQRQRQKVLLVANLGSDSLTLPTTSPDIEESGSRTRDFRASSRCGSQAKSILGSGSSKPERKKRKPEDVIKVLTALTVVHVVCTLPGTIFTLLTEYMDLKRQKPTKYV----LVMLIFTNNAINFFAYLASSERFRSQFANLFSC 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: W6UXQ5 (Kappa-type opioid receptor OS=Echinococcus granulosus OX=6210 GN=EGR_01843 PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 9.526e-67
Identity = 133/371 (35.85%), Postives = 201/371 (54.18%), Query Frame = 3
Query:   87 SSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWG--FFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIIL------------------NKTYQNIPKLQQMNLITNEETPIPV------------------IPK----KRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICC 1073
            SS  +S +  +  E  ++ + +LL+ +G+P N IS Y++  D++NR TTR LM++++  D +VLLTAV RYW       D R Y++ +CK H F V+  +DFAVG+LCA+AVERF+VV++PQ++ S+ +  TVI+GM+ F+  +  KN    ++  +  I   G N T+  C P    +  W   F K+D  ++AVLPY+ILF CN+YIY  L+K R +L                  N    N P         N  T +P+                   PK    KR+ E +IK+LTAL+++H + +LP  I+  L     +        V    L++L+FTNNAIN FAYL SS  FR  F++++ C
Sbjct:    3 SSALDSESPTLFFELALQIYTSLLLIVGLPGNAISGYIMATDRTNRLTTRILMVIIAAADTSVLLTAVTRYWALEVLKTDFRDYSDLMCKMHVFAVAFFTDFAVGSLCAVAVERFLVVAFPQRANSVTSSKTVIIGMVTFAIALSIKNGIHFFIMGLREITTEG-NVTVSVCTPD-EDYTRWTRVFMKIDFFSFAVLPYVILFSCNLYIYCVLKKQRKLLSTALNQRKVQVSVPAVQVNSAPPNFPTAADRVERDNRTTDLPMNYRTISQKKSFSISGGGDEPKSERRKRKPEDVIKILTALTVVHVVCTLPGTIFTLLSEYTDLRRQKPTKYV----LVMLIFTNNAINFFAYLASSERFRIQFVNLLSC 367          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3WKW3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1371 PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 7.531e-66
Identity = 136/352 (38.64%), Postives = 196/352 (55.68%), Query Frame = 3
Query:  144 FAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWG--FFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILN-----KTYQN-IPKLQ------------QMNLITNEETPIPV------------------IPK----KRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICC 1073
            + +LL+ +G+P N IS Y++  D++NR TTR LM++++  D AVLLTAV RYW       D R Y++ +CK H F V+  +DFAVG+LCA+AVERF+VV++PQ++  + +  TVI GM+ F+  +  KN     +  +  I   G N T+  C P    +  W   F KVD  ++AVLPY+ILF CN+YIY  L+K R +L+     K  QN IPK+Q             M  I N     P+                   PK    KR+ E +IK+LTAL+++H + +LP  I+  L     +        V    L++L+FTNNAIN+FAYL SS  FR  FL+++ C
Sbjct:   22 YTSLLLVIGLPGNAISGYIMATDRTNRLTTRILMVIIAASDTAVLLTAVTRYWALEVLKSDFRNYSDLICKLHVFAVAFFTDFAVGSLCAVAVERFLVVAFPQRANIVTSTKTVITGMVAFAVALSIKNGIHFLIMGLREIVTEG-NATVFVCAPH-EDYTCWTSVFKKVDFFSFAVLPYVILFSCNLYIYCVLKKQRKLLSTKINQKRVQNSIPKMQVNSAPPNFPAAADMVEIDNCTADFPMKRHANDQKKSLSVSGGGSGPKSERRKRKPEDVIKILTALTVVHVVCTLPGTIFTLLAEYTDLRRQKPTKYV----LVMLIFTNNAINLFAYLASSERFRIQFLNLLSC 367          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3W925 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6916 PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 4.177e-65
Identity = 133/369 (36.04%), Postives = 204/369 (55.28%), Query Frame = 3
Query:  126 ETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKN---ICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFF-KVDLLTYAVLPYLILFFCNIYIYIKLRKHRIIL-----NKTYQN-IPKLQQMNLITNEETPIPVI------------------------------PK----KRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQRKTGKR 1100
            E  ++ + +LL+ +G+P N IS Y++  D++NR TTR LM+++++ D AVLLTAV RYW     N D R Y++ +CK H F V+  +DFAVG+LCA+AVERF+VV++PQ++  + +  TVI+GM+ F+  +  KN     I+ L  +V+      N TI  C P  +     G F K+D  ++AVLPY+ILF CN+YIY  L++ R +L      K  QN IP +Q  +   N  T    +                              PK    +R+ E ++K+LTAL+++H + +LP  I+  L   + +        V    L++L+FTNNAIN FAYL SS  FR  F++++ C    +  +R
Sbjct:   16 ELALQIYTSLLLIVGLPGNAISGYIMATDRTNRLTTRILMVIIAVSDTAVLLTAVTRYWALEVLNSDFRNYSDLICKLHVFAVAFFTDFAVGSLCAVAVERFLVVAFPQRANVVTSTKTVIIGMVAFAVALSIKNGIHFLIMGLQEVVT----EGNATIFVCAPDEDYTRLTGIFKKIDFFSFAVLPYVILFSCNLYIYCVLKRQRKLLFVAVNQKGVQNRIPTVQVNSAPPNFPTAADTVERDDRVTDISMSYRVINHKKSLSVSGGGGGPKSERRRRKPEDVMKILTALTVVHVVCTLPGTIFTLLAEYMDLRRQKPTKYV----LVMLIFTNNAINFFAYLASSERFRIQFVNLLSCGRANRRNRR 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A564YLH2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2349 PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.240e-63
Identity = 126/377 (33.42%), Postives = 208/377 (55.17%), Query Frame = 3
Query:   78 LEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACK--PKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTY-QNIPKLQQMNLITNEETPI-----------------PVIP---------------------KKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQR 1085
            +  ++  +S N  +  +  ++ + + L+ +G+P N IS Y++  D++NR TTR LM++++  D AVLLT V RYW      +D RI+++ +CK H F  +  +DFAVG+LCA+AVERF+VV++P  + +  +I +V  GM  F+  +  KN   +++  ++ I R    +T   CK   K + ++   F K+D +++AV+PY+ILF CN+YIY KL++ R +L  T  Q   K+ +  L+ N  +P                   ++P                     +KR+ E +IKVLTAL+ +H + +LP  I   L     +    S+   I++ L++ +FTNNAIN FAYL SS  FR+ F  ++CC  +R
Sbjct:    1 MSATNATDSDNPKMFFKLALQVYTSFLLIIGLPGNVISGYIMATDQANRITTRILMVIIAAADTAVLLTGVTRYWSNVVLGFDFRIHSDLMCKIHVFGFAFFTDFAVGSLCAVAVERFLVVAFPHHANTFTSIKSVCFGMAAFAVVLSIKNGIHLFMMGLLEITRVAG-ETFHVCKTMDKYHKFMEV-FKKIDFISFAVIPYIILFSCNLYIYCKLKRQRRLLRTTMNQRQLKMNKSALLANSTSPATYTDAENPESLIVDKNSELMPNSAIDGQVKTPSECVSTRHERRKRKPEDVIKVLTALTAVHVVCTLPGTIVTLLSDYKHL----SVPVQIKQFLVIFIFTNNAINFFAYLASSERFRKKFASILCCDSRR 371          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: GPR68 (G protein-coupled receptor 68 [Source:NCBI gene;Acc:103041579])

HSP 1 Score: 58.9214 bits (141), Expect = 2.940e-9
Identity = 35/114 (30.70%), Postives = 61/114 (53.51%), Query Frame = 3
Query:  153 LLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVG 494
            L++ +G+P N  SLY  +     RN     +I L++ D  +L  A L  W++  F  D   Y  +VC+  GFL+  +   ++G LC I+++R++ V YP +  SL T+   ++ 
Sbjct:   36 LVLLVGLPANAYSLYHAWLQLRARNELGVYLINLTVSD--LLYLASLPLWLQYFFQGDDWQYGEWVCQLCGFLLYENIYVSIGFLCCISIDRYLAVVYPLRFSSLRTMKAAVLA 147          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: gpr4 (G-protein coupled receptor 4 [Source:NCBI gene;Acc:103040167])

HSP 1 Score: 57.7658 bits (138), Expect = 7.883e-9
Identity = 32/101 (31.68%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  153 LLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQK 455
            ++I LG P NC++L+  Y     +N     +I LS+ D  +L  A L  WI     +D  I+    CK  GF+   +   ++  LC I+++R++ V+YP K
Sbjct:   23 IVIILGFPTNCMALWAAYMQVRQKNELGIYLISLSVAD--LLYIATLPLWIDYFLQHDNWIHGPGSCKVFGFIFYTNIYVSIAFLCCISLDRYLAVAYPLK 121          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 51.2174 bits (121), Expect = 1.270e-6
Identity = 85/331 (25.68%), Postives = 138/331 (41.69%), Query Frame = 3
Query:  180 NCISLYVLYRDKSNRNTTRFLMILLSICD--------NAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIG-FSFGVICKNICIIYL--YNIVSINRGGNNQT--ILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIY------IYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLK--AQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNF---LDVICCVPQRKTGKR 1100
            N +  +++ R KS R  T   ++ L+I D           L+  ++  W           + + VCK  G +  IS   +V TL  IAV+RF  + YP K K  ++  TVI+ +I   +  ++C +  ++ +   + VSI  G +N T     C+    +W S    K+         Y  + F NIY      I I   +  I L KT   +P          E     V  KK+R   +IK+L  ++L+  ++ LP      L   A L    +  ++  +      L F N+++N   Y F +  FR+ F     +  C  QR  GKR
Sbjct:   66 NGLVCFIVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWP----------FGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIVYPFKQKLTISTSTVIIVIIWVLAISIMCPSGVMLQVTKESRVSILLGESNATRPFYWCR---ENWPSQEMRKI---------YTTVLFANIYLAPLTLIVIMYARIGITLFKTAVPVPTRGGY-----EGRGHTVSRKKKR---VIKMLLVVALLFILSWLPLWTLMMLSDYASLSEYQHRVINIYVYPLAHWLAFCNSSVNPIIYGFFNENFRRGFQIVFKLQFCSAQR--GKR 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-148a17.6 (leukotriene B4 receptor 1-like [Source:NCBI gene;Acc:103021612])

HSP 1 Score: 50.0618 bits (118), Expect = 2.335e-6
Identity = 78/359 (21.73%), Postives = 150/359 (41.78%), Query Frame = 3
Query:   57 MNGN-FSILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKS-------------------LVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLI-HAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLL---LMFTNNAINIFAYLFSSITFRQNFLD 1061
            MNG+ F  +++  E+   +             A+   LG+P N + ++ + +    R+ T  L++ L+I D  VL+T  L  WI +       ++   VCK   ++++     +V  +  +++ERF+ V YP  S S                   L++I  ++  ++G   G   +N C+   Y   S         IL     L S I  GF         V+P+ IL  C   ++                  ++ QMNL + +++ + +          + VL AL  I H I +L + ++ +L+   K E+  ++H  ++    +   L+F ++ +N   Y+F++  FR +  D
Sbjct:    1 MNGSSFWAIKQQQEEEEDDGGHAGLAGACVILAICFVLGVPGNLMVVWTILKHVKKRSHTVMLILHLAIADLLVLIT--LPLWIYSLARS--WVFGEVVCKAMAYIINACMYASVFLITIMSLERFLAVRYPFASASWRRKQALRKVLLVVWVSSFLLSIPVIVTQVLGDDLG---ENQCLYRYYESTS-----QEAAILL----LESLI--GF---------VIPFFILVVCYGCLF-----------------SRIAQMNLRSKKKSTMLIAS--------VVVLFALCWIPHHIGNLLSLVHLTLEE--KSEEAQTLHHAVEAMTFVAGALVFISSTVNPILYVFAARNFRSSLRD 305          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000006013.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:4195125:4261560:1 gene:ENSAMXG00000005876.2 transcript:ENSAMXT00000006013.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 4.053e-6
Identity = 71/309 (22.98%), Postives = 133/309 (43.04%), Query Frame = 3
Query:  156 LIFLGIPFNCISLYVLYRDKS--NRNTTRFLMILLSICDNAVLLTAVLRYWIRAT-FNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICC 1073
            + FLGI  N + + VL R KS  +R+TT   ++ LSI D + LL  V     +AT ++    I+  F+CK+  + V+++   ++ TL A++V+R++ V   +KS  +      ++G            + II+L ++V       +Q +       NS   W  +   L+   +LP +++  C    Y K+  H   L+K  +N+ K  + +              KR+    + ++ A  L+  +     A++        + D      ++   L    + N+ +N   Y F S  FR+    V  C
Sbjct:   44 IFFLGIVGNALVMVVLGRIKSGRSRSTTNIFILNLSIADLSFLLFCVP---FQATIYSLPEWIFGAFLCKSVHYFVTVTMLVSIFTLVAMSVDRYVAVVLSKKSPCIRNRRNALLG------------VWIIWLLSLVFAVPVAQHQVVTDHPDAPNSSFCWEIWVTILVIGYLLPLVLITCC----YAKVLYH---LHKKIKNMSKKSERS--------------KRKTAQTVLLVVAAFLLCWMPHHIIAMWVEF-GDFPLNDASFAFRIVSHCL---AYGNSCVNPILYAFLSENFRKACRQVFTC 312          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-202l22.3 (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 51.6026 bits (122), Expect = 1.407e-7
Identity = 38/119 (31.93%), Postives = 61/119 (51.26%), Query Frame = 3
Query:  150 ALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIR--IYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMI 500
            ALL  +G+  N + + V+ R K   N T FL+  L++ D  V LT V    I A F ++ R  +Y   +C     L   +   +V +L AIA++R++VV+YP + +  V    +  G I
Sbjct:   75 ALLTLVGVSGNLLLILVIARTKRLHNATNFLLGNLALSDLLVCLTCVP---ISAAFAFEPRGWVYGALLCYLVALLQPATVHVSVLSLTAIALDRYVVVAYPIRRRVAVRSCALTAGFI 190          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001964.1 (pep scaffold:Pmarinus_7.0:GL476839:47524:48493:-1 gene:ENSPMAG00000001783.1 transcript:ENSPMAT00000001964.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 6.980e-6
Identity = 31/121 (25.62%), Postives = 66/121 (54.55%), Query Frame = 3
Query:   99 NSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSK 461
            ++ +T  + E  V + + L++ L +P N +++Y+L      +++T  LMI L++ D  VL    L + I   F  ++ ++  F+C     +   ++  +  ++ AI+V+R++ + YP KSK
Sbjct:    7 STVSTMHLTEHVVPAVSCLVVVLALPLNLVAIYILCACIKRKSSTTMLMINLAVAD--VLFVCCLFFIIPYYFMANVWVFGLFLCHFVYTVFFTTTYVSTLSMMAISVDRYLAILYPIKSK 125          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO46500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ52])

HSP 1 Score: 57.3806 bits (137), Expect = 3.779e-9
Identity = 75/324 (23.15%), Postives = 142/324 (43.83%), Query Frame = 3
Query:  153 LLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLR-YWIRATFNYDIRIYNNFVCK--THGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSK---SLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACK-PKLNSWISWGFFKV--DLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQS---LKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQRK 1088
            L+  +G+  N + + V+ R++S   TT FL++ L+  D   LLT     YW+  T ++ + +  +++CK  T   LV I++  +  TL  +AVER+  +  P + K   S+  +  V+  + G S            L NI    +   ++    C  P     +   F  V   +L   V P LIL FC I I   L   + I ++   N+ +++                KKR    + ++L +++    +  +   +Y S    + + KI    ++H +I +++   +  ++ IN   Y F S  +R+ F  +  C  +R+
Sbjct:   37 LIDIIGVTGNALVILVVKRNRSMHTTTNFLLVNLAFADIFTLLTCPRNGYWLAVTASHPVGLAGDYICKFFTGNALVGITASVSSLTLTVLAVERYRALLKPMERKYSVSMENVKFVMTAIWGISI-----------LVNIPDFLKNKYSEHYGKCVCPFSLELVQPEFTHVLCTVLFLGVAPSLILSFCYIQIVSGLFLTKKICSEVTGNLNEIE---------------AKKR----LARLLISVTFAFYVCYISYGVYFSYLLFQDREKIIQKYNLHYIILKTVEFTLVCSSCINPILYGFQSSNYREGFKKLCFCHARRQ 330          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO49619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFL1])

HSP 1 Score: 54.6842 bits (130), Expect = 1.998e-8
Identity = 76/318 (23.90%), Postives = 135/318 (42.45%), Query Frame = 3
Query:  150 ALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNN------FVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSK-SLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYA-VLPYLILFFCNIYIYIKLRKH--RIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICC 1073
            A++  +G+  N +   V+++  + RNT  +L++ L+I D  V L  +        F+  IR+Y +       +CK     ++  +  +  TL AI+ +R+  V +P K + S+     VIV     SF V+        L  I+ +   G++ T    K      I    + V L  +A  LP +I+ F    + +KLR+   RI  NK    IP   + N IT                   K+L  + LI+A+  LP  +   L  +    +       +     +L++ N+ +N F Y   +  F++ F  ++CC
Sbjct:    3 AIIFIVGVVGNSLVCLVIFKTPNMRNTRNYLIVNLAIADITVALVCI-------PFDVVIRVYGDTWVLGAAMCKMVWPSMTFVATCSAATLAAISFDRYRAVVHPWKPRLSMRQTLAVIVSTWLVSFLVV--------LPYILVLGMDGHSCTEFWLKD-----IHRQLYTVFLFVFAYALPLVIIAFAYSRVALKLREQSNRIEKNKLASGIPSSSKYNWIT-------------------KMLVTVVLIYALCLLPNQVLW-LWMEFGTGNEFEHMNTLLTFTGMLVYINSIVNPFLYAGLNDEFKKGFARLLCC 280          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO46345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQD6])

HSP 1 Score: 53.1434 bits (126), Expect = 6.994e-8
Identity = 73/303 (24.09%), Postives = 131/303 (43.23%), Query Frame = 3
Query:  165 LGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLR-YWIRATFNYDIRIYNNFVCK--THGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILAC-KPKLNSWISWGFFKV--DLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNF 1055
            +G+  N + ++V+ R++S   TT FL++ L+  D   LLT     YW+    N  + +  +++CK  T   LV I++  +  TL  +AVER+  +  P + K  V++  V   M   ++G       I  L NI    +   +     C  P     +   F  V   +L   V P+LIL FC I I   L   + I ++   N  +++                KKR    +I V  A  + + I+     +Y   + ++ I     +H ++ +++   +  ++ IN   Y F S  +R+ F
Sbjct:   13 IGVTGNALVIFVVKRNRSMHTTTNFLLVNLAFADIFTLLTCPRNGYWLAVMVNQPVGVAGDYICKFFTGNALVGITASVSSLTLTVLAVERYRALLKPMERKYSVSMENVKFVMAA-TWG-------ISILVNIPDFLKNKYSDYYGKCICPFSLELVQPEFTHVLCTVLFLGVAPFLILSFCYIQIVSGLFLTKKICSEVTGNSSEIE---------------AKKRLARLLISVTLAFYVCY-ISYGTYFLYLLFQDRVIIIQKYDIHYIVLKTVEFTLVCSSCINPILYGFQSSNYREGF 291          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO47227 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMX9])

HSP 1 Score: 53.1434 bits (126), Expect = 8.578e-8
Identity = 71/331 (21.45%), Postives = 143/331 (43.20%), Query Frame = 3
Query:   90 SEDNSPNTNIIMETFVKSFAALLIFLG-IPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYP---QKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVIC 1070
            S  N P T    E  ++ F  ++IF+G +  N + L V+ R + N  TT + +  L++ +       V  +W+         +  N  CKT  F   ++   + G L  I+++RF VV +P   + +K+      V V +      +IC     +Y +   SI+   NN  ++ C    ++ + W   KV +    ++P+       + +Y ++ +  +  N+        Q MNL  +       +PK +    ++++L    L+   + LP  I  +++A   ++ + S++     + L++ F N+ +N   Y   +  FR+    V C
Sbjct:   16 STANCPGTP---EITLEVFFLIVIFIGALVGNVLILLVVRRSRRNEWTTNYFVTSLAVSNLTSPFLCV--FWVLVWITSGKWLLGNISCKTTFFFHFLNVGVSAGLLACISLDRFYVVVHPLSFKMTKAQTKELIVFVWVF-----MICATAPSLYFFKTKSIS---NNNELIYCITDFDT-VEW---KVFITLLVLIPFGCPLITTLALYCRITQAILFRNR--------QAMNLTNDFRRQANQVPKSK--IKVLRMLVIQWLVFVASWLPLLITMAVQALKLVDFSESLYI----ATLVISFANSGLNALIYSLFNGDFRRGCKRVFC 315          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO49025 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHR7])

HSP 1 Score: 52.7582 bits (125), Expect = 1.060e-7
Identity = 74/335 (22.09%), Postives = 129/335 (38.51%), Query Frame = 3
Query:   96 DNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCK--THGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLP---AAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQR 1085
             +S    I + TF  SF  +   +G   N + + V+  +K+ R    FL+I L++ D  V +    R+      N+   +    +CK  T G         +V TL AIA ER+  V YP   K  ++I  +    IG   G    N+ +      ++I    +        P    W+   +  V      V P     F   ++Y ++  + +   ++    P  Q             VI  ++R     K++  +S+I+A   LP     +      Q K  D      V   + + L   N+++N   Y F ++ FR+   D++CC   R
Sbjct:    5 GDSATAQIALTTFF-SFLVVTDLIG---NTLVILVIVTNKTARTPMNFLLINLAVADMMVAIFIAPRFLFMNAINHPEGLAGTIICKLITGGNFSWTGGACSVFTLVAIAFERYYAVMYPYNDKGKMSIKKLRYIFIGVWLGAAVLNLPL-----FLTIYYEASKHFCFEYWPPDLPWLPIAYASVWWAAAGVFP----IFSMAFLYTRV-VYNLWFKRSESGNPAQQA------------VIRYRKRAT---KMVITVSVIYAFCWLPILTTYMLSYAHPQFKYGD------VTHIATIGLSTLNSSVNPLVYTFQNVRFRKLLKDLVCCKQSR 304          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029747.1 (G protein-coupled receptor 4 [Source:NCBI gene;Acc:101161819])

HSP 1 Score: 58.151 bits (139), Expect = 4.893e-9
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  153 LLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIV 491
            ++I LG+P NC++L+  Y     RN     ++ LS+ D  +L  A L  WI     +D  I+    CK  GF+   +   ++  LC I+++R++ V+YP +   +  I T I+
Sbjct:   24 IVIVLGLPTNCMALWAAYLQVRQRNELGIYLMNLSVAD--LLYIATLPLWIDYFLQHDDWIHGQESCKLFGFIFYTNIYVSIAFLCCISMDRYLAVAYPLRFAKVRRIKTAIL 134          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042465.1 (SMESG000042465.1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 357/357 (100.00%), Postives = 357/357 (100.00%), Query Frame = 3
Query:   57 MNGNFSILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQRKTGKRFEAEMIVNS 1127
            MNGNFSILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQRKTGKRFEAEMIVNS
Sbjct:    1 MNGNFSILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQRKTGKRFEAEMIVNS 357          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042531.1 (SMESG000042531.1)

HSP 1 Score: 380.178 bits (975), Expect = 5.050e-131
Identity = 191/331 (57.70%), Postives = 250/331 (75.53%), Query Frame = 3
Query:   84 KSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNI-VSINRGGNNQTILACKPKLNSWISWGFF-KVDLLTYAVLPYLILFFCNIYIYIKLR-KHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVI 1067
            KSS   +   +++ME F+K +AA+LIF GIPFN   L++L +D SNRNTTRFLMILL++ DNAVLLT VLRYW+RATF YDIR ++N  CK HGFLVS+SSD A+G LC+IAVERF+VVSYP +SK+LVT+ TVI G+ GF  GVI KN CI++LY + ++ N+      +  C+P+L+S + W FF K+D +TYA+LPY+ILFFCNIYIY +L+ +H+ + N     I      + + ++  PI    KKRR EHI+KVLTALSLIHAIT+LPAAIYQ++K+++ +  N  MH +I E+LLLLMFTNNAINIFAYLFSSI+FRQ F  +I
Sbjct:    8 KSSVIGNNEKSVLMENFIKIYAAILIFFGIPFNSFVLHILRKDISNRNTTRFLMILLAVADNAVLLTGVLRYWVRATFKYDIRHFSNIACKGHGFLVSVSSDCAIGFLCSIAVERFLVVSYPNQSKTLVTMVTVICGISGFVLGVILKNSCILWLYQLHLTNNKTDEKLALFECRPQLDSGL-WKFFQKLDFITYAILPYVILFFCNIYIYFRLKQQHKALRNNQKLKIKNSDASSGLESQIKPIVKRNKKRRTEHIVKVLTALSLIHAITTLPAAIYQAMKSRIGVNKNQYMHTIIHENLLLLMFTNNAINIFAYLFSSISFRQQFFKII 337          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000054459.1 (SMESG000054459.1)

HSP 1 Score: 224.557 bits (571), Expect = 4.842e-70
Identity = 136/323 (42.11%), Postives = 198/323 (61.30%), Query Frame = 3
Query:  120 IMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVIC-KNIC-IIYLYNIVSINRGGNNQTILA----CKPKLNSWISWGFF-KVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLK-----AQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQN 1052
            I E  ++ +A LL+F+G+P N IS+ V+  D + R TT+ LMI+LSI D+ V++ AV RYWI   F  DIRIYNN +C  H FLV I +D AVG+LC +AVERFIVV +PQKS  L+ +  ++ G+I F  GV   KN    ++L  I      G N T L     C P       +  F K+D +++AV+PY+ILF  NIYIY+ LR+  I+L+K        +  + + N++       +KRR ++++K+LT L++IH IT+LP AI+  LK     A     ++PS++ ++  SL+LL+FTNNA+N F Y  SS  FR+N
Sbjct:    5 IFEIGIQIYATLLLFVGLPLNIISVVVVAYDYTTRLTTKLLMIILSITDSLVIVIAVSRYWIFVIFKTDIRIYNNLICMIHSFLVGIVTDLAVGSLCFLAVERFIVVVFPQKSNQLIKVNRILFGIIIF-LGVTSFKNSANFVFLTTI-----HGKNSTNLTVNRKCGPSSQYIQEFAIFKKIDFVSFAVIPYVILFSTNIYIYVVLRRQHILLSKH-------KSSSTLLNDKK-----RRKRRPQNVMKILTGLTIIHVITTLPGAIFTMLKNFFPFAINSKNEDPSLNRILTSSLVLLLFTNNALNFFVYYISSTVFRRN 309          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000063789.1 (SMESG000063789.1)

HSP 1 Score: 203.756 bits (517), Expect = 7.807e-62
Identity = 144/348 (41.38%), Postives = 197/348 (56.61%), Query Frame = 3
Query:  123 METFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVICKNICIIYLYNIVSINRGGNNQTIL---ACKPK--LNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKK----RRIEHIIKVLTALSLIHAITSLPAAIY----QSLKAQLKIEDNPSMHAVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVI-CCVPQRKTGKRFEAEMIVN 1124
            +E  ++ +  LLIF GIP N I   V+  DK+N  TTR LM+LL+  D  VLLTA+LRYW+   F  DIR  N+  C  H FLV++S+D A+ TLCA+A+ERFIVV +P KS   VT+   I+ +      +I KN   I+   I S N   N Q  +    C PK  L +++   F K+D +TY+VLPY ILF  N+YI+I LR+   IL K++ N PK       TN +    V  KK    R+ ++IIK+LTAL+++H ITS+P  I+    Q     LK         +I + L++LMFTNNA N  AYL SS +FR+  L V+ CC            EMI +
Sbjct:   16 VEFILQVYGGLLIFAGIPANVICGIVMGTDKTNHFTTRLLMVLLAAADCVVLLTALLRYWVIEAFKVDIRSINSLTCLLHTFLVAVSTDAAIATLCALAIERFIVVGFPYKSIRCVTMKNSIISITMVYLILILKNSFNIWSMEIQSSNYTLNQQNTIIKPKCIPKRHLLNYVRV-FSKIDFITYSVLPYFILFSTNMYIFIILRRQSRIL-KSHLN-PK------NTNNKNQRTVSRKKTNRGRQSQNIIKILTALTVVHMITSIPGTIFNIITQFFPENLKYISYLK-RRLISDGLMMLMFTNNATNFLAYLISSNSFRKRILIVLPCCFQSHSETPINGQEMITH 353          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000001813.1 (SMESG000001813.1)

HSP 1 Score: 119.398 bits (298), Expect = 2.217e-30
Identity = 95/328 (28.96%), Postives = 163/328 (49.70%), Query Frame = 3
Query:   96 DNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLYRDKSNRNTT--RFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVIC-KNICIIYLYNIVSINRG---GNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPS---MHAVIQESLLLLMFTNNAINIFAYLFSSITFRQN 1052
               P   +++  F+  +A  LI +G   N   +++++  +SN      R ++++L+  D AVL  AVLRYWI  TF+ DIR  +N +C  H FL  I++DFAV  LC ++VER + + YP +SK ++  +  +    G S  VI  K+  ++++ ++ +   G     +   LA  P  ++WI       + +T+++LPY++L   NI +YI +RKH     + ++N      + +          I  +  +    K+L  LS++H   S P  +Y       +I   PS      ++  +L LL  TNNA+N F  L+ S  FR  
Sbjct:    2 SGQPMLLLLIRYFLAFYAGFLIVIGSLGN---IFIIFGMRSNLRIRIPRLILVILAGSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSK-VIDSWEKVCFCAGVSVFVIAMKHAPLLWITHLGNGTVGCSYNKDWCNLAMCP--HTWI-------EFITHSLLPYVLLIPTNISLYIIIRKHS---EEAFRNSGSFNSVRVSRFSRISERSIRNRGMVSS--KILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNT 311          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPR48.384e-928.33G protein-coupled receptor 4 [Source:HGNC Symbol;A... [more]
NPFFR29.903e-723.37neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR21.145e-623.37neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
GPR681.536e-625.81G protein-coupled receptor 68 [Source:HGNC Symbol;... [more]
GPR681.536e-625.81G protein-coupled receptor 68 [Source:HGNC Symbol;... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AstA-R18.172e-620.63gene:FBgn0266429 transcript:FBtr0333798[more]
AstA-R18.172e-620.63gene:FBgn0266429 transcript:FBtr0070575[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr44.221e-829.46G protein-coupled receptor 4 [Source:ZFIN;Acc:ZDB-... [more]
GPR683.700e-724.32ovarian cancer G-protein coupled receptor 1-like [... [more]
CU915819.22.266e-624.73neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
AL929374.12.266e-624.73neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
NPFFR22.266e-624.73neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000032590.12.090e-825.93pep primary_assembly:Xenopus_tropicalis_v9.1:8:718... [more]
foxd4l1.21.136e-628.32forkhead box D4 like 1, gene 2 [Source:Xenbase;Acc... [more]
kiss1r4.280e-628.24KISS1 receptor [Source:NCBI gene;Acc:100316929][more]
GPR654.480e-625.60G protein-coupled receptor 65 [Source:HGNC Symbol;... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpr45.968e-826.62G protein-coupled receptor 4 [Source:MGI Symbol;Ac... [more]
Gpr681.370e-725.60G protein-coupled receptor 68 [Source:MGI Symbol;A... [more]
Gpr681.370e-725.60G protein-coupled receptor 68 [Source:MGI Symbol;A... [more]
Gpr681.370e-725.60G protein-coupled receptor 68 [Source:MGI Symbol;A... [more]
Npffr22.180e-623.14neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46093|GPR4_HUMAN4.026e-828.33G-protein coupled receptor 4 OS=Homo sapiens OX=96... [more]
sp|P50132|GPR4_PIG5.413e-825.00G-protein coupled receptor 4 OS=Sus scrofa OX=9823... [more]
sp|Q1JQB3|GPR4_BOVIN5.816e-828.33G-protein coupled receptor 4 OS=Bos taurus OX=9913... [more]
sp|Q4KLH9|GPR4_RAT8.338e-827.34G-protein coupled receptor 4 OS=Rattus norvegicus ... [more]
sp|Q8BUD0|GPR4_MOUSE4.175e-726.62G-protein coupled receptor 4 OS=Mus musculus OX=10... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UHX31.002e-6736.02G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
W6UXQ59.526e-6735.85Kappa-type opioid receptor OS=Echinococcus granulo... [more]
A0A0R3WKW37.531e-6638.64G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3W9254.177e-6536.04G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A564YLH21.240e-6333.42G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPR682.940e-930.70G protein-coupled receptor 68 [Source:NCBI gene;Ac... [more]
gpr47.883e-931.68G-protein coupled receptor 4 [Source:NCBI gene;Acc... [more]
npffr2b1.270e-625.68neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
si:dkey-148a17.62.335e-621.73leukotriene B4 receptor 1-like [Source:NCBI gene;A... [more]
ENSAMXT00000006013.24.053e-622.98pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-202l22.31.407e-731.93prolactin releasing hormone receptor [Source:HGNC ... [more]
ENSPMAT00000001964.16.980e-625.62pep scaffold:Pmarinus_7.0:GL476839:47524:48493:-1 ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465003.779e-923.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496191.998e-823.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463456.994e-824.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472278.578e-821.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490251.060e-722.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000029747.14.893e-930.09G protein-coupled receptor 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042465.10.000e+0100.00SMESG000042465.1[more]
SMESG000042531.15.050e-13157.70SMESG000042531.1[more]
SMESG000054459.14.842e-7042.11SMESG000054459.1[more]
SMESG000063789.17.807e-6241.38SMESG000063789.1[more]
SMESG000001813.12.217e-3028.96SMESG000001813.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015514 ID=SMED30015514|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1191bp
GAAAAATCTTATGAAAATTTACCTAATCCAGTCACATTTTTTGAACTCAA
ACAAAAATGAATGGTAATTTTTCGATATTAGAAAAATCAAGTGAAGACAA
TTCACCTAATACTAACATTATAATGGAAACCTTTGTCAAATCCTTTGCGG
CTTTGTTGATCTTTCTTGGAATTCCATTTAATTGTATTTCTCTTTACGTT
TTATATCGAGATAAATCAAACCGAAATACAACGAGATTTTTAATGATATT
ATTGTCAATTTGCGACAACGCAGTTCTATTGACTGCCGTTCTCCGCTACT
GGATTCGTGCAACCTTTAACTATGATATTAGAATTTACAACAATTTCGTT
TGTAAAACTCACGGATTTTTGGTGTCAATATCCTCAGATTTCGCAGTCGG
AACTTTGTGTGCAATTGCCGTTGAGAGATTTATTGTCGTTTCCTATCCCC
AGAAATCTAAATCTCTAGTTACGATCTTCACTGTCATAGTTGGAATGATT
GGATTTTCATTTGGGGTCATTTGTAAAAATATTTGTATTATATATTTATA
CAATATTGTGTCAATAAATAGAGGCGGAAACAATCAAACGATACTTGCCT
GTAAACCAAAATTAAACAGCTGGATTAGTTGGGGATTTTTTAAAGTCGAC
TTGTTAACTTATGCTGTTTTGCCATATTTGATTTTATTTTTCTGTAACAT
TTACATTTACATTAAATTACGTAAGCATAGAATAATTTTGAATAAAACCT
ATCAGAATATCCCGAAATTACAACAGATGAACCTAATCACCAATGAAGAA
ACTCCGATTCCCGTGATTCCAAAAAAACGCAGAATTGAACACATCATTAA
AGTCCTGACAGCACTTTCATTAATTCACGCAATTACATCCTTGCCAGCAG
CCATTTATCAATCTTTAAAAGCTCAACTTAAAATCGAGGATAACCCCTCA
ATGCATGCCGTTATCCAGGAGAGTCTTTTGTTATTAATGTTTACGAATAA
TGCCATAAACATTTTTGCGTATTTGTTTTCTTCGATAACGTTTCGTCAGA
ATTTCCTCGATGTCATTTGTTGCGTACCGCAACGAAAAACTGGAAAACGA
TTTGAAGCAGAAATGATTGTGAACAGTTGATTGGAATTTGTATTTCATTG
TTTATTATTGTTTCAAAAATTTCATTTTACATTTAGATGAC
back to top

protein sequence of SMED30015514-orf-1

>SMED30015514-orf-1 ID=SMED30015514-orf-1|Name=SMED30015514-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=358bp
MNGNFSILEKSSEDNSPNTNIIMETFVKSFAALLIFLGIPFNCISLYVLY
RDKSNRNTTRFLMILLSICDNAVLLTAVLRYWIRATFNYDIRIYNNFVCK
THGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGF
SFGVICKNICIIYLYNIVSINRGGNNQTILACKPKLNSWISWGFFKVDLL
TYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETP
IPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPSMH
AVIQESLLLLMFTNNAINIFAYLFSSITFRQNFLDVICCVPQRKTGKRFE
AEMIVNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 26..50
score: 16.85
coord: 106..128
score: 25.11
coord: 195..218
score: 17.27
coord: 59..80
score: 20.24
coord: 304..330
score: 23.97
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 42..318
e-value: 5.4E-17
score: 62.0
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 112..128
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 9..347
e-value: 1.4E-45
score: 157.6
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 18..342
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 33..333
e-value: 1.08374E-22
score: 94.622
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 23..345
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 199..221
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 30..49
NoneNo IPR availableTMHMMTMhelixcoord: 266..287
NoneNo IPR availableTMHMMTMhelixcoord: 103..122
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 41..322
score: 20.392