BRCA1-associated protein

Overview
NameBRCA1-associated protein
Smed IDSMED30015506
Length (bp)1974
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BRCA1-associated protein (SMED30015506) t-SNE clustered cells

Violin plots show distribution of expression levels for BRCA1-associated protein (SMED30015506) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BRCA1-associated protein (SMED30015506) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BRCA1-associated protein (SMED30015506) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015506

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30015506SMESG000049888.1 SmedASXL_012215SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30015506SMESG000049888.1 dd_Smed_v4_4083_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015506SMESG000049888.1 dd_Smed_v4_4083_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015506SMESG000049888.1 dd_Smed_v4_4083_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BRCA1-associated protein vs. Ensembl Human
Match: BRAP (BRCA1 associated protein [Source:HGNC Symbol;Acc:HGNC:1099])

HSP 1 Score: 328.176 bits (840), Expect = 1.040e-103
Identity = 171/403 (42.43%), Postives = 260/403 (64.52%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAYLESEFCM-------KLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLK-----------SKDDELKNLQEQLSDLMINLQMGSKIAE--AQSRGELNEDEIN 1589
            +LC+++VP +M+  D++ F A + + I++MK+++DSTPN+Y+VL+KFR+  DAD+FY   N   FNS+E  VC L YV   E L S      P++DLTELP C VCLER+DE +NGILT +CNH+FHS+C+Q+ +++TCPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     ++K+ ++ +EY+ +L  QL SQR Y E++          +++ ++ K +   E C NLE     +L++KQ +ER+ +Q+ T   +L  + +EE  MN  L   Q  L   LK            KD ++  +QEQL D+M  L+   KI    A++R E+ E +IN
Sbjct:  132 MLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQIN 533          
BLAST of BRCA1-associated protein vs. Ensembl Human
Match: BRAP (BRCA1 associated protein [Source:HGNC Symbol;Acc:HGNC:1099])

HSP 1 Score: 327.791 bits (839), Expect = 2.952e-103
Identity = 171/403 (42.43%), Postives = 260/403 (64.52%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAYLESEFCM-------KLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLK-----------SKDDELKNLQEQLSDLMINLQMGSKIAE--AQSRGELNEDEIN 1589
            +LC+++VP +M+  D++ F A + + I++MK+++DSTPN+Y+VL+KFR+  DAD+FY   N   FNS+E  VC L YV   E L S      P++DLTELP C VCLER+DE +NGILT +CNH+FHS+C+Q+ +++TCPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     ++K+ ++ +EY+ +L  QL SQR Y E++          +++ ++ K +   E C NLE     +L++KQ +ER+ +Q+ T   +L  + +EE  MN  L   Q  L   LK            KD ++  +QEQL D+M  L+   KI    A++R E+ E +IN
Sbjct:  162 MLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQIN 563          
BLAST of BRCA1-associated protein vs. Ensembl Human
Match: USP13 (ubiquitin specific peptidase 13 [Source:HGNC Symbol;Acc:HGNC:12611])

HSP 1 Score: 57.3806 bits (137), Expect = 8.675e-8
Identity = 36/115 (31.30%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  759 VCLERLDEPLNGILTIVCNHTFHSKCIQQMN-----ESTCPVCRYPQT-------PQIMSDKYKCAMCDLREDLWLCLICANIGCGR------HENKHAELHFYDTGHTFAMKIG 1049
            + L  ++E L  ++TI C+    SK   +       E+  PV +Y           +I    +KCA CDLRE+LWL L   ++ CG+        N HA  H+ D G+  A+K+G
Sbjct:   83 IALPNIEE-LPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLG 196          
BLAST of BRCA1-associated protein vs. Ensembl Human
Match: USP13 (ubiquitin specific peptidase 13 [Source:HGNC Symbol;Acc:HGNC:12611])

HSP 1 Score: 56.9954 bits (136), Expect = 1.096e-7
Identity = 36/115 (31.30%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  759 VCLERLDEPLNGILTIVCNHTFHSKCIQQMN-----ESTCPVCRYPQT-------PQIMSDKYKCAMCDLREDLWLCLICANIGCGR------HENKHAELHFYDTGHTFAMKIG 1049
            + L  ++E L  ++TI C+    SK   +       E+  PV +Y           +I    +KCA CDLRE+LWL L   ++ CG+        N HA  H+ D G+  A+K+G
Sbjct:  148 IALPNIEE-LPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLG 261          
BLAST of BRCA1-associated protein vs. Ensembl Human
Match: USP44 (ubiquitin specific peptidase 44 [Source:HGNC Symbol;Acc:HGNC:20064])

HSP 1 Score: 51.2174 bits (121), Expect = 2.032e-7
Identity = 21/61 (34.43%), Postives = 36/61 (59.02%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL C+++ CGR+  +HA  HF ++ H  A+++    V+ Y  D +V
Sbjct:   26 KWHCVDCNTTESIWACLSCSHVACGRYIEEHALKHFQESSHPVALEVNEMYVFCYLCDDYV 86          
BLAST of BRCA1-associated protein vs. Ensembl Celegans
Match: brap-2 (BRCA1-associated protein homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:Q95QN6])

HSP 1 Score: 261.151 bits (666), Expect = 2.104e-78
Identity = 161/442 (36.43%), Postives = 253/442 (57.24%), Query Frame = 3
Query:  390 NLMKFRKNSFSNRTKIST-RVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP---DDK------KLSSICMEYTAMLADQLSSQRAYLES-----EFCMK------LSIVENKLEHQ----QEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQ----NHLNKTLKSK-------DDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSL 1607
             +M F K +    TK++  R+LCM +VP  + +R+++ F       I  +KVV+D  PN+Y++++KF+  +DA  FY+ FNN  FN LES  C L +V  +E   S          LTELPTC VCLER+D   + +L I+CNH+FH++C++Q  ++TCPVCRY Q+P++++++ +C  C +  DLW+CLIC NIGCGR+  +HA+ H+  T HT+++K+G   VWDYA D +VHRL+ N +DGK VE   E     DDK      KL  I +EYT +L  QL  QR Y E      E  M        + VEN LEHQ        K+L+ D    +  ++  E++ +Q      +L  + ++E  +N  L   Q      + K ++S+       + ++++LQ Q++DL+++ +  +K+ E    G++ ++EI  S V L
Sbjct:  138 GIMHFYKYNDEKLTKVAQCRMLCMYAVPAQVEVREIISFMCISLPMIVSIKVVRDPAPNQYMLIIKFKEHNDAVTFYEEFNNCPFNDLESYCCTLFFVDRIECTTSNDLFSSDDTSLTELPTCAVCLERMD---DSVLAILCNHSFHARCLEQWADNTCPVCRYVQSPEVVAEQ-RCNDCGMSNDLWICLICGNIGCGRYAEQHAQRHWELTSHTYSLKVGGERVWDYAGDNYVHRLIENGADGKLVEYQRESNASFDDKNQKGGDKLEGIKLEYTLLLTSQLEDQRKYFEGLRHDMEQTMSKMEKTAYAQVEN-LEHQLTERSTELKSLKGDLDDTVTARKVAEKRATQTNEKVNKLANELKDEREINQMLRKDQQVWKGQVEKLIESQKTARTEYEKKIEDLQSQVNDLLMHFETQNKLKEQLDAGKITQEEITESQVEL 574          
BLAST of BRCA1-associated protein vs. Ensembl Celegans
Match: hda-6 (Histone deacetylase 6 [Source:UniProtKB/Swiss-Prot;Acc:Q20296])

HSP 1 Score: 58.5362 bits (140), Expect = 4.641e-10
Identity = 26/81 (32.10%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  855 STCPVCR--YPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVH 1091
            +TCP  +   P  P  ++ +  C+ C +  ++W CL C    CGR  N+HA +H   + H  A+ + +  VW Y  D++VH
Sbjct:   36 ATCPHLKEVKPLPPAKINARTACSECQIGAEVWTCLTCYKYNCGRFVNEHAMMHHLSSSHPMALSMADLSVWCYPCDSYVH 116          
BLAST of BRCA1-associated protein vs. Ensembl Celegans
Match: hda-6 (Histone deacetylase 6 [Source:UniProtKB/Swiss-Prot;Acc:Q20296])

HSP 1 Score: 58.5362 bits (140), Expect = 4.641e-10
Identity = 26/81 (32.10%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  855 STCPVCR--YPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVH 1091
            +TCP  +   P  P  ++ +  C+ C +  ++W CL C    CGR  N+HA +H   + H  A+ + +  VW Y  D++VH
Sbjct:   36 ATCPHLKEVKPLPPAKINARTACSECQIGAEVWTCLTCYKYNCGRFVNEHAMMHHLSSSHPMALSMADLSVWCYPCDSYVH 116          
BLAST of BRCA1-associated protein vs. Ensembl Celegans
Match: hda-6 (Histone deacetylase 6 [Source:UniProtKB/Swiss-Prot;Acc:Q20296])

HSP 1 Score: 60.4622 bits (145), Expect = 3.453e-9
Identity = 26/81 (32.10%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  855 STCPVCR--YPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVH 1091
            +TCP  +   P  P  ++ +  C+ C +  ++W CL C    CGR  N+HA +H   + H  A+ + +  VW Y  D++VH
Sbjct:  855 ATCPHLKEVKPLPPAKINARTACSECQIGAEVWTCLTCYKYNCGRFVNEHAMMHHLSSSHPMALSMADLSVWCYPCDSYVH 935          
BLAST of BRCA1-associated protein vs. Ensembl Celegans
Match: hda-6 (Histone deacetylase 6 [Source:UniProtKB/Swiss-Prot;Acc:Q20296])

HSP 1 Score: 60.4622 bits (145), Expect = 3.570e-9
Identity = 26/81 (32.10%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  855 STCPVCR--YPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVH 1091
            +TCP  +   P  P  ++ +  C+ C +  ++W CL C    CGR  N+HA +H   + H  A+ + +  VW Y  D++VH
Sbjct:  853 ATCPHLKEVKPLPPAKINARTACSECQIGAEVWTCLTCYKYNCGRFVNEHAMMHHLSSSHPMALSMADLSVWCYPCDSYVH 933          
BLAST of BRCA1-associated protein vs. Ensembl Fly
Match: CG5555 (gene:FBgn0038686 transcript:FBtr0083746)

HSP 1 Score: 280.796 bits (717), Expect = 4.297e-86
Identity = 156/408 (38.24%), Postives = 243/408 (59.56%), Query Frame = 3
Query:  402 FRKNSFSNRTKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLES-SVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAE-DPDDKKLSSICMEYTAMLADQLSSQRAYLESEFCMKLSIVENKLEHQQEICKN-------LEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQN-----------HLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRG 1565
            ++KN      +  +  LC+++VP +++  D+L+F A     I  +++V+D +PN+++VLL+FRS + A  FYK++N   +NSLE  S+CH  +VS VE     S  G P +  TELPTCPVCLER+DE ++G+LTI+CNH FH+ C+ +  +STCPVCR+ QTP ++ D   C  C+  + LW+CLIC ++GCGR++  HA  HF  T HTFAM++G + VWDYA D  VHRL  N SDGK V    E D  ++K+ S+ ME+T +L  QL +QR Y E     ++  +E + ++ +    +       L++  Q++ ++K  +ER+ +Q     K +QKQ  EE  ++ +L   Q+             N+  ++ D E+  L+EQL D+M  L    K+A  +  G
Sbjct:  134 YKKNERKAIKEAPSNQLCLLAVPATLNCHDLLNFIAPCHAEIKHIQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWVSEVER----SEHGAPPMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQTPGLVEDSV-CMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNFVHRLFQNKSDGKLVASQTEKDEREEKIDSMQMEFTYLLTSQLDTQRKYYEE----RMERLEQEWQNHKATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQSSWHGKYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKLANTEIAG 532          
BLAST of BRCA1-associated protein vs. Ensembl Fly
Match: CG5555 (gene:FBgn0038686 transcript:FBtr0332165)

HSP 1 Score: 280.796 bits (717), Expect = 4.451e-86
Identity = 156/408 (38.24%), Postives = 243/408 (59.56%), Query Frame = 3
Query:  402 FRKNSFSNRTKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLES-SVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAE-DPDDKKLSSICMEYTAMLADQLSSQRAYLESEFCMKLSIVENKLEHQQEICKN-------LEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQN-----------HLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRG 1565
            ++KN      +  +  LC+++VP +++  D+L+F A     I  +++V+D +PN+++VLL+FRS + A  FYK++N   +NSLE  S+CH  +VS VE     S  G P +  TELPTCPVCLER+DE ++G+LTI+CNH FH+ C+ +  +STCPVCR+ QTP ++ D   C  C+  + LW+CLIC ++GCGR++  HA  HF  T HTFAM++G + VWDYA D  VHRL  N SDGK V    E D  ++K+ S+ ME+T +L  QL +QR Y E     ++  +E + ++ +    +       L++  Q++ ++K  +ER+ +Q     K +QKQ  EE  ++ +L   Q+             N+  ++ D E+  L+EQL D+M  L    K+A  +  G
Sbjct:  137 YKKNERKAIKEAPSNQLCLLAVPATLNCHDLLNFIAPCHAEIKHIQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWVSEVER----SEHGAPPMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQTPGLVEDSV-CMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNFVHRLFQNKSDGKLVASQTEKDEREEKIDSMQMEFTYLLTSQLDTQRKYYEE----RMERLEQEWQNHKATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQSSWHGKYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKLANTEIAG 535          
BLAST of BRCA1-associated protein vs. Ensembl Fly
Match: HDAC6 (gene:FBgn0026428 transcript:FBtr0074009)

HSP 1 Score: 57.3806 bits (137), Expect = 4.592e-8
Identity = 27/80 (33.75%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  858 TCP---VCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            TCP   + R  + P+ +    +C++C    + W+CL C ++ CGR+ N H E H  +  H  AM   +  VW YA  A+V
Sbjct:  995 TCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYV 1074          
BLAST of BRCA1-associated protein vs. Ensembl Fly
Match: HDAC6 (gene:FBgn0026428 transcript:FBtr0074008)

HSP 1 Score: 56.9954 bits (136), Expect = 5.034e-8
Identity = 27/80 (33.75%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  858 TCP---VCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            TCP   + R  + P+ +    +C++C    + W+CL C ++ CGR+ N H E H  +  H  AM   +  VW YA  A+V
Sbjct:  985 TCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYV 1064          
BLAST of BRCA1-associated protein vs. Ensembl Fly
Match: HDAC6 (gene:FBgn0026428 transcript:FBtr0074010)

HSP 1 Score: 56.9954 bits (136), Expect = 5.084e-8
Identity = 27/80 (33.75%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  858 TCP---VCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            TCP   + R  + P+ +    +C++C    + W+CL C ++ CGR+ N H E H  +  H  AM   +  VW YA  A+V
Sbjct:  992 TCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYV 1071          
BLAST of BRCA1-associated protein vs. Ensembl Zebrafish
Match: brap (BRCA1 associated protein [Source:ZFIN;Acc:ZDB-GENE-040718-168])

HSP 1 Score: 328.176 bits (840), Expect = 8.353e-104
Identity = 173/428 (40.42%), Postives = 268/428 (62.62%), Query Frame = 3
Query:  402 FRKNSFSNRTKISTR--VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAY-------LESEFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLK-----------SKDDELKNLQEQLSDLMINLQMGSKI--AEAQSRGELNEDEINSSSVSLGP 1613
            ++ N  ++ T+   R  +LC+++VP +M+  D++ F A Y D ++ MK+++DSTPN+Y+VL+KFRS  DAD+FY   N   FNS+E +VC L YV   E + S      P++DLTELP C VCLER+DE +NG+LT +CNH+FHS+C+Q+  +++CPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     D+K+ ++ +EY+ +L  QL SQR Y       LE +   +++ ++ K +   + C +LE     + +DKQ I+++ SQ+     +L ++  EE  MN  L   Q  L   L+           +KD ++  LQEQL D+M  L+   +I    A +R E+ E +IN +S    P
Sbjct:  129 YKTNKMTSLTEDVRRSAMLCILTVPTTMTSHDLMKFVAPYNDVMEHMKIIRDSTPNQYMVLVKFRSQADADSFYTTCNGRQFNSIEDAVCQLVYVERAEVIKSEEGASLPVMDLTELPKCTVCLERMDESVNGVLTTLCNHSFHSQCLQRWEDASCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKMVQYECEGDTCQDEKIDALQLEYSYLLTSQLESQRIYWENKIVHLEKDTAEEINNMKAKFKETIDKCDSLERKLNELAKDKQSIDKKCSQLNNKVAKLSQELREEQEMNRCLRANQTQLQAQLQEEERRVQDTAANKDGQIAELQEQLRDVMFYLETQQQIDRMPADTRQEIQEGQINIASAPAAP 555          
BLAST of BRCA1-associated protein vs. Ensembl Zebrafish
Match: usp44 (ubiquitin specific peptidase 44 [Source:NCBI gene;Acc:393227])

HSP 1 Score: 51.6026 bits (122), Expect = 2.508e-6
Identity = 21/61 (34.43%), Postives = 35/61 (57.38%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL C+++ CGR+  +HA  HF +  H  A+++    V+ Y  D +V
Sbjct:   23 KWHCVDCNTTESVWACLSCSHVACGRYIEEHALQHFKEQHHPLALEVNELYVYCYLCDDYV 83          
BLAST of BRCA1-associated protein vs. Ensembl Zebrafish
Match: usp44 (ubiquitin specific peptidase 44 [Source:NCBI gene;Acc:393227])

HSP 1 Score: 51.6026 bits (122), Expect = 2.508e-6
Identity = 21/61 (34.43%), Postives = 35/61 (57.38%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL C+++ CGR+  +HA  HF +  H  A+++    V+ Y  D +V
Sbjct:   23 KWHCVDCNTTESVWACLSCSHVACGRYIEEHALQHFKEQHHPLALEVNELYVYCYLCDDYV 83          
BLAST of BRCA1-associated protein vs. Ensembl Zebrafish
Match: hdac6 (histone deacetylase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-3232])

HSP 1 Score: 51.9878 bits (123), Expect = 2.788e-6
Identity = 21/62 (33.87%), Postives = 33/62 (53.23%), Query Frame = 3
Query:  915 CAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLV 1100
            C  C    + W+CL C  + CGR+ N+H   H  ++GH   +   +  VW YA +++VH  V
Sbjct:  999 CEECGGEAENWICLFCYKVLCGRYVNQHMVTHGQESGHPVVLSFADLSVWCYACESYVHNKV 1060          
BLAST of BRCA1-associated protein vs. Ensembl Zebrafish
Match: hdac6 (histone deacetylase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-3232])

HSP 1 Score: 51.9878 bits (123), Expect = 2.788e-6
Identity = 21/62 (33.87%), Postives = 33/62 (53.23%), Query Frame = 3
Query:  915 CAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLV 1100
            C  C    + W+CL C  + CGR+ N+H   H  ++GH   +   +  VW YA +++VH  V
Sbjct:  999 CEECGGEAENWICLFCYKVLCGRYVNQHMVTHGQESGHPVVLSFADLSVWCYACESYVHNKV 1060          
BLAST of BRCA1-associated protein vs. Ensembl Xenopus
Match: BRAP (BRCA1 associated protein [Source:NCBI gene;Acc:100488470])

HSP 1 Score: 321.627 bits (823), Expect = 3.313e-101
Identity = 172/408 (42.16%), Postives = 259/408 (63.48%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAY-------LESEFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLK-----------SKDDELKNLQEQLSDLMINLQMGSKIAE--AQSRGELNEDEINSSSVS 1604
            +LC+++VP +M+  D++ F AS+ + I+ MK+++DSTPN+Y+VL+KF S  DAD+FY   N   FNS+E  VC L YV   E L S      P++DLTELP C VCLER+DE +NGILT +CNH+FHS+C+Q+  ++TCPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     D+K+ S+ +EY+ +L  QL SQR Y       LE +   +++ ++ K +   + C +LE     + ++KQ +ER+ +Q+ +   +L  + +EE  MN  L   Q  L   L+            KD +L  +QEQL D+M  L+   KI    A +R E+ + +IN +S S
Sbjct:  142 MLCILTVPATMTSHDLMKFVASFNEVIEHMKIIRDSTPNQYMVLIKFSSQADADSFYMANNGRQFNSIEEDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWEDTTCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQDEKIDSLQLEYSYLLTSQLESQRIYWENKIVRLEKDTAEEINNMKAKFKETIDKCDSLEHRLNDLSKEKQAVERRCAQLNSKVAKLSTELKEEQEMNKCLRANQTMLQSRLREEEIMRKETCEQKDVQLLEMQEQLRDVMFYLETQQKINHMPADTRQEIQDGQINIASPS 548          
BLAST of BRCA1-associated protein vs. Ensembl Xenopus
Match: BRAP (BRCA1 associated protein [Source:NCBI gene;Acc:100488470])

HSP 1 Score: 321.627 bits (823), Expect = 5.090e-101
Identity = 172/408 (42.16%), Postives = 259/408 (63.48%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAY-------LESEFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLK-----------SKDDELKNLQEQLSDLMINLQMGSKI--AEAQSRGELNEDEINSSSVS 1604
            +LC+++VP +M+  D++ F AS+ + I+ MK+++DSTPN+Y+VL+KF S  DAD+FY   N   FNS+E  VC L YV   E L S      P++DLTELP C VCLER+DE +NGILT +CNH+FHS+C+Q+  ++TCPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     D+K+ S+ +EY+ +L  QL SQR Y       LE +   +++ ++ K +   + C +LE     + ++KQ +ER+ +Q+ +   +L  + +EE  MN  L   Q  L   L+            KD +L  +QEQL D+M  L+   KI    A +R E+ + +IN +S S
Sbjct:  160 MLCILTVPATMTSHDLMKFVASFNEVIEHMKIIRDSTPNQYMVLIKFSSQADADSFYMANNGRQFNSIEEDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWEDTTCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQDEKIDSLQLEYSYLLTSQLESQRIYWENKIVRLEKDTAEEINNMKAKFKETIDKCDSLEHRLNDLSKEKQAVERRCAQLNSKVAKLSTELKEEQEMNKCLRANQTMLQSRLREEEIMRKETCEQKDVQLLEMQEQLRDVMFYLETQQKINHMPADTRQEIQDGQINIASPS 566          
BLAST of BRCA1-associated protein vs. Ensembl Xenopus
Match: ncbp3 (nuclear cap binding subunit 3 [Source:Xenbase;Acc:XB-GENE-5831122])

HSP 1 Score: 54.6842 bits (130), Expect = 4.816e-7
Identity = 22/61 (36.07%), Postives = 36/61 (59.02%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL C+++ CGR+  +HA  HF D+ H  A+++    V+ Y  D +V
Sbjct:   23 KWHCVDCNTTESVWACLSCSHVACGRYIEEHALRHFQDSKHPLALEVNELYVFCYLCDDYV 83          
BLAST of BRCA1-associated protein vs. Ensembl Xenopus
Match: adrm1 (adhesion regulating molecule 1 [Source:Xenbase;Acc:XB-GENE-489445])

HSP 1 Score: 54.299 bits (129), Expect = 6.195e-7
Identity = 25/62 (40.32%), Postives = 36/62 (58.06%), Query Frame = 3
Query:  885 TPQIMSDKYKCAMCDLREDLWLCLICANIGCGRH------ENKHAELHFYDTGHTFAMKIGN 1052
             P+I    +KC++CDLRE+LWL +    I CGR        N HA  H+ +TG+  A+K+G 
Sbjct:  188 VPRIPPCGWKCSVCDLRENLWLNMTDGAILCGRRYFDGSGGNNHALQHYQETGYPLAVKLGT 249          
BLAST of BRCA1-associated protein vs. Ensembl Xenopus
Match: adrm1 (adhesion regulating molecule 1 [Source:Xenbase;Acc:XB-GENE-489445])

HSP 1 Score: 54.299 bits (129), Expect = 6.213e-7
Identity = 25/62 (40.32%), Postives = 36/62 (58.06%), Query Frame = 3
Query:  885 TPQIMSDKYKCAMCDLREDLWLCLICANIGCGRH------ENKHAELHFYDTGHTFAMKIGN 1052
             P+I    +KC++CDLRE+LWL +    I CGR        N HA  H+ +TG+  A+K+G 
Sbjct:  180 VPRIPPCGWKCSVCDLRENLWLNMTDGAILCGRRYFDGSGGNNHALQHYQETGYPLAVKLGT 241          
BLAST of BRCA1-associated protein vs. Ensembl Mouse
Match: Brap (BRCA1 associated protein [Source:MGI Symbol;Acc:MGI:1919649])

HSP 1 Score: 319.701 bits (818), Expect = 9.114e-101
Identity = 169/410 (41.22%), Postives = 263/410 (64.15%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAYLESEFCM-------KLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHL-------------NKTLKSKDDELKNLQEQLSDLMINLQMGSKIAE--AQSRGELNEDEINSSSVS 1604
            +LC+++VP +M+  D++ F A + D I++MK+++DSTPN+Y+VL+KF +  DAD+FY   N   FNS+E  VC L YV   E L S      P++DLTELP C VCLER+DE +NGILT +CNH+FHS+C+Q+ +++TCPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     ++K+ ++ +EY+ +L  QL SQR Y E++          +++ ++ K +   E C +LE     +L++KQ +ER+ +Q+ T   +L  + +EE  +N  L  R N L              +T   KD ++  +QEQL D+M  L+   +I+   A++R E+ E +IN +  S
Sbjct:  131 MLCVLTVPATMTSHDLMKFVAPFNDVIEQMKIIRDSTPNQYMVLIKFSAQADADSFYMACNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDSLELRLSDLLKEKQSVERKCTQLNTRVAKLSTELQEEQELNKCL--RANQLVLQNQLKEEEKLLKETCAQKDLQITEIQEQLRDVMFYLETQQQISHLPAETRQEIQEGQINIAMAS 537          
BLAST of BRCA1-associated protein vs. Ensembl Mouse
Match: Brap (BRCA1 associated protein [Source:MGI Symbol;Acc:MGI:1919649])

HSP 1 Score: 320.087 bits (819), Expect = 1.880e-100
Identity = 169/410 (41.22%), Postives = 263/410 (64.15%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAYLESEFCM-------KLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHL-------------NKTLKSKDDELKNLQEQLSDLMINLQMGSKIAE--AQSRGELNEDEINSSSVS 1604
            +LC+++VP +M+  D++ F A + D I++MK+++DSTPN+Y+VL+KF +  DAD+FY   N   FNS+E  VC L YV   E L S      P++DLTELP C VCLER+DE +NGILT +CNH+FHS+C+Q+ +++TCPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     ++K+ ++ +EY+ +L  QL SQR Y E++          +++ ++ K +   E C +LE     +L++KQ +ER+ +Q+ T   +L  + +EE  +N  L  R N L              +T   KD ++  +QEQL D+M  L+   +I+   A++R E+ E +IN +  S
Sbjct:  161 MLCVLTVPATMTSHDLMKFVAPFNDVIEQMKIIRDSTPNQYMVLIKFSAQADADSFYMACNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDSLELRLSDLLKEKQSVERKCTQLNTRVAKLSTELQEEQELNKCL--RANQLVLQNQLKEEEKLLKETCAQKDLQITEIQEQLRDVMFYLETQQQISHLPAETRQEIQEGQINIAMAS 567          
BLAST of BRCA1-associated protein vs. Ensembl Mouse
Match: Brap (BRCA1 associated protein [Source:MGI Symbol;Acc:MGI:1919649])

HSP 1 Score: 60.4622 bits (145), Expect = 1.425e-13
Identity = 22/47 (46.81%), Postives = 39/47 (82.98%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKF 587
            +LC+++VP +M+  D++ F A + D I++MK+++DSTPN+Y+VL+KF
Sbjct:  117 MLCVLTVPATMTSHDLMKFVAPFNDVIEQMKIIRDSTPNQYMVLIKF 163          

HSP 2 Score: 35.8094 bits (81), Expect = 1.425e-13
Identity = 14/23 (60.87%), Postives = 17/23 (73.91%), Query Frame = 1
Query:  262 DIINFISGNPANEITEGIIHFYK 330
            D I+F SGNP+ EI  GI+H YK
Sbjct:   79 DQISFFSGNPSVEIVHGIMHLYK 101          
BLAST of BRCA1-associated protein vs. Ensembl Mouse
Match: Usp13 (ubiquitin specific peptidase 13 (isopeptidase T-3) [Source:MGI Symbol;Acc:MGI:1919857])

HSP 1 Score: 57.3806 bits (137), Expect = 5.613e-8
Identity = 36/115 (31.30%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  759 VCLERLDEPLNGILTIVCNHTFHSKCIQQMN-----ESTCPVCRYPQT-------PQIMSDKYKCAMCDLREDLWLCLICANIGCGR------HENKHAELHFYDTGHTFAMKIG 1049
            + L  ++E L  ++TI C+    SK   +       E+  PV +Y           +I    +KCA CDLRE+LWL L   ++ CG+        N HA  H+ D G+  A+K+G
Sbjct:  146 IALPNIEE-LPALVTIACDAVLSSKSPYRKQDPDTWENEVPVSKYANNLVQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLG 259          
BLAST of BRCA1-associated protein vs. Ensembl Mouse
Match: Usp13 (ubiquitin specific peptidase 13 (isopeptidase T-3) [Source:MGI Symbol;Acc:MGI:1919857])

HSP 1 Score: 57.3806 bits (137), Expect = 5.806e-8
Identity = 36/115 (31.30%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  759 VCLERLDEPLNGILTIVCNHTFHSKCIQQMN-----ESTCPVCRYPQT-------PQIMSDKYKCAMCDLREDLWLCLICANIGCGR------HENKHAELHFYDTGHTFAMKIG 1049
            + L  ++E L  ++TI C+    SK   +       E+  PV +Y           +I    +KCA CDLRE+LWL L   ++ CG+        N HA  H+ D G+  A+K+G
Sbjct:  145 IALPNIEE-LPALVTIACDAVLSSKSPYRKQDPDTWENEVPVSKYANNLVQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHALEHYRDMGYPLAVKLG 258          
BLAST of BRCA1-associated protein vs. UniProt/SwissProt
Match: sp|Q7Z569|BRAP_HUMAN (BRCA1-associated protein OS=Homo sapiens OX=9606 GN=BRAP PE=1 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 1.418e-102
Identity = 171/403 (42.43%), Postives = 260/403 (64.52%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAYLESEFCM-------KLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLK-----------SKDDELKNLQEQLSDLMINLQMGSKIAE--AQSRGELNEDEIN 1589
            +LC+++VP +M+  D++ F A + + I++MK+++DSTPN+Y+VL+KFR+  DAD+FY   N   FNS+E  VC L YV   E L S      P++DLTELP C VCLER+DE +NGILT +CNH+FHS+C+Q+ +++TCPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     ++K+ ++ +EY+ +L  QL SQR Y E++          +++ ++ K +   E C NLE     +L++KQ +ER+ +Q+ T   +L  + +EE  MN  L   Q  L   LK            KD ++  +QEQL D+M  L+   KI    A++R E+ E +IN
Sbjct:  162 MLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQIN 563          
BLAST of BRCA1-associated protein vs. UniProt/SwissProt
Match: sp|Q99MP8|BRAP_MOUSE (BRCA1-associated protein OS=Mus musculus OX=10090 GN=Brap PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.315e-99
Identity = 169/410 (41.22%), Postives = 263/410 (64.15%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP--DDKKLSSICMEYTAMLADQLSSQRAYLESEFCM-------KLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHL-------------NKTLKSKDDELKNLQEQLSDLMINLQMGSKIAE--AQSRGELNEDEINSSSVS 1604
            +LC+++VP +M+  D++ F A + D I++MK+++DSTPN+Y+VL+KF +  DAD+FY   N   FNS+E  VC L YV   E L S      P++DLTELP C VCLER+DE +NGILT +CNH+FHS+C+Q+ +++TCPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E     ++K+ ++ +EY+ +L  QL SQR Y E++          +++ ++ K +   E C +LE     +L++KQ +ER+ +Q+ T   +L  + +EE  +N  L  R N L              +T   KD ++  +QEQL D+M  L+   +I+   A++R E+ E +IN +  S
Sbjct:  161 MLCVLTVPATMTSHDLMKFVAPFNDVIEQMKIIRDSTPNQYMVLIKFSAQADADSFYMACNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDSLELRLSDLLKEKQSVERKCTQLNTRVAKLSTELQEEQELNKCL--RANQLVLQNQLKEEEKLLKETCAQKDLQITEIQEQLRDVMFYLETQQQISHLPAETRQEIQEGQINIAMAS 567          
BLAST of BRCA1-associated protein vs. UniProt/SwissProt
Match: sp|Q95QN6|BRAP2_CAEEL (BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans OX=6239 GN=brap-2 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 2.676e-77
Identity = 161/442 (36.43%), Postives = 253/442 (57.24%), Query Frame = 3
Query:  390 NLMKFRKNSFSNRTKIST-RVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDP---DDK------KLSSICMEYTAMLADQLSSQRAYLES-----EFCMK------LSIVENKLEHQ----QEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQ----NHLNKTLKSK-------DDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSL 1607
             +M F K +    TK++  R+LCM +VP  + +R+++ F       I  +KVV+D  PN+Y++++KF+  +DA  FY+ FNN  FN LES  C L +V  +E   S          LTELPTC VCLER+D   + +L I+CNH+FH++C++Q  ++TCPVCRY Q+P++++++ +C  C +  DLW+CLIC NIGCGR+  +HA+ H+  T HT+++K+G   VWDYA D +VHRL+ N +DGK VE   E     DDK      KL  I +EYT +L  QL  QR Y E      E  M        + VEN LEHQ        K+L+ D    +  ++  E++ +Q      +L  + ++E  +N  L   Q      + K ++S+       + ++++LQ Q++DL+++ +  +K+ E    G++ ++EI  S V L
Sbjct:  138 GIMHFYKYNDEKLTKVAQCRMLCMYAVPAQVEVREIISFMCISLPMIVSIKVVRDPAPNQYMLIIKFKEHNDAVTFYEEFNNCPFNDLESYCCTLFFVDRIECTTSNDLFSSDDTSLTELPTCAVCLERMD---DSVLAILCNHSFHARCLEQWADNTCPVCRYVQSPEVVAEQ-RCNDCGMSNDLWICLICGNIGCGRYAEQHAQRHWELTSHTYSLKVGGERVWDYAGDNYVHRLIENGADGKLVEYQRESNASFDDKNQKGGDKLEGIKLEYTLLLTSQLEDQRKYFEGLRHDMEQTMSKMEKTAYAQVEN-LEHQLTERSTELKSLKGDLDDTVTARKVAEKRATQTNEKVNKLANELKDEREINQMLRKDQQVWKGQVEKLIESQKTARTEYEKKIEDLQSQVNDLLMHFETQNKLKEQLDAGKITQEEITESQVEL 574          
BLAST of BRCA1-associated protein vs. UniProt/SwissProt
Match: sp|O13747|EPT1_SCHPO (RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC16E8.13 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 2.215e-63
Identity = 149/434 (34.33%), Postives = 217/434 (50.00%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYR-DFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHV---------------ESLASLSSTGFPLVD--LTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDPDDKKLSS----------ICMEYTAMLADQLSSQRAYLESEF---CMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQ--------FSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQ-------EQLSDLMINLQMGSKIAEAQSRGELNEDEI---NSSSV 1601
            +L ++++P  MS  DVL F        I  ++++K   PN  + LLKF+       FY  FN   F+ ++   CH+ ++  V               + L   SS  F      L ELPTC VCLER+D  + G++TIVC HTFH  C+Q+   S+CPVCRY Q  Q    + KC +C   +DLW+CLIC NIGCGR+ + HA+ H+ DT H +AM++    VWDYA D +VHRL+ + +DGK VE+  +        S          + +EYT +L  QL SQR Y ES       KLS V  +L  + +I      +  + LR +  I             ++++  + L+   EEE SMN +LL R   L K   +K D++ ++Q       EQL DLM  +    +I +     EL    I   N+S+V
Sbjct:   88 ILAILAIPLYMSPSDVLGFLGEKHCKSIQHIRLLKTKDPNRIMALLKFKDQASVIRFYTEFNGKAFSQIDPETCHVLHIDKVNIKYPMESSDSSSTEQQLVGPSSKPFASTTPALIELPTCVVCLERMDSSITGLITIVCQHTFHCPCLQKWGNSSCPVCRYTQKVQSSEFQSKCTVCCYDKDLWICLICGNIGCGRYHDAHAKQHYVDTAHCYAMELETQRVWDYAGDNYVHRLLQSETDGKLVELSTDGKSSGWTGSSATESKLRDKMGLEYTQILVSQLESQRLYYESHLSNMSQKLSRVNEELVLKTKIA-TASSNANTDLRSRVDISESKLKKRDDKLKRVSSQLEHLKHNYEEEKSMNENLLVRIQTLEKQNTTKSDQIVSMQFQINDLNEQLRDLMFTISASQEIQKMGQSEELQNGTIVLPNNSTV 520          
BLAST of BRCA1-associated protein vs. UniProt/SwissProt
Match: sp|O80996|BRIZ2_ARATH (BRAP2 RING ZnF UBP domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=BRIZ2 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.210e-57
Identity = 123/390 (31.54%), Postives = 218/390 (55.90%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVK-DSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLA---SLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDPDDKKLSSICMEY--TAMLADQLSSQRAYLESEFCMKLSI-VENKLEHQQEICKNLEEDYQSVLRD--KQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLN-----------KTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQ 1556
            ++C++ VP  M+  D   F  S+   I +M+ V+ D   N Y +L++F S +  D F+++F    FNSL+  VC L +   V+      S+  T        E PTCPVCLERLD+   GILT +CNH+FH  CI    +S+CPVCRY Q      +   C +C   E+LW+C+IC  +GCGR++  HA  H+ +T H +++++    VWDYA D +VHRL+ + +DGK VE+++     K     C EY  + M    L+S+   + SE+   L   +EN+ ++ +++ +N++E+ +  + +   + I ++  ++ T F +  K+++    +N +L+  ++  +           K +++KD++++ L+EQL +LM  +   S+++E +
Sbjct:   61 LVCVLGVPNHMTYADFCQFCGSFIQHILDMRTVRNDDIENRYSILIRFDSQESTDTFFQHFRGKQFNSLDEDVCRLLFALDVQFTGYSGSIDHTQPSAAGPIEQPTCPVCLERLDQDTGGILTTMCNHSFHCSCISNWPDSSCPVCRYCQQ---QPENSVCCVCQTTENLWMCVICGVVGCGRYKEGHARRHWEETEHCYSLELETQRVWDYAGDNYVHRLIQSKTDGKLVELNSHGSLSKDGCGSC-EYSDSGMTDALLNSKVDMIISEYNELLQAQLENQKQYFEKLLQNVKEETEQKISEAASKAISQRLQKLQTRFDRCVKEKQFLEDLNENLVKNKDVWSTKITEMKEREKKAVRAKDEKIQGLEEQLGNLMAQMDGESEVSETK 446          
BLAST of BRCA1-associated protein vs. TrEMBL
Match: A0A4V3SCA6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010221 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 2.319e-110
Identity = 178/402 (44.28%), Postives = 266/402 (66.17%), Query Frame = 3
Query:  429 TKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGIL-TIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDA-EDPDDKKLSSICMEYTAMLADQLSSQRAYLES-------EFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSL 1607
            +++S+ +LC+ SVP  ++++D+L F A  RD ++E+KVVK+  PN Y+ LLKFRS  + D FY+ +NN  + +LES VC L YVSHV+       T FP  DL ELP+CPVCLERLDEP+ GIL TI+CNH+FH +CI ++ + TCPVCRY Q+P+++ D+ +CA C +R++LW+CLIC  IGCGR+  KHA+LHF  TGHTFA+++G NLVWDYA DA+VHRL  N  DGK V+V A  +  DKKL  + ME++A+L  QL SQRAY ES       E  +++   E+K+E        +++    + ++K    R+  Q  +  ++LQK+ EEE ++N SLL+ ++      +  + E K  +E+  +L++NL+  SK+ E  S  +L+  E+ +  +S+
Sbjct:  122 SRVSSTMLCIFSVPSYLTVKDLLSFVAPMRDSVEELKVVKNGGPNHYMALLKFRSEQETDQFYRTYNNTCYRNLESEVCQLMYVSHVDKTHPAMGTAFPTKDLLELPSCPVCLERLDEPVQGILTTILCNHSFHDECIARVEDITCPVCRYMQSPELL-DESQCADCCIRDNLWICLICGRIGCGRYGRKHAQLHFEQTGHTFALELGKNLVWDYADDAYVHRLAVNHEDGKLVQVGAGSETGDKKLDLMSMEFSAVLTSQLESQRAYFESQLERITTESAIRIQAAESKVEELSSTLNQVQQHLNELTKEKSSTVRKLQQATSLAQRLQKELEEERALNKSLLNNESIWRSRAEKAEAEAKTSKEECKELLLNLEFRSKLTEFASSEQLSSGELENCEISI 522          
BLAST of BRCA1-associated protein vs. TrEMBL
Match: A0A1S8X3D8 (Zinc finger, C3HC4 type OS=Opisthorchis viverrini OX=6198 GN=X801_02881 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 4.866e-110
Identity = 178/402 (44.28%), Postives = 265/402 (65.92%), Query Frame = 3
Query:  429 TKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGIL-TIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDA-EDPDDKKLSSICMEYTAMLADQLSSQRAYLES-------EFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSL 1607
            +++S+ +LC+ SVP  ++++D+L F A  RD ++E+KVVK+  PN Y+ LLKFRS  + D FY  +NN  + +LES VC L YVSHV+       T FP  DL ELP+CPVCLERLDEP+ GIL TI+CNH+FH +CI ++ + TCPVCRY Q+P+++ D+ +CA C +R++LW+CLIC  IGCGR+  KHA+LHF  TGHTFA+++G NLVWDYA DA+VHRL  N  DGK V+V A  +  DKKL  + ME++A+L  QL SQRAY ES       E  +++   E+K+E        +++    + ++K    R+  Q  +  ++LQK+ EEE ++N SLL+ ++      +  + E K  +E+  +L++NL+  SK+ E  S  +L+  E+ +  +S+
Sbjct:  121 SRVSSTMLCIFSVPSYLTVKDLLSFVAPMRDSVEELKVVKNGGPNHYMALLKFRSEQETDQFYHTYNNTCYRNLESEVCQLMYVSHVDKTHPAMGTAFPTKDLLELPSCPVCLERLDEPVQGILTTILCNHSFHDECIARVEDITCPVCRYMQSPELL-DESQCADCCIRDNLWICLICGRIGCGRYGRKHAQLHFEQTGHTFALELGKNLVWDYADDAYVHRLAVNHEDGKLVQVGAGSETGDKKLDLMSMEFSAVLTSQLESQRAYFESQLERITTESAIRIQAAESKVEELSSTLNQVQQQLNELTKEKSSTIRKLQQATSLAQRLQKELEEERALNKSLLNNESIWRSRAEKAEAEAKTSKEECKELLLNLEFRSKLTEFASSEQLSSGELENCEISI 521          
BLAST of BRCA1-associated protein vs. TrEMBL
Match: A0A0X3Q1G9 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR134896 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 9.820e-108
Identity = 170/400 (42.50%), Postives = 262/400 (65.50%), Query Frame = 3
Query:  438 STRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILT-IVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEV-DAEDPDDKKLSSICMEYTAMLADQLSSQRAYLESEF-------CMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSLG 1610
            ++ +LCM+ +P +++++D+L+F A  R  I E+K+VK S    Y+ LL F + + AD FY+  N + +NSLE  +C LAY+SHVE++ S     FPL  L ELP+CPVCLE+LDEP+ GILT I+CNH FH +CI Q  E+TCPVCRY Q+P++++D  +CA C+LRE+LW+CLIC ++GCGR+  KHA  HF +TGHTFA+++G NLVWDYA DA+VHR+  N  DGK V++ +  +  DKKL  +  E++A++  QL SQR Y ES+          + + +E+KLE  + +  +LE    ++ ++K  + ++ SQ  T  ++LQ +  EE ++ +SL   Q    +  K+ +   +  QE++ DL++N +M  K+ E   RGEL  ++I    +S+G
Sbjct:   44 TSSMLCMLGIPSNITVKDLLNFCAPMRRGILELKIVKGSHVGRYMALLNFENQEYADQFYEALNGVAYNSLEPDICQLAYISHVEAIHSSLGGTFPLRGLVELPSCPVCLEKLDEPVQGILTTILCNHNFHDECISQTTETTCPVCRYVQSPEMVADS-QCADCELRENLWICLICGHVGCGRYGQKHAHRHFQETGHTFALELGKNLVWDYADDAYVHRIAVNQEDGKLVQLGEGSETGDKKLDCLNTEFSAIMISQLESQRQYFESQLDIITSESAARTADIEDKLEKTRLMVSDLESKVATLTKEKTMLAQKLSQANTLTQKLQSELAEEKALTVSLSKSQILWEERAKNAELTAQMAQEEVRDLLLNFEMRDKLTEVSERGELTSEDIAGGQISIG 442          
BLAST of BRCA1-associated protein vs. TrEMBL
Match: A0A0X3QFS2 (BRCA1-associated protein OS=Schistocephalus solidus OX=70667 GN=BRAP PE=4 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 5.657e-107
Identity = 170/400 (42.50%), Postives = 262/400 (65.50%), Query Frame = 3
Query:  438 STRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILT-IVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEV-DAEDPDDKKLSSICMEYTAMLADQLSSQRAYLESEF-------CMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSLG 1610
            ++ +LCM+ +P +++++D+L+F A  R  I E+K+VK S    Y+ LL F + + AD FY+  N + +NSLE  +C LAY+SHVE++ S     FPL  L ELP+CPVCLE+LDEP+ GILT I+CNH FH +CI Q  E+TCPVCRY Q+P++++D  +CA C+LRE+LW+CLIC ++GCGR+  KHA  HF +TGHTFA+++G NLVWDYA DA+VHR+  N  DGK V++ +  +  DKKL  +  E++A++  QL SQR Y ES+          + + +E+KLE  + +  +LE    ++ ++K  + ++ SQ  T  ++LQ +  EE ++ +SL   Q    +  K+ +   +  QE++ DL++N +M  K+ E   RGEL  ++I    +S+G
Sbjct:  114 TSSMLCMLGIPSNITVKDLLNFCAPMRRGILELKIVKGSHVGRYMALLNFENQEYADQFYEALNGVAYNSLEPDICQLAYISHVEAIHSSLGGTFPLRGLVELPSCPVCLEKLDEPVQGILTTILCNHNFHDECISQTTETTCPVCRYVQSPEMVADS-QCADCELRENLWICLICGHVGCGRYGQKHAHRHFQETGHTFALELGKNLVWDYADDAYVHRIAVNQEDGKLVQLGEGSETGDKKLDCLNTEFSAIMISQLESQRQYFESQLDIITSESAARTADIEDKLEKTRLMVSDLESKVATLTKEKTMLAQKLSQANTLTQKLQSELAEEKALTVSLSKSQILWEERAKNAELTAQMAQEEVRDLLLNFEMRDKLTEVSERGELTSEDIAGGQISIG 512          
BLAST of BRCA1-associated protein vs. TrEMBL
Match: A0A074ZZV8 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_02196 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 1.439e-106
Identity = 176/402 (43.78%), Postives = 260/402 (64.68%), Query Frame = 3
Query:  429 TKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGIL-TIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDA-EDPDDKKLSSICMEYTAMLADQLSSQRAYLES-------EFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSL 1607
            +++S+ +LC+ SVP  ++++D+L F A  RD ++E+KVVK+  PN Y+ LLKFRS  + D FY  +NN  + +LES VC L YVSHV+       T FP  DL ELP+CPVCLERLDEP+ GIL TI+CNH+FH +CI ++ + TCPVCRY Q+P+++ D+ +CA C +R++LW+CLIC  IGCGR+  KHA+LHF  TGHTFA+++G NLVWDYA DA+VHRL  N  DGK V+V A  +  DKKL  + ME++A+L  QL SQRAY ES       E  +++   E+K+E        +++    + ++K    R+           QK+ EEE ++N SLL+ ++      +  + E K  +E+  +L++NL+  SK+ E  S  +L+  E+ +  +S+
Sbjct:   98 SRVSSTMLCIFSVPSYLTVKDLLSFVAPMRDSVEELKVVKNGGPNHYMALLKFRSEQETDQFYHTYNNTCYRNLESEVCQLMYVSHVDKTHPAMGTAFPTKDLLELPSCPVCLERLDEPVQGILTTILCNHSFHDECIARVEDITCPVCRYMQSPELL-DESQCADCCIRDNLWICLICGRIGCGRYGRKHAQLHFEQTGHTFALELGKNLVWDYADDAYVHRLAVNHEDGKLVQVGAGSETGDKKLDLMSMEFSAVLTSQLESQRAYFESQLERITTESAIRIQAAESKVEELSSTLNQVQQQLNELTKEKSSTIRKLQ---------QKELEEERALNKSLLNNESIWRSRAEKAEAEAKTSKEECKELLLNLEFRSKLTEFASSEQLSSGELENCEISI 489          
BLAST of BRCA1-associated protein vs. Ensembl Cavefish
Match: brap (BRCA1 associated protein [Source:ZFIN;Acc:ZDB-GENE-040718-168])

HSP 1 Score: 281.952 bits (720), Expect = 3.022e-86
Identity = 161/435 (37.01%), Postives = 251/435 (57.70%), Query Frame = 3
Query:  402 FRKNSFSNRTKISTR--VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV------HRLVANTSDGKPVEVDAEDPDDKKLSSICME--YTAMLADQLSSQRAY-------LESEFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTL-----------KSKDDELKNLQEQLSDLMINLQMGSKIAE--AQSRGELNEDEIN-SSSVSLGP 1613
            ++ N  ++ T+   R  +LC+++VP +M+  D++ F A + D ++ MK+++DSTPN+Y+VL+KF +  DAD+FY   N   FNS+E +VC L YV   E + S      P+++LTELP C VCLER+DE +NG+LT +CNH+FHS+C+Q+  +++CPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA   H       H L                   K   + C +  Y+ +L  QL SQR Y       LE E   +++ ++ K +   E C NLE+    + +DKQ +E++ +Q+     +L ++  EE  MN  L   Q  L   L             KD ++  LQEQL D+M  L+   +I +  A +R E+ E +IN +++   GP
Sbjct:  135 YKTNKMTSLTEDVRRSAMLCVLTVPTTMTSHDLMKFVAPFNDVMEHMKIIRDSTPNQYMVLIKFSTQADADSFYTACNGRQFNSIEDAVCQLVYVQRAEVIKSEEGASLPVMNLTELPKCTVCLERMDESVNGVLTTLCNHSFHSQCLQRWEDASCPVCRYCQTPEQVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGGTHTVISFIKHHL-------------------KHQFNWCQKCLYSYLLTSQLESQRIYWENKIVHLEKETAEEINNMKAKFKETIEKCDNLEQRLNELSKDKQSVEKKCTQLNGKVTKLVQELREEQEMNRCLRANQVQLQTQLHEEERRGQEAAAQKDVQIAELQEQLRDIMFYLETQQQIDQMPADARQEIQEGQINIAAAPQPGP 549          
BLAST of BRCA1-associated protein vs. Ensembl Cavefish
Match: ENSAMXT00000019549.2 (pep primary_assembly:Astyanax_mexicanus-2.0:11:9777104:9794273:1 gene:ENSAMXG00000018983.2 transcript:ENSAMXT00000019549.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 1.208e-6
Identity = 23/60 (38.33%), Postives = 34/60 (56.67%), Query Frame = 3
Query:  891 QIMSDKYKCAMCDLREDLWLCLICANIGCGRH------ENKHAELHFYDTGHTFAMKIGN 1052
            +I    +KC +C+L+E+LW+ L    + CGR        N HA LHF  TG+  A+K+G 
Sbjct:  182 KIPPSGWKCEVCELQENLWMNLTDGKVMCGRRYFDGSGGNNHALLHFQQTGYPLAVKLGT 241          
BLAST of BRCA1-associated protein vs. Ensembl Cavefish
Match: ENSAMXT00000031620.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:9777104:9799795:1 gene:ENSAMXG00000018983.2 transcript:ENSAMXT00000031620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.723e-6
Identity = 23/60 (38.33%), Postives = 34/60 (56.67%), Query Frame = 3
Query:  891 QIMSDKYKCAMCDLREDLWLCLICANIGCGRH------ENKHAELHFYDTGHTFAMKIGN 1052
            +I    +KC +C+L+E+LW+ L    + CGR        N HA LHF  TG+  A+K+G 
Sbjct:  180 KIPPSGWKCEVCELQENLWMNLTDGKVMCGRRYFDGSGGNNHALLHFQQTGYPLAVKLGT 239          
BLAST of BRCA1-associated protein vs. Ensembl Cavefish
Match: usp44 (ubiquitin specific peptidase 44 [Source:NCBI gene;Acc:103036803])

HSP 1 Score: 50.8322 bits (120), Expect = 4.438e-6
Identity = 21/61 (34.43%), Postives = 35/61 (57.38%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL C+++ CGR+  +HA  HF +  H  A+++    V+ Y  D +V
Sbjct:   23 KWHCVDCNTTESVWGCLSCSHVACGRYIEEHALQHFQEQHHPLALEVNELYVFCYLCDDYV 83          
BLAST of BRCA1-associated protein vs. Ensembl Cavefish
Match: usp44 (ubiquitin specific peptidase 44 [Source:NCBI gene;Acc:103036803])

HSP 1 Score: 50.8322 bits (120), Expect = 4.438e-6
Identity = 21/61 (34.43%), Postives = 35/61 (57.38%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL C+++ CGR+  +HA  HF +  H  A+++    V+ Y  D +V
Sbjct:   23 KWHCVDCNTTESVWGCLSCSHVACGRYIEEHALQHFQEQHHPLALEVNELYVFCYLCDDYV 83          
BLAST of BRCA1-associated protein vs. Ensembl Yeast
Match: ETP1 (Protein of unknown function required for growth on ethanol; contains a zinc finger region and has homology to human BRAP2, which is a cytoplasmic protein that binds nuclear localization sequences [Source:SGD;Acc:S000001002])

HSP 1 Score: 174.866 bits (442), Expect = 1.512e-47
Identity = 136/450 (30.22%), Postives = 209/450 (46.44%), Query Frame = 3
Query:  447 VLCMISVPRSMSIRDVLDFTASYRDFIDE----MKVVKDSTPN---EYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASL-----SSTGFPLVDLTE--------------LPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTP-------QIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDPDD----------------------------KKLSSIC----------MEYTAMLADQLSSQRAYLESEFCMKLSIVEN--KLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLD--------RQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEA 1553
            ++C++ VP   ++ D+L F     D +++     +++++        + VL+KFR+  DA NF + FN  +F+ ++   CH+  V  +     L     ++  FP + LT+              LPTCPVCLER+D    G++TI C HTFH +C+ +   S CPVCR+           +   D   CA C   ++LW+CLIC N+GCGR+ +KHA  H+ +T H FAM I    VWDYA D +VHRLV N  DGK VEV     DD                            KK   +           +EY  +L  QL SQR Y E +   K     +   +E  ++  ++L+  +Q   ++ Q+ E     MA      QK + EE  + I  L         +Q  L +  K+ ++  ++L+EQ+ DLM  L    K  +A
Sbjct:  114 MICILFVPTYFTVHDLLHFYIG-DDIVNKQVSNFRILRNQQKGMGFNFTVLIKFRNALDAKNFKEEFNGKSFSRMDPETCHVISVKEIVFQKKLFQRPAANEDFPYL-LTDPFTVKKKKELVKVELPTCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSRCPVCRHSSLRLSRESLLKQAGDSAHCATCGSTDNLWICLICGNVGCGRYNSKHAIKHYEETLHCFAMDIRTQRVWDYAGDNYVHRLVQNEVDGKLVEVGGSGDDDNNDIGNSDELQNVVYGNRSKNGEKSNSNKKDGELAANFLRHREYHLEYVQVLISQLESQREYYELKLQEKDQTASDSSNVESLKKSMEDLKLQFQVTQKEWQKRE-----MA------QKSKLEEDMLVIEGLQANLDHLSKKQEQLERENKALEESKQDLEEQVKDLMFYLDSQEKFKDA 550          
BLAST of BRCA1-associated protein vs. Ensembl Yeast
Match: UBP14 (Ubiquitin-specific protease; specifically disassembles unanchored ubiquitin chains; involved in fructose-1,6-bisphosphatase (Fbp1p) degradation; similar to human isopeptidase T [Source:SGD;Acc:S000000262])

HSP 1 Score: 56.6102 bits (135), Expect = 9.955e-9
Identity = 29/74 (39.19%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  855 STCPVC---RYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHE-----NKHAELHFY-DTGHTFAMKIG 1049
            STCP     + P  P+   +  +C+ CDL ++LWLCL C NIGCGR +     + HA  H+  +  H  A+K+G
Sbjct:  169 STCPHTENFQIPSKPENTVNLNQCSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPLAIKLG 242          
BLAST of BRCA1-associated protein vs. Ensembl Nematostella
Match: EDO31557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXK5])

HSP 1 Score: 302.753 bits (774), Expect = 4.042e-96
Identity = 164/415 (39.52%), Postives = 252/415 (60.72%), Query Frame = 3
Query:  441 TRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDPDDKKLSSICMEYTAMLADQLSSQRAYLESEFC-------MKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQ-----------NHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEA--QSRGELNEDEI----NSSSVSLGP 1613
            ++ +CM++VP  ++  D+L F A   +FI+ +K+++D++PN+Y+ L+KF+  + A  FY  FN   +NS E  VCHL YV+ VE + S          LTELP CPVCLER+DE + G+LTI+CNH+FH  C+ + +++TCPVCRY QTP+  ++  KC MCD RE LW+CLIC +IGCGR+++ HA  HF DT HT+++++G   VWDY  D +VHRLV N +DGK VE      DD+KL S+ +EYT +L +QL +QR Y + +          +++  E + +   E CK LE       ++K+  E++++Q+     +L  + +EE  +N  L + Q           N   ++ K +  E++ LQEQ++DLM +LQ    IA A  ++R EL E ++     SSS +  P
Sbjct:   38 SQTICMLAVPAKLTCIDLLQFVAPSEEFIENIKIIRDASPNQYMALIKFK--NQAHEFYNTFNGQQYNSFEEEVCHLVYVAKVEIVKSSEGASLACPGLTELPKCPVCLERMDESVEGVLTILCNHSFHGSCLSKWSDTTCPVCRYLQTPETTTEN-KCFMCDSRESLWICLICGHIGCGRYQSSHAYRHFEDTNHTYSLQLGTQRVWDYTGDNYVHRLVQNKTDGKLVEFVG---DDEKLDSLTLEYTYLLTNQLENQRLYFQEKVTRIETEAAAQVAEEEERSKKTLEECKKLEMKLADCEKEKRNFEKKYNQVVGKVGKLVNELKEEKELNKCLRENQAAWQEKVIEIENKFQESEKIRTTEVRELQEQVADLMHHLQAQEAIACAPQETRQELQEGQMFVGEGSSSQNRKP 446          
BLAST of BRCA1-associated protein vs. Ensembl Medaka
Match: brap (BRCA1 associated protein [Source:NCBI gene;Acc:101157072])

HSP 1 Score: 265.774 bits (678), Expect = 1.266e-80
Identity = 154/420 (36.67%), Postives = 244/420 (58.10%), Query Frame = 3
Query:  402 FRKNSFSNRTKISTR--VLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDPDDKKLSSICMEYTAMLADQLSSQRAYLESEFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKN-----LQEQLSDLMINLQMGSKIAE--AQSRGELNEDEIN-----SSSVSLGPVS 1619
            ++ N  ++ T+   R  ++C+++VP +M+  D++   A + + ++ MK+++DSTPN+Y+VL+KF S  DAD+FY   N   FNS+E +VC + YV   E + S      P+++LTELP C VCLER+DE +NG+LT +CNH+FHS+C+Q+  +++CPVCRY QTP+ + +  KC  C ++E+LW+CLIC +IGCGR+ ++HA  HF +T HT+AM++ N+ VWDYA D +VHRLVA+ +DGK V+ + E          C E           +   L+ E C   S+V        E  K+L                  +Q++    +L ++ +EE  MN  L   Q  L   L  ++ E K+     LQEQL D+M  L+   KI +  +++R E+ + +I+     + S + GP S
Sbjct:  140 YKTNKMTSLTEDVRRSAMVCILTVPATMTSHDLMQLMAPFNEVMEHMKIIRDSTPNQYMVLIKFCSQADADSFYTTCNGRQFNSIEEAVCQVVYVERAEVIKSQEGASLPVMELTELPKCTVCLERMDESVNGVLTTLCNHSFHSQCLQRWEDASCPVCRYCQTPEPVEEN-KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKMVQFECE-------GDTCQE----------EKVDGLQLEVCTFCSLVPA------ESPKSLS-----------------TQLSGRVLKLSQELKEEQEMNRCLRANQAQLQAQLAEEERERKDAVIAELQEQLRDVMFYLETQQKIEQLSSEARSEIQDGQIDIPAGPADSAAAGPSS 518          
BLAST of BRCA1-associated protein vs. Ensembl Medaka
Match: usp5 (ubiquitin specific peptidase 5 [Source:NCBI gene;Acc:101155956])

HSP 1 Score: 53.1434 bits (126), Expect = 7.847e-7
Identity = 23/60 (38.33%), Postives = 35/60 (58.33%), Query Frame = 3
Query:  891 QIMSDKYKCAMCDLREDLWLCLICANIGCGRH------ENKHAELHFYDTGHTFAMKIGN 1052
            +I    ++C +CDL+E+LW+ L    + CGR        N HA LHF +TG+  A+K+G 
Sbjct:  189 KIPPTGWRCEVCDLQENLWMNLTDGKVLCGRRYFDGTGGNNHALLHFQETGYPLAVKLGT 248          
BLAST of BRCA1-associated protein vs. Ensembl Medaka
Match: usp44 (ubiquitin specific peptidase 44 [Source:NCBI gene;Acc:101164938])

HSP 1 Score: 53.1434 bits (126), Expect = 8.148e-7
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL CA++ CGR+  +HA  HF    H  AM++    V+ Y  D +V
Sbjct:   23 KWHCVDCNTTESVWACLGCAHVACGRYIEEHALQHFQQQHHPLAMEVNELYVFCYLCDDYV 83          
BLAST of BRCA1-associated protein vs. Ensembl Medaka
Match: usp44 (ubiquitin specific peptidase 44 [Source:NCBI gene;Acc:101164938])

HSP 1 Score: 53.1434 bits (126), Expect = 8.148e-7
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL CA++ CGR+  +HA  HF    H  AM++    V+ Y  D +V
Sbjct:   23 KWHCVDCNTTESVWACLGCAHVACGRYIEEHALQHFQQQHHPLAMEVNELYVFCYLCDDYV 83          
BLAST of BRCA1-associated protein vs. Ensembl Medaka
Match: usp44 (ubiquitin specific peptidase 44 [Source:NCBI gene;Acc:101164938])

HSP 1 Score: 53.1434 bits (126), Expect = 8.354e-7
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 3
Query:  906 KYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHV 1088
            K+ C  C+  E +W CL CA++ CGR+  +HA  HF    H  AM++    V+ Y  D +V
Sbjct:   23 KWHCVDCNTTESVWACLGCAHVACGRYIEEHALQHFQQQHHPLAMEVNELYVFCYLCDDYV 83          
BLAST of BRCA1-associated protein vs. Planmine SMEST
Match: SMESG000049888.1 (SMESG000049888.1)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 403/404 (99.75%), Postives = 404/404 (100.00%), Query Frame = 3
Query:  408 KNSFSNRTKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADXXXXXXXXXXXXSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDPDDKKLSSICMEYTAMLADQLSSQRAYLESEFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSLGPVS 1619
            KNSFSNRTKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADNFYKNFNNINFNSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDPDDKK+SSICMEYTAMLADQLSSQRAYLESEFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSLGPVS
Sbjct:  114 KNSFSNRTKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVVKDSTPNEYIVLLKFRSCDDADNFYKNFNNINFNSLESSVCHLAYVSHVESLASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQMNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENKHAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAEDPDDKKVSSICMEYTAMLADQLSSQRAYLESEFCMKLSIVENKLEHQQEICKNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQNHLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSSSVSLGPVS 517          

HSP 2 Score: 228.409 bits (581), Expect = 0.000e+0
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
Query:    1 ESINVLPILIVFEHKSNNLFNNIIYQAENSTNKSILNYSNKLTRPERTFESQLGERKYKLLNIITLEGKDLRNICDLMESDKLKSDTDIINFISGNPANEITEGIIHFYKDG 336
            ESINVLPILIVFEHKSNNLFNNIIYQAENSTNKSILNYSNKLTRPERTFESQLGERKYKLLNIITLEGKDLRNICDLMESDKLKSDTDIINFISGNPANEITEGIIHFYKDG
Sbjct:    2 ESINVLPILIVFEHKSNNLFNNIIYQAENSTNKSILNYSNKLTRPERTFESQLGERKYKLLNIITLEGKDLRNICDLMESDKLKSDTDIINFISGNPANEITEGIIHFYKDG 113          
The following BLAST results are available for this feature:
BLAST of BRCA1-associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRAP1.040e-10342.43BRCA1 associated protein [Source:HGNC Symbol;Acc:H... [more]
BRAP2.952e-10342.43BRCA1 associated protein [Source:HGNC Symbol;Acc:H... [more]
USP138.675e-831.30ubiquitin specific peptidase 13 [Source:HGNC Symbo... [more]
USP131.096e-731.30ubiquitin specific peptidase 13 [Source:HGNC Symbo... [more]
USP442.032e-734.43ubiquitin specific peptidase 44 [Source:HGNC Symbo... [more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brap-22.104e-7836.43BRCA1-associated protein homolog 2 [Source:UniPro... [more]
hda-64.641e-1032.10Histone deacetylase 6 [Source:UniProtKB/Swiss-Pro... [more]
hda-64.641e-1032.10Histone deacetylase 6 [Source:UniProtKB/Swiss-Pro... [more]
hda-63.453e-932.10Histone deacetylase 6 [Source:UniProtKB/Swiss-Pro... [more]
hda-63.570e-932.10Histone deacetylase 6 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG55554.297e-8638.24gene:FBgn0038686 transcript:FBtr0083746[more]
CG55554.451e-8638.24gene:FBgn0038686 transcript:FBtr0332165[more]
HDAC64.592e-833.75gene:FBgn0026428 transcript:FBtr0074009[more]
HDAC65.034e-833.75gene:FBgn0026428 transcript:FBtr0074008[more]
HDAC65.084e-833.75gene:FBgn0026428 transcript:FBtr0074010[more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brap8.353e-10440.42BRCA1 associated protein [Source:ZFIN;Acc:ZDB-GENE... [more]
usp442.508e-634.43ubiquitin specific peptidase 44 [Source:NCBI gene;... [more]
usp442.508e-634.43ubiquitin specific peptidase 44 [Source:NCBI gene;... [more]
hdac62.788e-633.87histone deacetylase 6 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
hdac62.788e-633.87histone deacetylase 6 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRAP3.313e-10142.16BRCA1 associated protein [Source:NCBI gene;Acc:100... [more]
BRAP5.090e-10142.16BRCA1 associated protein [Source:NCBI gene;Acc:100... [more]
ncbp34.816e-736.07nuclear cap binding subunit 3 [Source:Xenbase;Acc:... [more]
adrm16.195e-740.32adhesion regulating molecule 1 [Source:Xenbase;Acc... [more]
adrm16.213e-740.32adhesion regulating molecule 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Brap9.114e-10141.22BRCA1 associated protein [Source:MGI Symbol;Acc:MG... [more]
Brap1.880e-10041.22BRCA1 associated protein [Source:MGI Symbol;Acc:MG... [more]
Brap1.425e-1346.81BRCA1 associated protein [Source:MGI Symbol;Acc:MG... [more]
Usp135.613e-831.30ubiquitin specific peptidase 13 (isopeptidase T-3)... [more]
Usp135.806e-831.30ubiquitin specific peptidase 13 (isopeptidase T-3)... [more]
back to top
BLAST of BRCA1-associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z569|BRAP_HUMAN1.418e-10242.43BRCA1-associated protein OS=Homo sapiens OX=9606 G... [more]
sp|Q99MP8|BRAP_MOUSE1.315e-9941.22BRCA1-associated protein OS=Mus musculus OX=10090 ... [more]
sp|Q95QN6|BRAP2_CAEEL2.676e-7736.43BRCA1-associated protein homolog 2 OS=Caenorhabdit... [more]
sp|O13747|EPT1_SCHPO2.215e-6334.33RING finger protein ETP1 homolog OS=Schizosaccharo... [more]
sp|O80996|BRIZ2_ARATH3.210e-5731.54BRAP2 RING ZnF UBP domain-containing protein 2 OS=... [more]
back to top
BLAST of BRCA1-associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SCA62.319e-11044.28Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8X3D84.866e-11044.28Zinc finger, C3HC4 type OS=Opisthorchis viverrini ... [more]
A0A0X3Q1G99.820e-10842.50Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3QFS25.657e-10742.50BRCA1-associated protein OS=Schistocephalus solidu... [more]
A0A074ZZV81.439e-10643.78Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brap3.022e-8637.01BRCA1 associated protein [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSAMXT00000019549.21.208e-638.33pep primary_assembly:Astyanax_mexicanus-2.0:11:977... [more]
ENSAMXT00000031620.11.723e-638.33pep primary_assembly:Astyanax_mexicanus-2.0:11:977... [more]
usp444.438e-634.43ubiquitin specific peptidase 44 [Source:NCBI gene;... [more]
usp444.438e-634.43ubiquitin specific peptidase 44 [Source:NCBI gene;... [more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BRCA1-associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ETP11.512e-4730.22Protein of unknown function required for growth on... [more]
UBP149.955e-939.19Ubiquitin-specific protease; specifically disassem... [more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO315574.042e-9639.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BRCA1-associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brap1.266e-8036.67BRCA1 associated protein [Source:NCBI gene;Acc:101... [more]
usp57.847e-738.33ubiquitin specific peptidase 5 [Source:NCBI gene;A... [more]
usp448.148e-737.70ubiquitin specific peptidase 44 [Source:NCBI gene;... [more]
usp448.148e-737.70ubiquitin specific peptidase 44 [Source:NCBI gene;... [more]
usp448.354e-737.70ubiquitin specific peptidase 44 [Source:NCBI gene;... [more]
back to top
BLAST of BRCA1-associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000049888.10.000e+099.75SMESG000049888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015506 ID=SMED30015506|Name=BRCA1-associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1974bp
GAAAGCATCAATGTTTTACCTATATTGATTGTTTTCGAACATAAGTCTAA
TAATTTATTTAACAATATTATTTATCAAGCTGAAAATTCAACTAATAAAA
GTATATTAAACTACTCCAATAAGTTAACTAGACCTGAACGAACATTTGAG
TCCCAACTTGGTGAACGTAAATATAAATTACTGAATATTATAACACTTGA
AGGAAAAGATCTGAGAAATATTTGTGATTTAATGGAAAGTGACAAATTGA
AATCTGATACTGATATTATTAATTTTATTTCTGGAAATCCAGCTAACGAA
ATCACAGAAGGAATTATTCATTTTTATAAAGATGGGTATGAATATTTACT
ATTTCTATTATAGCATTTTCCTTTTAATATTTTTTGTAAAATTTAATGAA
ATTCAGGAAAAATTCATTTTCTAATCGAACCAAGATCTCAACTCGTGTTT
TATGCATGATCTCGGTTCCGAGGTCAATGAGTATTAGAGACGTGTTAGAC
TTCACGGCTTCCTATCGAGATTTTATTGACGAAATGAAAGTCGTGAAAGA
TTCCACACCGAATGAGTATATCGTTTTGTTGAAATTTCGATCTTGCGATG
ATGCTGACAATTTCTATAAAAACTTCAACAATATCAATTTCAACAGTCTC
GAGTCATCGGTTTGCCATTTGGCGTACGTGTCCCATGTCGAGTCGTTGGC
GTCATTGTCTAGCACCGGGTTTCCATTAGTGGATTTAACTGAGCTACCGA
CCTGTCCGGTTTGTCTTGAACGATTAGATGAGCCATTGAATGGCATTCTC
ACAATCGTTTGCAATCACACATTCCACAGTAAATGCATCCAGCAAATGAA
TGAATCGACTTGTCCCGTGTGCCGATATCCGCAAACCCCACAAATAATGA
GTGACAAATACAAATGTGCAATGTGTGATCTGCGTGAAGATCTGTGGCTG
TGCTTGATATGTGCCAATATCGGTTGTGGTAGGCATGAGAACAAGCACGC
TGAGTTGCATTTCTATGACACCGGTCACACATTTGCCATGAAAATCGGCA
ATAACTTGGTTTGGGATTACGCCGCCGATGCCCATGTCCATCGATTGGTT
GCCAATACCAGTGACGGCAAACCGGTTGAGGTGGACGCGGAAGATCCCGA
TGACAAAAAACTGTCGAGTATCTGTATGGAATACACGGCAATGTTGGCGG
ATCAGTTGTCATCTCAACGGGCCTATTTGGAAAGCGAATTCTGCATGAAA
TTGTCGATAGTTGAAAATAAGTTAGAGCATCAGCAGGAGATATGTAAAAA
CCTGGAAGAGGATTATCAATCGGTGTTGAGGGATAAGCAAAGAATCGAAA
GGCAATTCAGTCAGATGGCAACGAATTTCAAGCAGCTACAGAAACAAAGA
GAAGAAGAAGCTAGCATGAATATATCTTTGCTTGATAGGCAGAATCATTT
GAATAAGACTCTGAAAAGTAAAGATGATGAGTTGAAAAATCTCCAGGAGC
AATTGTCAGATTTGATGATCAATTTGCAAATGGGATCAAAAATCGCGGAA
GCCCAAAGCAGAGGAGAACTCAATGAAGATGAAATTAATAGTTCCAGTGT
TTCCCTTGGTCCCGTTTCCCGAGGCAGAACTCGTCGTAATAAAAGGAAAT
AATAATCTTATTACTTTCATCTAATGTTTATTTATAAATATATGATTTAT
GTTTTGATTCTGTTGTGGGGAATATAATTTTCAAATTCTAATTAATTTGC
TGTTTTTTACTATTTTCAGAAATGGATCCCCCCCCAATTATTTGGTAATT
AGTGTCATACTAACTCCAATTAAATAATTACACCAAGTCAAGTTCGTGTG
AGGCTGTATAATAACTTTCTTGTTATTTTTTTCCTTTTGGAATTACTTGC
CAATGATTACCACTTAGTTGAGTTTTATAGTTTTCTTTTGAAAGATAATA
GTAATAATGATAATGATAGTAACA
back to top

protein sequence of SMED30015506-orf-1

>SMED30015506-orf-1 ID=SMED30015506-orf-1|Name=SMED30015506-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
ESINVLPILIVFEHKSNNLFNNIIYQAENSTNKSILNYSNKLTRPERTFE
SQLGERKYKLLNIITLEGKDLRNICDLMESDKLKSDTDIINFISGNPANE
ITEGIIHFYKDGYEYLLFLL*
back to top

protein sequence of SMED30015506-orf-2

>SMED30015506-orf-2 ID=SMED30015506-orf-2|Name=SMED30015506-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=419bp
MKFRKNSFSNRTKISTRVLCMISVPRSMSIRDVLDFTASYRDFIDEMKVV
KDSTPNEYIVLLKFRSCDDADNFYKNFNNINFNSLESSVCHLAYVSHVES
LASLSSTGFPLVDLTELPTCPVCLERLDEPLNGILTIVCNHTFHSKCIQQ
MNESTCPVCRYPQTPQIMSDKYKCAMCDLREDLWLCLICANIGCGRHENK
HAELHFYDTGHTFAMKIGNNLVWDYAADAHVHRLVANTSDGKPVEVDAED
PDDKKLSSICMEYTAMLADQLSSQRAYLESEFCMKLSIVENKLEHQQEIC
KNLEEDYQSVLRDKQRIERQFSQMATNFKQLQKQREEEASMNISLLDRQN
HLNKTLKSKDDELKNLQEQLSDLMINLQMGSKIAEAQSRGELNEDEINSS
SVSLGPVSRGRTRRNKRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR001607Znf_UBP
IPR013083Znf_RING/FYVE/PHD
IPR011422BRAP2
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0004842ubiquitin-protein transferase activity
GO:0008139nuclear localization sequence binding
GO:0016740transferase activity
GO:0042802identical protein binding
GO:0046872metal ion binding
GO:0061630ubiquitin protein ligase activity
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0005737cytoplasm
GO:0005829cytosol
GO:0031965nuclear membrane
Vocabulary: biological process
TermDefinition
GO:0000165MAPK cascade
GO:0007265Ras protein signal transduction
GO:0009968negative regulation of signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 349..376
NoneNo IPR availableCOILSCoilCoilcoord: 286..334
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 393..408
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 386..418
NoneNo IPR availablePANTHERPTHR24007BRCA1-ASSOCIATED PROTEINcoord: 13..416
NoneNo IPR availablePRODOMPD017029coord: 18..99
e-value: 1.0E-14
score: 196.0
NoneNo IPR availableCDDcd16457RING-H2_BRAP2coord: 118..161
e-value: 1.01842E-23
score: 90.8028
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 119..166
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 154..235
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 120..159
e-value: 1.9E-7
score: 40.8
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 119..160
e-value: 1.5E-8
score: 34.8
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 120..160
score: 13.183
IPR001607Zinc finger, UBP-typeSMARTSM00290Zf_UBP_1coord: 173..222
e-value: 1.4E-18
score: 77.7
IPR001607Zinc finger, UBP-typePFAMPF02148zf-UBPcoord: 174..233
e-value: 1.3E-16
score: 60.7
IPR001607Zinc finger, UBP-typePROSITEPS50271ZF_UBPcoord: 172..233
score: 16.806
IPR011422BRCA1-associated 2PFAMPF07576BRAP2coord: 15..102
e-value: 1.9E-27
score: 95.4
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 93..164
e-value: 2.0E-10
score: 42.2
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 165..240
e-value: 4.9E-13
score: 50.7