X-ray radiation resistance-associated protein 1

Overview
NameX-ray radiation resistance-associated protein 1
Smed IDSMED30015511
Length (bp)2903
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of X-ray radiation resistance-associated protein 1 (SMED30015511) t-SNE clustered cells

Violin plots show distribution of expression levels for X-ray radiation resistance-associated protein 1 (SMED30015511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of X-ray radiation resistance-associated protein 1 (SMED30015511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for X-ray radiation resistance-associated protein 1 (SMED30015511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015511h1SMcG0003956 SmedASXL_016614SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30015511h1SMcG0003956 Contig40050newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015511h1SMcG0003956 Contig40050uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30015511h1SMcG0003956 dd_Smed_v4_13519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015511h1SMcG0003956 dd_Smed_v4_13519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015511h1SMcG0003956 dd_Smed_v4_13519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015511h1SMcG0003956 dd_Smed_v4_13519_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015511h1SMcG0003956 dd_Smed_v6_13519_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015511h1SMcG0003956 dd_Smed_v4_13519_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Human
Match: XRRA1 (X-ray radiation resistance associated 1 [Source:HGNC Symbol;Acc:HGNC:18868])

HSP 1 Score: 91.2781 bits (225), Expect = 2.490e-19
Identity = 90/268 (33.58%), Postives = 142/268 (52.99%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDD-GAWVIAQKADQRKRFKAIIC-------NLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVS-FKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMA-----HPYMGDDGKAY-RKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKL 819
            N  P R L++   +  G W++ QK + +K+ K ++        +LK T  F    + +   E+  +       + F+L++     P  +  INVS  K  ++ E++F  F SV  I+AS N L L+ F TF  L EL+L+ N ++ I +   DF+ LE LDLSFN+L  E I  LG+L  L++L LTGN L +LP ++A             K Y  +F +LE L ++ N+L + S F++L GL +L+ L L  N    IP L+ ++L
Sbjct:   18 NCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKGLVGAQAERRESLKATS-FEFKGKKESRRENQVDLPGHILDQAFLLKHHCVRKPSDLCTINVSGLKFSKAKENDFKHFHSVIYINASENLLPLEAFHTFPALKELDLAFNGIKTIYVKYGDFKLLEFLDLSFNSLTVEAICDLGILPHLRVLLLTGNGLTSLPPNLAVAEQEASVTSLTSKRYILRFPALETLMLDDNRLSNPSCFASLAGLRRLKKLSLDENRIIRIPYLQQVQL 284          
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Human
Match: XRRA1 (X-ray radiation resistance associated 1 [Source:HGNC Symbol;Acc:HGNC:18868])

HSP 1 Score: 90.5077 bits (223), Expect = 4.990e-18
Identity = 84/267 (31.46%), Postives = 133/267 (49.81%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDD-GAWVIAQKADQRKRFKAIIC-------NLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMA-----HPYMGDDGKAY-RKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKL 819
            N  P R L++   +  G W++ QK + +K+ K ++        +LK T  F    + +   E+  +       + F+L++     P  +  IN    D +           V  I+AS N L L+ F TF  L EL+L+ N ++ I +   DF+ LE LDLSFN+L  E I  LG+L  L++L LTGN L +LP ++A             K Y  +F +LE L ++ N+L + S F++L GL +L+ L L  N    IP L+ ++L
Sbjct:   18 NCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKGLVGAQAERRESLKAT-SFEFKGKKESRRENQVDLPGHILDQAFLLKHHCVRKPSDLCTINAKENDFKHFHS-------VIYINASENLLPLEAFHTFPALKELDLAFNGIKTIYVKYGDFKLLEFLDLSFNSLTVEAICDLGILPHLRVLLLTGNGLTSLPPNLAVAEQEASVTSLTSKRYILRFPALETLMLDDNRLSNPSCFASLAGLRRLKKLSLDENRIIRIPYLQQVQL 276          
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Human
Match: XRRA1 (X-ray radiation resistance associated 1 [Source:HGNC Symbol;Acc:HGNC:18868])

HSP 1 Score: 90.5077 bits (223), Expect = 8.558e-18
Identity = 84/267 (31.46%), Postives = 133/267 (49.81%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDD-GAWVIAQKADQRKRFKAIIC-------NLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMA-----HPYMGDDGKAY-RKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKL 819
            N  P R L++   +  G W++ QK + +K+ K ++        +LK T  F    + +   E+  +       + F+L++     P  +  IN    D +           V  I+AS N L L+ F TF  L EL+L+ N ++ I +   DF+ LE LDLSFN+L  E I  LG+L  L++L LTGN L +LP ++A             K Y  +F +LE L ++ N+L + S F++L GL +L+ L L  N    IP L+ ++L
Sbjct:   18 NCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKGLVGAQAERRESLKAT-SFEFKGKKESRRENQVDLPGHILDQAFLLKHHCVRKPSDLCTINAKENDFKHFHS-------VIYINASENLLPLEAFHTFPALKELDLAFNGIKTIYVKYGDFKLLEFLDLSFNSLTVEAICDLGILPHLRVLLLTGNGLTSLPPNLAVAEQEASVTSLTSKRYILRFPALETLMLDDNRLSNPSCFASLAGLRRLKKLSLDENRIIRIPYLQQVQL 276          
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Zebrafish
Match: xrra1 (X-ray radiation resistance associated 1 [Source:ZFIN;Acc:ZDB-GENE-101216-2])

HSP 1 Score: 84.7297 bits (208), Expect = 2.250e-16
Identity = 68/147 (46.26%), Postives = 87/147 (59.18%), Query Frame = 1
Query:  379 IDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAHPY-----MGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPML 804
            I+AS N LTL+ F  F  L EL LS N++  + I+  DF+ LE+LDLSFNN+  E IL LGLL  LK+L+LTGN LQ LPL MA          D G +   FESLE L ++ N+L S   F +L  + +LR L L  N    +P L
Sbjct:   30 INASDNHLTLEPFGRFPALRELELSLNSLHKLEIHADDFKKLEVLDLSFNNVTGESILNLGLLPCLKVLHLTGNQLQMLPLSMAGSCNQLEENTDQGVSL--FESLEVLMLDDNKLTSPGVFMSLANMKRLRHLNLQGNLISGVPFL 174          
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Mouse
Match: Xrra1 (X-ray radiation resistance associated 1 [Source:MGI Symbol;Acc:MGI:2181647])

HSP 1 Score: 97.0561 bits (240), Expect = 5.381e-21
Identity = 91/275 (33.09%), Postives = 140/275 (50.91%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDD-GAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYD--------HESNANANNFKFSKEFILENCKTVDPDKIAVINVS-FKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMA-----HPYMGDDGKAY-RKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNN 837
            N  P + L++   +  G W++ +K   +K           TEG     ++ +D         +S A+       + F+L++     P  +  INVS  K  ++ E +F  F+SV  I+AS N L LD F TF  L EL L+ N ++ + +   DF+ LE LDLSFN+L  E I  LG+L  L++L LTGN L +LP +MA             K Y  +F +LE L ++ N+L + S F++L GL +L+ L L  N    IP L+ I+L+  S +
Sbjct:   18 NCFPAKSLLRLPEEGRGHWIVVRKGSMKKGAAK-----ASTEGQESQKKVSFDTGLKKISRRDSQADVLGHILDRSFLLKHHSARKPSDLCTINVSGMKFSKAKEKDFKHFTSVIYINASENLLPLDVFHTFPVLKELELAFNGIKMVYVKYGDFKTLEFLDLSFNSLTEEAICDLGILPHLRVLLLTGNGLTSLPPNMAVKEQEASMTSLTSKKYILRFPALETLMLDDNKLSNPSCFASLAGLRRLKKLSLDQNKIVRIPYLQQIQLRDGSGD 287          
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Mouse
Match: Xrra1 (X-ray radiation resistance associated 1 [Source:MGI Symbol;Acc:MGI:2181647])

HSP 1 Score: 97.4413 bits (241), Expect = 4.170e-20
Identity = 91/275 (33.09%), Postives = 140/275 (50.91%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDD-GAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYD--------HESNANANNFKFSKEFILENCKTVDPDKIAVINVS-FKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMA-----HPYMGDDGKAY-RKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNN 837
            N  P + L++   +  G W++ +K   +K           TEG     ++ +D         +S A+       + F+L++     P  +  INVS  K  ++ E +F  F+SV  I+AS N L LD F TF  L EL L+ N ++ + +   DF+ LE LDLSFN+L  E I  LG+L  L++L LTGN L +LP +MA             K Y  +F +LE L ++ N+L + S F++L GL +L+ L L  N    IP L+ I+L+  S +
Sbjct:   18 NCFPAKSLLRLPEEGRGHWIVVRKGSMKKG-----AAKASTEGQESQKKVSFDTGLKKISRRDSQADVLGHILDRSFLLKHHSARKPSDLCTINVSGMKFSKAKEKDFKHFTSVIYINASENLLPLDVFHTFPVLKELELAFNGIKMVYVKYGDFKTLEFLDLSFNSLTEEAICDLGILPHLRVLLLTGNGLTSLPPNMAVKEQEASMTSLTSKKYILRFPALETLMLDDNKLSNPSCFASLAGLRRLKKLSLDQNKIVRIPYLQQIQLRDGSGD 287          
BLAST of X-ray radiation resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q3U3V8|XRRA1_MOUSE (X-ray radiation resistance-associated protein 1 OS=Mus musculus OX=10090 GN=Xrra1 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.917e-19
Identity = 91/275 (33.09%), Postives = 140/275 (50.91%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDD-GAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYD--------HESNANANNFKFSKEFILENCKTVDPDKIAVINVS-FKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMA-----HPYMGDDGKAY-RKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNN 837
            N  P + L++   +  G W++ +K   +K           TEG     ++ +D         +S A+       + F+L++     P  +  INVS  K  ++ E +F  F+SV  I+AS N L LD F TF  L EL L+ N ++ + +   DF+ LE LDLSFN+L  E I  LG+L  L++L LTGN L +LP +MA             K Y  +F +LE L ++ N+L + S F++L GL +L+ L L  N    IP L+ I+L+  S +
Sbjct:   18 NCFPAKSLLRLPEEGRGHWIVVRKGSMKKG-----AAKASTEGQESQKKVSFDTGLKKISRRDSQADVLGHILDRSFLLKHHSARKPSDLCTINVSGMKFSKAKEKDFKHFTSVIYINASENLLPLDVFHTFPVLKELELAFNGIKMVYVKYGDFKTLEFLDLSFNSLTEEAICDLGILPHLRVLLLTGNGLTSLPPNMAVKEQEASMTSLTSKKYILRFPALETLMLDDNKLSNPSCFASLAGLRRLKKLSLDQNKIVRIPYLQQIQLRDGSGD 287          
BLAST of X-ray radiation resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q6P2D8|XRRA1_HUMAN (X-ray radiation resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=XRRA1 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 4.110e-17
Identity = 84/267 (31.46%), Postives = 133/267 (49.81%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDD-GAWVIAQKADQRKRFKAIIC-------NLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMA-----HPYMGDDGKAY-RKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKL 819
            N  P R L++   +  G W++ QK + +K+ K ++        +LK T  F    + +   E+  +       + F+L++     P  +  IN    D +           V  I+AS N L L+ F TF  L EL+L+ N ++ I +   DF+ LE LDLSFN+L  E I  LG+L  L++L LTGN L +LP ++A             K Y  +F +LE L ++ N+L + S F++L GL +L+ L L  N    IP L+ ++L
Sbjct:   18 NCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKGLVGAQAERRESLKAT-SFEFKGKKESRRENQVDLPGHILDQAFLLKHHCVRKPSDLCTINAKENDFKHFHS-------VIYINASENLLPLEAFHTFPALKELDLAFNGIKTIYVKYGDFKLLEFLDLSFNSLTVEAICDLGILPHLRVLLLTGNGLTSLPPNLAVAEQEASVTSLTSKRYILRFPALETLMLDDNRLSNPSCFASLAGLRRLKKLSLDENRIIRIPYLQQVQL 276          
BLAST of X-ray radiation resistance-associated protein 1 vs. TrEMBL
Match: A0A2R2MPY6 (X-ray radiation resistance-associated protein 1-like OS=Lingula unguis OX=7574 GN=LOC106181326 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.908e-27
Identity = 95/267 (35.58%), Postives = 150/267 (56.18%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDDG-AWVIAQKADQRKRFKAIICNL-----KVTEGFNQSN------RIK---YDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXX-XXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCI 813
            N  PVR + K + + G AW+++ +A+QR+RFKA++C+      ++ E   QS       R++    D E     + F   K   +E     DP  +  +N+  K +   ++E      +V  ++A  N L  + F  F  + EL +  N +R I I  +DF ++E+LDLS+NNL  EDILMLG++ KL++L+LTGNN + LP D+A P+  +  K   +F +LE L ++ N+L   S+FSAL GL +LR L L  NN  S+P L+ +
Sbjct:   18 NCFPVRSIFKQSEEGGGAWLVSLRAEQRRRFKAVLCSKPKTYSQIKEEKKQSAAPISTPRLQGNLSDEEEGETLDGFYLMKHSCVE-----DPSDLCSVNICGKGITEVKEEDLGLFDNVAYVNAGENFLPFEAFRGFPIIRELEIPLNGLRGIRITRKDFPHMEVLDLSYNNLAKEDILMLGVIPKLRVLHLTGNNFKELPPDLAQPFKSEKEKRMERFPALEILFLDDNKLSDLSTFSALAGLRRLRHLSLEKNNIFSVPQLRLV 279          
BLAST of X-ray radiation resistance-associated protein 1 vs. TrEMBL
Match: A0A1S3IH48 (X-ray radiation resistance-associated protein 1 OS=Lingula unguis OX=7574 GN=LOC106164239 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.281e-26
Identity = 96/267 (35.96%), Postives = 150/267 (56.18%), Query Frame = 1
Query:   61 NYLPVRPLIKCNSDDG-AWVIAQKADQRKRFKAIICN-----LKVTEGFNQSN------RIKY---DHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXX-XXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCI 813
            N  PVR + K + + G AW+++ +A+QR+RFKA++C+      ++ E   QS       R++    D E     + F   K   +E     DP  +  +N+  K +   ++E      +V  ++A  N L  + F  F  + EL +  N +R I I  +DF +LE+LDLS+NNL  EDILMLG++ KL++L+LTGNN + LP D+A P+  +  K   +F +LE L ++ N+L   S+FSAL GL +LR L L  NN  S+P L+ +
Sbjct:   18 NCFPVRSIFKQSEEGGGAWLVSLRAEQRRRFKAVLCSKPKTYSQIKEEKKQSAAPISTPRLQGNLSDEEEGETLDGFYLMKHSCVE-----DPSDLCSVNICGKGITEVKEEDLGLFDNVAYVNAGENFLPFEAFRGFPIIRELEIPLNGLRGIRITRKDFPHLEVLDLSYNNLAKEDILMLGVIPKLRVLHLTGNNFKELPPDLAQPFKSEKEKRMERFPALEILFLDDNKLSDLSTFSALAGLRRLRHLSLEKNNIFSVPQLRLV 279          

HSP 2 Score: 67.3958 bits (163), Expect = 1.474e-7
Identity = 36/102 (35.29%), Postives = 57/102 (55.88%), Query Frame = 1
Query: 1972 PKPFPALEFLDLSFNQIKSERVLIPVIAWLNLKMLSIFNNPISMKKSQKSSFIKVLLENTFKIKVEWLPPISKEKPNPTIK-------KSKLRVVDMVPNVP 2256
            P PFP L++L+L+FNQI+ +  L+PV AW  L  L I +NP++ + S     +K  L++   I+V       ++KP P IK       K+  +V  +VP +P
Sbjct:  526 PPPFPELQYLNLAFNQIEDQEALLPVAAWPMLNELVIHDNPLTTRNSGDPPILKQYLQDRLGIRV------VRKKPQPAIKPHVEVPQKASRKVKTVVPPIP 621          
BLAST of X-ray radiation resistance-associated protein 1 vs. TrEMBL
Match: A0A1I8I1N7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.663e-25
Identity = 86/265 (32.45%), Postives = 139/265 (52.45%), Query Frame = 1
Query:   52 FKMNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAIICN------------LKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXX-XXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLK 807
            +   Y PVRPL++    DGAW++A KA++R+RF  ++                   G +     + D E     + F     ++L   +  DP  +  ++VS ++L   ++E  +   SV  + A  N L L+    F  L EL +  N +RN+ +    F NLE LD+S+N L  +D+  +GLL++L+ L+  GN L  LP DMA P +  DG+A ++F+SLE L ++ N+L    +F++L  L KL++L L  N F  IP L+
Sbjct:  445 YSAQYFPVRPLLRAGESDGAWLVAHKAEERRRFNELLSKQHRASKRQAAAAGSSGRGNSGGAGTQADGEEQTCLDGF-----YLLRVVRVDDPSFVCHVDVSGRNLTEVKEEDLQLFDSVTSLKAGENLLRLEPLNGFPNLRELEIPFNGLRNLQLTADSFPNLEFLDVSYNELTKDDLFNIGLLKRLRRLHAGGNGLAELPEDMALPDIAVDGEAQQRFQSLECLMLDDNRLSDPKAFASLATLRKLKVLSLEKNEFSGIPYLR 704          
BLAST of X-ray radiation resistance-associated protein 1 vs. TrEMBL
Match: A0A1I8I101 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 7.670e-25
Identity = 86/266 (32.33%), Postives = 139/266 (52.26%), Query Frame = 1
Query:   52 FKMNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAII------------CNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXX-XXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKC 810
            +   Y PVRPL++    DGAW++A KA++R+RF  ++                   G +     + D E     + F     ++L   +  DP  +  ++VS ++L   ++E  +   SV  + A  N L L+    F  L EL +  N +RN+ +    F NLE LD+S+N L  +D+  +GLL++L+ L+  GN L  LP DMA P +  DG+A ++F+SLE L ++ N+L    +F++L  L KL++L L  N F  IP L+ 
Sbjct:   38 YSAQYFPVRPLLRAGESDGAWLVAHKAEERRRFNELLSKQHRASKRQAAAAGSSGRGNSGGAGTQADGEEQTCLDGF-----YLLRVVRVDDPSFVCHVDVSGRNLTEVKEEDLQLFDSVTSLKAGENLLRLEPLNGFPNLRELEIPFNGLRNLQLTADSFPNLEFLDVSYNELTKDDLFNIGLLKRLRRLHAGGNGLAELPEDMALPDIAVDGEAQQRFQSLECLMLDDNRLSDPKAFASLATLRKLKVLSLEKNEFSGIPYLRV 298          
BLAST of X-ray radiation resistance-associated protein 1 vs. TrEMBL
Match: A0A267E639 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022969g1 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 9.404e-25
Identity = 86/266 (32.33%), Postives = 139/266 (52.26%), Query Frame = 1
Query:   52 FKMNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAII------------CNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXX-XXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKC 810
            +   Y PVRPL++    DGAW++A KA++R+RF  ++                   G +     + D E     + F     ++L   +  DP  +  ++VS ++L   ++E  +   SV  + A  N L L+    F  L EL +  N +RN+ +    F NLE LD+S+N L  +D+  +GLL++L+ L+  GN L  LP DMA P +  DG+A ++F+SLE L ++ N+L    +F++L  L KL++L L  N F  IP L+ 
Sbjct:   38 YSAQYFPVRPLLRAGESDGAWLVAHKAEERRRFNELLSKQHRASKRQAAAAGSSGRGNSGGAGTQADGEEQTCLDGF-----YLLRVVRVDDPSFVCHVDVSGRNLTEVKEEDLQLFDSVTSLKAGENLLRLEPLNGFPNLRELEIPFNGLRNLQLTADSFPNLEFLDVSYNELTKDDLFNIGLLKRLRRLHAGGNGLAELPEDMALPDIAVDGEAQQRFQSLECLMLDDNRLSDPKAFASLATLRKLKVLSLEKNEFSGIPYLRV 298          
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000008743.2 (X-ray radiation resistance associated 1 [Source:NCBI gene;Acc:101163266])

HSP 1 Score: 76.2554 bits (186), Expect = 8.114e-14
Identity = 80/257 (31.13%), Postives = 131/257 (50.97%), Query Frame = 1
Query:  100 DDGAWVIA--QKADQRKRFKAIICNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXX-XXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAH----PYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNNNQIN 849
            D G W++   +K++ R   +   C  K TE                 A+       F+L+     DP +I  +++S + L S + E ++   ++  IDAS N L+L  F  F  L ELNLS N ++N++++  DF +L++L+LS+N+L  E ++ L  L  LK+L+LTGN L  LP +++     P      +  + FESLE L ++ N+L SS  F +L  L +L+ L L  N    IP   C+++       QI+
Sbjct:   29 DAGCWLLQAHRKSENRAANRGKKC--KTTE-----------------ADQLTLDALFLLQLHCVDDPSQICSVDISEQKLNSVKPEGFQVFENIAYIDASINSLSLGSFSCFPSLRELNLSLNRIQNLDLDSADFHHLQVLNLSYNSLSPESLISLSGLSSLKVLHLTGNGLHHLPPNLSSSDQDPTEMSSEQERKHFESLEVLILDDNKL-SSVVFYSLVNLKRLKHLNLQKNLICEIP---CLQMTRGLTPEQIS 262          
BLAST of X-ray radiation resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000019618.1 (SMESG000019618.1)

HSP 1 Score: 1593.56 bits (4125), Expect = 0.000e+0
Identity = 906/920 (98.48%), Postives = 913/920 (99.24%), Query Frame = 1
Query:   58 MNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNNNQINNYXXXXXXXXXXXXYQNSFFTKNMELRIPSTLHEVEEETTYRTTIDTKSSNEYSPKIVSKEAKVXXXXXXXXXXXXXXQQHQESKDEELEAETEDANSNYRTEINLNAEERNDEEIQPEFINKSEDFTGTSEKNYFEENNAQVFPSAKKTYILXXXXXXXXXXXXXXXXXDFNDNYQHETFSEKKETINPNLDELNIDIQSNQSNNLKENLTEDPEDKINTENTDPFKQEPNFIVIQVKENEINLSNENKEQSDQKSRSNNNNKIMIDKQNSXXXXXXXXXXXXXXXXSGELIPYQEENEDRNQNKENRIAKDNEDDSNKFETLETFDEMKWMSLSQDEENSYHSLVIVNDFMKSSSVSDIIRQLSISSFNENSPKPFPALEFLDLSFNQIKSERVLIPVIAWLNLKMLSIFNNPISMKKSQKSSFIKVLLENTFKIKVEWLPPISKEKPNPTIKKSKLRVVDMVPNVPLNCRKSNAFHTGLIKTEENELNLPKMMPLPNILKQSHPTVHENNSLAIISEMNKPDDDLENDLKEGKSFKLLGRNKTFLMRALQYKIDHPITYFERNVDLFEKQNSLQSIKKRTYQIDERKMGKSENIVLVLKQQKNRVNQSEMSLDKVLSTEFLTLNRKNKQESAIASKALKNMQKKYNQVRLESL 2817
            MNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLESSEDEFYEFSSV+KIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDILMLGLLRKLKILNLTGNNLQ LPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNNNQINNYE D+EEEEEMEDYQNSFFTKNMELRIPSTLHEVEEETTYRTTIDTKSSNEYSPKIVSKEAKVIKEILDEIIDKIDLQQ QESKDEELEAETEDANSNYRTEINLNAEERNDEEIQPEFINKSEDFTGTSEKNYFEENNAQ FPSAKKTYILEIKENIE PINESPS+EDFNDNYQHETFSEKKETINPNLDELNIDIQSNQSNNLKENLTEDPEDKINTENTDPFKQEPNFIVIQVKENEINLSNEN+EQSDQKSRSNNNNKI+IDKQNSKIKIPKENNKENDIENSGELIPYQEENEDRNQNKENRIAKDNE+DSNKFETLETFDEMKWM LSQDEENSYHSLVIVNDFMKSSSVSDIIRQLSISSFNENSPKPFPALEFLDLSFNQIKSERVLIPVIAWLNLKMLSIFNNPISMKKSQKSSFIKVLLENTFKIKVEWLPPISKEKPNPTIKKSKLRVVD VPNVPLNCRKSNAFHTGLIKTEENELNLPKMMPLPNILKQSHPTVHENNSLAIISEMNKPDDDLENDLKEG+SFKLLGRNKTFLMRALQYKIDHPITYFERNVDLFEKQNSLQSIKKRTYQIDERKMGKSENIVLVLKQQKNRVNQSEMSLDKVLSTEFLTLNRKNKQESAIASKALKNMQKKYNQVRLESL
Sbjct:    1 MNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLESSEDEFYEFSSVHKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDILMLGLLRKLKILNLTGNNLQTLPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNNNQINNYEIDYEEEEEMEDYQNSFFTKNMELRIPSTLHEVEEETTYRTTIDTKSSNEYSPKIVSKEAKVIKEILDEIIDKIDLQQPQESKDEELEAETEDANSNYRTEINLNAEERNDEEIQPEFINKSEDFTGTSEKNYFEENNAQDFPSAKKTYILEIKENIEKPINESPSKEDFNDNYQHETFSEKKETINPNLDELNIDIQSNQSNNLKENLTEDPEDKINTENTDPFKQEPNFIVIQVKENEINLSNENEEQSDQKSRSNNNNKIIIDKQNSKIKIPKENNKENDIENSGELIPYQEENEDRNQNKENRIAKDNEEDSNKFETLETFDEMKWMPLSQDEENSYHSLVIVNDFMKSSSVSDIIRQLSISSFNENSPKPFPALEFLDLSFNQIKSERVLIPVIAWLNLKMLSIFNNPISMKKSQKSSFIKVLLENTFKIKVEWLPPISKEKPNPTIKKSKLRVVDTVPNVPLNCRKSNAFHTGLIKTEENELNLPKMMPLPNILKQSHPTVHENNSLAIISEMNKPDDDLENDLKEGQSFKLLGRNKTFLMRALQYKIDHPITYFERNVDLFEKQNSLQSIKKRTYQIDERKMGKSENIVLVLKQQKNRVNQSEMSLDKVLSTEFLTLNRKNKQESAIASKALKNMQKKYNQVRLESL 920          
BLAST of X-ray radiation resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000019618.1 (SMESG000019618.1)

HSP 1 Score: 1587.39 bits (4109), Expect = 0.000e+0
Identity = 905/920 (98.37%), Postives = 912/920 (99.13%), Query Frame = 1
Query:   58 MNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLXXXXXXXXXXXXVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDXXXXXXXXXXXXXXXTGNNLQALPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNNNQINNYXXXXXXXXXXXXYQNSFFTKNMELRIPSTLHEVEEETTYRTTIDTKSSNEYSPKIVSKEAKVXXXXXXXXXXXXXXQQHQESKDEELEAETEDANSNYRTEINLNAEERNDEEIQPEFINKSEDFTGTSEKNYFEENNAQVFPSAKKTYILXXXXXXXXXXXXXXXXXDFNDNYQHETFSEKKETINPNLDELNIDIQSNQSNNLKENLTEDPEDKINTENTDPFKQEPNFIVIQVKENEINLSNENKEQSDQKSRSNNNNKIMIDKQNSXXXXXXXXXXXXXXXXSGELIPYQEENEDRNQNKENRIAKDNEDDSNKFETLETFDEMKWMSLSQDEENSYHSLVIVNDFMKSSSVSDIIRQLSISSFNENSPKPFPALEFLDLSFNQIKSERVLIPVIAWLNLKMLSIFNNPISMKKSQKSSFIKVLLENTFKIKVEWLPPISKEKPNPTIKKSKLRVVDMVPNVPLNCRKSNAFHTGLIKTEENELNLPKMMPLPNILKQSHPTVHENNSLAIISEMNKPDDDLENDLKEGKSFKLLGRNKTFLMRALQYKIDHPITYFERNVDLFEKQNSLQSIKKRTYQIDERKMGKSENIVLVLKQQKNRVNQSEMSLDKVLSTEFLTLNRKNKQESAIASKALKNMQKKYNQVRLESL 2817
            MNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLESSEDEFYEFSSV+KIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDILMLGLLRKLKILNLTGNNLQ LPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNNNQINNYE D+EEEEEMEDYQNSFFTKNMELRIPSTLHEVEEETTYRTTIDTKSSNEYSPKIVSKEAKVIKEILDEIIDKIDLQQ QESKDEELEAETEDANSNYRTEINLNAEERNDEEIQPEFINKSEDFTGTSEKNYFEENNAQ FPSAKKTYILEIKENIE PINESPS+EDFNDNYQHETFSEKKETINPNLDELNIDIQSNQSNNLKENLTEDPEDKINTENTDPFKQEPNFIVIQVKENEINLSNEN+EQSDQKSRSNNNNKI+IDKQNSKIKIPKENNKENDIENSGELIPYQEENEDRNQNKENRIAKDNE+DSNKFETLETFDEMKWM LSQD ENSYHSLVIVNDFMKSSSVSDIIRQLSISSFNENSPKPFPALEFLDLSFNQIKSERVLIPVIAWLNLKMLSIFNNPISMKKSQKSSFIKVLLENTFKIKVEWLPPISKEKPNPTIKKSKLRVVD VPNVPLNCRKSNAFHTGLIKTEENELNLPKMMPLPNILKQSHPTVHENNSLAIISEMNKPDDDLENDLKEG+SFKLLGRNKTFLMRALQYKIDHPITYFERNVDLFEKQNSLQSIKKRTYQIDERKMGKSENIVLVLKQQKNRVNQSEMSLDKVLSTEFLTLNRKNKQESAIASKALKNMQKKYNQVRLESL
Sbjct:    1 MNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRIKYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLESSEDEFYEFSSVHKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLEILDLSFNNLCSEDILMLGLLRKLKILNLTGNNLQTLPLDMAHPYMGDDGKAYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLKCIKLKTNSNNNQINNYEIDYEEEEEMEDYQNSFFTKNMELRIPSTLHEVEEETTYRTTIDTKSSNEYSPKIVSKEAKVIKEILDEIIDKIDLQQPQESKDEELEAETEDANSNYRTEINLNAEERNDEEIQPEFINKSEDFTGTSEKNYFEENNAQDFPSAKKTYILEIKENIEKPINESPSKEDFNDNYQHETFSEKKETINPNLDELNIDIQSNQSNNLKENLTEDPEDKINTENTDPFKQEPNFIVIQVKENEINLSNENEEQSDQKSRSNNNNKIIIDKQNSKIKIPKENNKENDIENSGELIPYQEENEDRNQNKENRIAKDNEEDSNKFETLETFDEMKWMPLSQD-ENSYHSLVIVNDFMKSSSVSDIIRQLSISSFNENSPKPFPALEFLDLSFNQIKSERVLIPVIAWLNLKMLSIFNNPISMKKSQKSSFIKVLLENTFKIKVEWLPPISKEKPNPTIKKSKLRVVDTVPNVPLNCRKSNAFHTGLIKTEENELNLPKMMPLPNILKQSHPTVHENNSLAIISEMNKPDDDLENDLKEGQSFKLLGRNKTFLMRALQYKIDHPITYFERNVDLFEKQNSLQSIKKRTYQIDERKMGKSENIVLVLKQQKNRVNQSEMSLDKVLSTEFLTLNRKNKQESAIASKALKNMQKKYNQVRLESL 919          
The following BLAST results are available for this feature:
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
XRRA12.490e-1933.58X-ray radiation resistance associated 1 [Source:HG... [more]
XRRA14.990e-1831.46X-ray radiation resistance associated 1 [Source:HG... [more]
XRRA18.558e-1831.46X-ray radiation resistance associated 1 [Source:HG... [more]
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xrra12.250e-1646.26X-ray radiation resistance associated 1 [Source:ZF... [more]
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Xrra15.381e-2133.09X-ray radiation resistance associated 1 [Source:MG... [more]
Xrra14.170e-2033.09X-ray radiation resistance associated 1 [Source:MG... [more]
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q3U3V8|XRRA1_MOUSE2.917e-1933.09X-ray radiation resistance-associated protein 1 OS... [more]
sp|Q6P2D8|XRRA1_HUMAN4.110e-1731.46X-ray radiation resistance-associated protein 1 OS... [more]
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MPY64.908e-2735.58X-ray radiation resistance-associated protein 1-li... [more]
A0A1S3IH481.281e-2635.96X-ray radiation resistance-associated protein 1 OS... [more]
A0A1I8I1N76.663e-2532.45Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I1017.670e-2532.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E6399.404e-2532.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000008743.28.114e-1431.13X-ray radiation resistance associated 1 [Source:NC... [more]
back to top
BLAST of X-ray radiation resistance-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000019618.10.000e+098.48SMESG000019618.1[more]
SMESG000019618.10.000e+098.37SMESG000019618.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015511 ID=SMED30015511|Name=X-ray radiation resistance-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2903bp
TGTTTAAATAATGCAATATGTTGGTTACAAATTAGAGTAACATCGCGATA
ATTCAAAATGAATTATTTGCCTGTAAGACCGTTAATTAAATGCAATTCTG
ATGATGGAGCTTGGGTAATAGCACAAAAAGCAGATCAAAGAAAACGGTTT
AAAGCAATAATATGTAACTTGAAAGTAACCGAAGGTTTTAATCAGTCAAA
TAGAATAAAATACGACCATGAAAGTAATGCCAATGCCAATAATTTCAAGT
TCTCCAAAGAATTTATTTTAGAGAATTGCAAAACTGTTGATCCAGATAAA
ATAGCCGTGATCAATGTCAGTTTTAAAGATCTGGAGTCATCGGAAGATGA
ATTCTATGAATTTTCATCAGTCTATAAAATCGATGCATCTAGCAATCGAT
TAACTTTAGATGATTTTATAACATTTATTCCTCTTATTGAGTTGAATTTG
TCTTCAAATAATGTAAGAAATATAAATATTAATCCCCAAGACTTTGAAAA
TTTAGAGATATTAGATTTATCATTCAATAATCTCTGCAGTGAAGATATAT
TAATGCTTGGACTTTTGAGGAAATTAAAAATTCTCAATTTAACAGGAAAC
AATTTACAGGCATTACCTTTGGATATGGCTCATCCCTATATGGGCGACGA
TGGAAAAGCCTATAGGAAATTTGAAAGTCTTGAAGAACTCCACATAGAAT
ACAACCAACTGCACTCAAGTAGCTCTTTTTCGGCACTAGGTGGCCTCCCA
AAACTTCGGATTTTAAAACTTGCACATAATAATTTTGAATCAATCCCAAT
GTTGAAATGTATAAAATTGAAGACTAACAGCAACAATAATCAAATAAACA
ACTATGAATTCGACTTCGAAGAAGAGGAAGAAATGGAAGATTATCAAAAT
TCATTCTTTACAAAAAACATGGAATTAAGAATTCCGAGTACTTTGCATGA
AGTTGAAGAAGAAACAACTTACCGAACCACAATTGATACAAAAAGTTCCA
ATGAGTATTCTCCTAAAATCGTCTCTAAAGAAGCAAAAGTTATAAAAGAG
ATACTTGATGAAATAATAGATAAAATAGATTTACAACAACATCAAGAAAG
CAAGGATGAAGAACTAGAAGCTGAAACTGAAGATGCAAATTCGAATTACA
GAACTGAAATTAATTTAAATGCTGAAGAAAGAAATGATGAAGAAATTCAA
CCAGAATTTATAAATAAATCGGAAGACTTCACTGGAACTTCTGAGAAAAA
TTATTTTGAAGAAAACAATGCTCAAGTTTTTCCATCAGCCAAAAAGACAT
ATATCTTAGAAATCAAAGAAAATATTGAAATACCGATAAACGAGAGCCCT
TCCGAAGAAGATTTTAATGATAATTATCAACATGAAACATTTTCCGAAAA
AAAAGAAACGATAAATCCTAACCTTGACGAACTCAACATTGATATTCAAA
GCAACCAAAGTAATAATCTGAAAGAAAATTTAACAGAAGATCCTGAGGAT
AAAATTAATACAGAAAATACCGATCCGTTTAAACAAGAACCAAACTTTAT
AGTTATTCAAGTGAAAGAAAATGAAATCAATCTCTCGAATGAAAACAAAG
AACAAAGTGATCAAAAATCCAGATCAAATAATAATAATAAAATCATGATT
GATAAACAGAATTCAAAAATAAAAATACCAAAAGAAAATAACAAAGAAAA
TGACATTGAAAATTCGGGTGAGTTGATTCCTTATCAGGAAGAAAATGAAG
ACAGAAATCAGAATAAGGAGAACAGAATTGCAAAAGATAACGAAGATGAT
TCAAATAAATTTGAAACACTGGAAACGTTTGATGAAATGAAATGGATGTC
ACTTAGCCAGGATGAAGAAAATTCATACCACTCATTAGTAATTGTAAATG
ATTTTATGAAGTCGTCTTCAGTGTCTGATATTATTCGACAGTTGTCCATA
AGTTCTTTCAATGAAAACTCACCAAAACCATTTCCAGCTCTTGAATTTTT
AGATTTATCTTTCAATCAAATTAAGTCAGAACGGGTTCTTATTCCTGTCA
TAGCATGGCTCAATTTAAAAATGTTATCAATTTTCAATAATCCTATTTCA
ATGAAAAAGTCACAGAAATCATCATTTATAAAAGTGCTATTAGAAAATAC
TTTTAAGATAAAAGTGGAATGGCTGCCACCGATTTCAAAAGAAAAACCAA
ATCCTACCATTAAAAAATCTAAATTACGAGTGGTCGACATGGTACCAAAT
GTGCCTTTGAATTGTAGAAAATCAAATGCATTCCATACTGGTCTAATCAA
AACTGAAGAAAATGAATTGAACTTACCGAAAATGATGCCTTTACCAAATA
TTTTGAAACAATCACATCCTACAGTTCACGAAAATAATAGTTTAGCAATA
ATATCAGAAATGAACAAGCCAGATGATGACTTGGAAAATGATCTGAAAGA
AGGCAAGTCTTTCAAATTATTAGGAAGAAATAAAACTTTTTTAATGCGAG
CTTTACAATATAAAATAGACCACCCTATAACATATTTTGAAAGAAATGTA
GATTTGTTTGAGAAACAAAATTCTCTTCAATCAATCAAAAAAAGAACATA
TCAAATTGATGAAAGAAAAATGGGGAAATCAGAAAATATTGTATTGGTTC
TGAAACAACAAAAAAATCGTGTTAACCAATCAGAAATGTCTTTAGATAAA
GTTTTGAGCACGGAGTTTCTTACTTTAAATCGAAAAAATAAACAAGAATC
AGCGATTGCATCAAAAGCCTTAAAAAATATGCAAAAGAAATACAATCAAG
TCAGATTAGAAAGTTTAAATAAAGAATATTAAGAGATAAATAAAATTAAT
AAAATTATATCGTTAATCTTTGAGTTTTAACGATAAAAACAATTATTTAT
TAG
back to top

protein sequence of SMED30015511-orf-1

>SMED30015511-orf-1 ID=SMED30015511-orf-1|Name=SMED30015511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=925bp
MNYLPVRPLIKCNSDDGAWVIAQKADQRKRFKAIICNLKVTEGFNQSNRI
KYDHESNANANNFKFSKEFILENCKTVDPDKIAVINVSFKDLESSEDEFY
EFSSVYKIDASSNRLTLDDFITFIPLIELNLSSNNVRNININPQDFENLE
ILDLSFNNLCSEDILMLGLLRKLKILNLTGNNLQALPLDMAHPYMGDDGK
AYRKFESLEELHIEYNQLHSSSSFSALGGLPKLRILKLAHNNFESIPMLK
CIKLKTNSNNNQINNYEFDFEEEEEMEDYQNSFFTKNMELRIPSTLHEVE
EETTYRTTIDTKSSNEYSPKIVSKEAKVIKEILDEIIDKIDLQQHQESKD
EELEAETEDANSNYRTEINLNAEERNDEEIQPEFINKSEDFTGTSEKNYF
EENNAQVFPSAKKTYILEIKENIEIPINESPSEEDFNDNYQHETFSEKKE
TINPNLDELNIDIQSNQSNNLKENLTEDPEDKINTENTDPFKQEPNFIVI
QVKENEINLSNENKEQSDQKSRSNNNNKIMIDKQNSKIKIPKENNKENDI
ENSGELIPYQEENEDRNQNKENRIAKDNEDDSNKFETLETFDEMKWMSLS
QDEENSYHSLVIVNDFMKSSSVSDIIRQLSISSFNENSPKPFPALEFLDL
SFNQIKSERVLIPVIAWLNLKMLSIFNNPISMKKSQKSSFIKVLLENTFK
IKVEWLPPISKEKPNPTIKKSKLRVVDMVPNVPLNCRKSNAFHTGLIKTE
ENELNLPKMMPLPNILKQSHPTVHENNSLAIISEMNKPDDDLENDLKEGK
SFKLLGRNKTFLMRALQYKIDHPITYFERNVDLFEKQNSLQSIKKRTYQI
DERKMGKSENIVLVLKQQKNRVNQSEMSLDKVLSTEFLTLNRKNKQESAI
ASKALKNMQKKYNQVRLESLNKEY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038894XRRA1
IPR003591Leu-rich_rpt_typical-subtyp
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0016604nuclear body
Vocabulary: biological process
TermDefinition
GO:0010165response to X-ray
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 560..580
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 559..584
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 535..550
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 510..584
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 83..680
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 170..193
e-value: 1.1
score: 18.3
coord: 642..669
e-value: 190.0
score: 2.7
coord: 205..228
e-value: 270.0
score: 1.5
coord: 230..251
e-value: 8.4
score: 13.9
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 148..167
e-value: 1.7
score: 8.9
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 125..145
score: 5.71
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 644..665
score: 6.634
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 207..228
score: 6.418
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 172..193
score: 7.003
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 232..253
score: 7.489
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 148..168
score: 6.834
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 198..304
e-value: 8.5E-9
score: 36.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 582..703
e-value: 6.4E-7
score: 30.8
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 10..195
e-value: 5.3E-14
score: 53.9
IPR038894X-ray radiation resistance-associated protein 1PANTHERPTHR22710X-RAY RADIATION RESISTANCE ASSOCIATED PROTEIN 1 XRRA1coord: 608..731
coord: 16..259