SMED30015503

Overview
NameSMED30015503
Smed IDSMED30015503
Length (bp)1289
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015503 (SMED30015503) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015503 (SMED30015503) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015503 (SMED30015503) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015503 (SMED30015503) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015503

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30015503SMESG000072876.1 dd_Smed_v4_834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015503SMESG000072876.1 dd_Smed_v4_834_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015503 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001082:57028..59697 +6206
Homology
BLAST of SMED30015503 vs. Ensembl Human
Match: FNBP1L (formin binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:20851])

HSP 1 Score: 62.7734 bits (151), Expect = 5.847e-10
Identity = 79/364 (21.70%), Postives = 145/364 (39.84%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK--------EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEP--------------QIDVNERQLKSLQ-------------EMTEFV--GKQCPK--YAAESNSVVRNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            + EYA+QLQ FN  +   +   +P++  +L+ +D +R     +        ++  +  +    + +  +   +D + D+  +V   KS    P D  F D  +      +        Q+ GK++   T     G + L G + K         + PEQ    ++ R+DE+   ++        L  + + Y+ NP MGD  +++P              +I  NE  L  ++             ++   V  G++ P+  Y  ++N  VR  P Q    NE D  F++DD     G            K +Y FD  +   +++     + I+  +D   GWT  +       +GYVPT+YI
Sbjct:  186 KNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTISASKQESGKMDAKTTVGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKKLQQRIDELNRELQKESDQKDALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGGRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHNEFDDEFEDDDPLPAIGH----------CKAIYPFDGHNEGTLAMKEGEVLYIIE-EDKGDGWTRARRQN--GEEGYVPTSYI 536          
BLAST of SMED30015503 vs. Ensembl Human
Match: FNBP1L (formin binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:20851])

HSP 1 Score: 62.7734 bits (151), Expect = 6.698e-10
Identity = 79/364 (21.70%), Postives = 145/364 (39.84%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK--------EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEP--------------QIDVNERQLKSLQ-------------EMTEFV--GKQCPK--YAAESNSVVRNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            + EYA+QLQ FN  +   +   +P++  +L+ +D +R     +        ++  +  +    + +  +   +D + D+  +V   KS    P D  F D  +      +        Q+ GK++   T     G + L G + K         + PEQ    ++ R+DE+   ++        L  + + Y+ NP MGD  +++P              +I  NE  L  ++             ++   V  G++ P+  Y  ++N  VR  P Q    NE D  F++DD     G            K +Y FD  +   +++     + I+  +D   GWT  +       +GYVPT+YI
Sbjct:  186 KNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTISASKQESGKMDAKTTVGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKKLQQRIDELNRELQKESDQKDALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGGRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHNEFDDEFEDDDPLPAIGH----------CKAIYPFDGHNEGTLAMKEGEVLYIIE-EDKGDGWTRARRQN--GEEGYVPTSYI 536          
BLAST of SMED30015503 vs. Ensembl Human
Match: TRIP10 (thyroid hormone receptor interactor 10 [Source:HGNC Symbol;Acc:HGNC:12304])

HSP 1 Score: 53.5286 bits (127), Expect = 4.688e-7
Identity = 54/221 (24.43%), Postives = 100/221 (45.25%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAE-------VTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF-------PGILQQGGKVEKNDTAKSLFGGVGLKGIETKEM--LPEQIKMRL------DEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQI 713
            E  + EYA+QLQ FN  ++  Y + +P++  +L+ +D +RA        +  +A L +V I       +    + +  + N +D K D++ L+   KS    P D+ F D  +    A + S         P +   G    ++ T +  FG    K + T++   LP + + +       +  +   K +D+    LK + + Y+  P MGD +++EPQI
Sbjct:  184 EESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPI-------IAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSLGTPSDGRPELRGPG----RSRTKRWPFGKKN-KTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQ-REALKKMKDVYEKTPQMGDPASLEPQI 391          
BLAST of SMED30015503 vs. Ensembl Human
Match: TRIP10 (thyroid hormone receptor interactor 10 [Source:HGNC Symbol;Acc:HGNC:12304])

HSP 1 Score: 53.1434 bits (126), Expect = 6.129e-7
Identity = 55/219 (25.11%), Postives = 100/219 (45.66%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAE-------VTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVE-----KNDTAKSLFGGVGLKGIETKEM--LPEQIKMRL------DEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQI 713
            E  + EYA+QLQ FN  ++  Y + +P++  +L+ +D +RA        +  +A L +V I       +    + +  + N +D K D++ L+   KS    P D+ F D  +    A   SD        G+ E     ++ T +  FG    K + T++   LP + + +       +  +   K +D+    LK + + Y+  P MGD +++EPQI
Sbjct:   76 EESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPI-------IAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRA--PSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKN-KTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQ-REALKKMKDVYEKTPQMGDPASLEPQI 283          
BLAST of SMED30015503 vs. Ensembl Human
Match: TRIP10 (thyroid hormone receptor interactor 10 [Source:HGNC Symbol;Acc:HGNC:12304])

HSP 1 Score: 52.7582 bits (125), Expect = 8.502e-7
Identity = 57/219 (26.03%), Postives = 100/219 (45.66%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAE-------VTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVE-----KNDTAKSLFGGVGLKGIETKEM--LPEQIKMRL------DEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQI 713
            E  + EYA+QLQ FN  ++  Y + +P++  +L+ +D +RA        +  +A L +V I    LE +  +        N +D K D++ L+   KS    P D+ F D  +    A   SD        G+ E     ++ T +  FG    K + T++   LP + + +       +  +   K +D+    LK + + Y+  P MGD +++EPQI
Sbjct:  184 EESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIAKCLEGMKVAA-------NAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRA--PSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKN-KTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQ-REALKKMKDVYEKTPQMGDPASLEPQI 391          
BLAST of SMED30015503 vs. Ensembl Fly
Match: Cip4 (gene:FBgn0035533 transcript:FBtr0333570)

HSP 1 Score: 51.2174 bits (121), Expect = 1.188e-6
Identity = 47/217 (21.66%), Postives = 94/217 (43.32%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGI------ETKEMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ 746
            + EYA+QLQ  N+ +   Y   LP + + L+ +D KR    ++  +    ++      +    + + ++   I+ K D   ++   +S    P DI F DL K   D+   S +         +    +A  L   VG+  I      +  ++ P Q    ++ ++ E+   +    K   GL  +   Y+ N S+G+   +E Q++ +E +L+ L+
Sbjct:  215 KNEYANQLQKTNNLQQQHYSMLLPSVLNRLQELDEKRTRGFREFIVGAADVESSVAPIIARCMEGIVKAGESINEKEDTFKVIERYQSGFTPPRDIPFEDLSKCDPDSVQDSHYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSNKEDFSDLPPNQRRKKLQAKIAELTQNIAQETKARDGLMKMKIVYEANSSLGNPMTVEGQLNESEHKLEKLK 431          
BLAST of SMED30015503 vs. Ensembl Zebrafish
Match: trip10a (thyroid hormone receptor interactor 10a [Source:NCBI gene;Acc:492762])

HSP 1 Score: 69.3218 bits (168), Expect = 2.965e-12
Identity = 60/217 (27.65%), Postives = 108/217 (49.77%), Query Frame = 3
Query:   93 ANGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF---PGILQQGGKVEKNDTAKSLFGGVGLKGIETK---EMLPEQIKMRLDE-IKNAVKVIDKGLSGLKVLG---ETYKNNPSMGDISNIEPQI 713
            A+ +T   E  + +YA QLQ +N  +S  Y TD+P++ ++L+ +D +R +   Q  +     ++H +  +G   + +  +   ++ + D+  L+   KS    P D+ F D  +    A + S      G L+  GK  KN T + LF     K ++T+    + PEQ + RL + I +  K + K +   + LG   + Y+ NP MGD +++ PQI
Sbjct:  176 AHLRTHIAEDCKNDYAVQLQKYNKEQSQFYFTDMPQIFNKLQDMDERRIKKMAQGYILFAETERHVMPIIGKCLEGMTRAGTNVNARNDSMVLIEQHKSGFERPGDLDFEDYSQGINRASSDSSLGTPKGPLELLGK-NKNKTFR-LFNKKS-KPVDTEGFTHLPPEQRRKRLQQKIDDMSKELQKEMDQSEALGKMKDVYEKNPQMGDPASLAPQI 389          
BLAST of SMED30015503 vs. Ensembl Zebrafish
Match: fnbp1l (formin binding protein 1-like [Source:ZFIN;Acc:ZDB-GENE-040801-155])

HSP 1 Score: 63.5438 bits (153), Expect = 2.384e-10
Identity = 78/355 (21.97%), Postives = 148/355 (41.69%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK--------EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQID---VNERQLKS-----LQEMTEFVGKQCPKYAAESNS-VVRNTPH--QISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNL--------AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            E  + EYA+QLQ FN  +   +   +P++ + L+ +D +R     +   +   +++  +  V    + +  +   +D + D+  +V   KS    P D  F D  ++     + S       +GGK +           + L G + K         + PEQ    ++ R+DE+   ++        L  + + Y+ NP MGD  +++P+I     N  +L+S        + E  GK   +    S++ V  + PH  +   G+ +D    E          E D    +          K LY FD ++   + ++ N  + ++  +D   GWT V+  +N   +GYVPT+Y+
Sbjct:  182 EESKNEYAAQLQNFNGEQWKHFNQAIPQIFTNLQNMDERRTVKLGEMYRSFAEVERRVIPIVSKCLEGMVTAAKNVDERRDSGIVVESFKSGFEPPGDFPFEDFSQNIQRTGSDSTIGTPKTEGGKPDPKHAISRTKNKLWLFGKKPKAPTLEDLSHLPPEQRRKKLQQRIDELNKELQKEQDQRDALNKMKDVYEKNPQMGDPGSLQPKISETICNMEKLRSEIHKNESWLAEVEGKHGSRSERRSSADVNHHAPHGRESPEGSYTDDHSQEHRSPPQPDPHEFDDEFDDDDPLPAIGHCKALYSFDGSNEGTLVMNENEVLYVIE-EDKGDGWTRVR--KNSGEEGYVPTSYV 533          
BLAST of SMED30015503 vs. Ensembl Zebrafish
Match: fnbp1l (formin binding protein 1-like [Source:ZFIN;Acc:ZDB-GENE-040801-155])

HSP 1 Score: 63.1586 bits (152), Expect = 2.660e-10
Identity = 78/355 (21.97%), Postives = 148/355 (41.69%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK--------EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQID---VNERQLKS-----LQEMTEFVGKQCPKYAAESNS-VVRNTPH--QISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNL--------AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            E  + EYA+QLQ FN  +   +   +P++ + L+ +D +R     +   +   +++  +  V    + +  +   +D + D+  +V   KS    P D  F D  ++     + S       +GGK +           + L G + K         + PEQ    ++ R+DE+   ++        L  + + Y+ NP MGD  +++P+I     N  +L+S        + E  GK   +    S++ V  + PH  +   G+ +D    E          E D    +          K LY FD ++   + ++ N  + ++  +D   GWT V+  +N   +GYVPT+Y+
Sbjct:  182 EESKNEYAAQLQNFNGEQWKHFNQAIPQIFTNLQNMDERRTVKLGEMYRSFAEVERRVIPIVSKCLEGMVTAAKNVDERRDSGIVVESFKSGFEPPGDFPFEDFSQNIQRTGSDSTIGTPKTEGGKPDPKHAISRTKNKLWLFGKKPKAPTLEDLSHLPPEQRRKKLQQRIDELNKELQKEQDQRDALNKMKDVYEKNPQMGDPGSLQPKISETICNMEKLRSEIHKNESWLAEVEGKHGSRSERRSSADVNHHAPHGRESPEGSYTDDHSQEHRSPPQPDPHEFDDEFDDDDPLPAIGHCKALYSFDGSNEGTLVMNENEVLYVIE-EDKGDGWTRVR--KNSGEEGYVPTSYV 533          
BLAST of SMED30015503 vs. Ensembl Zebrafish
Match: fnbp1b (formin binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-091117-6])

HSP 1 Score: 58.151 bits (139), Expect = 9.628e-9
Identity = 52/226 (23.01%), Postives = 106/226 (46.90%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKS------LFGGVGLKGIETKEMLPEQ----IKMRLDEI-KNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ-EMTEFVG 767
            + EY+S LQ FN  ++  Y T +P +  +++ ++ KR E   ++      + +  L  +G   D + ++   I+ K D++ ++   KS    P D+ F D  ++     + +       +  K E++  +KS      +    G    +   + PEQ    ++ ++D+I K+  K +D+    L  + E Y  NP MGD ++++P++      ++ LQ E  +F G
Sbjct:   72 KSEYSSYLQKFNQEQNEHYYTIIPNIFQKIQAMEEKRIERMGESLKTFAEVDRQILPIIGKCLDGMTQAAESIESKTDSSQVIESYKSGFEPPGDVEFEDYGQAMKRTVSETSLTNSRSE-NKPERSSKSKSKTLWPFIKKNKGSNPEDFSHLPPEQRRKKLQAKIDDINKDIQKEMDQ-RDALTKMKEVYIKNPQMGDPNSVDPRLAEIAHNIEKLQVEAQKFEG 295          
BLAST of SMED30015503 vs. Ensembl Zebrafish
Match: fnbp1b (formin binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-091117-6])

HSP 1 Score: 57.7658 bits (138), Expect = 1.570e-8
Identity = 52/226 (23.01%), Postives = 106/226 (46.90%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKS------LFGGVGLKGIETKEMLPEQ----IKMRLDEI-KNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ-EMTEFVG 767
            + EY+S LQ FN  ++  Y T +P +  +++ ++ KR E   ++      + +  L  +G   D + ++   I+ K D++ ++   KS    P D+ F D  ++     + +       +  K E++  +KS      +    G    +   + PEQ    ++ ++D+I K+  K +D+    L  + E Y  NP MGD ++++P++      ++ LQ E  +F G
Sbjct:  172 KSEYSSYLQKFNQEQNEHYYTIIPNIFQKIQAMEEKRIERMGESLKTFAEVDRQILPIIGKCLDGMTQAAESIESKTDSSQVIESYKSGFEPPGDVEFEDYGQAMKRTVSETSLTNSRSE-NKPERSSKSKSKTLWPFIKKNKGSNPEDFSHLPPEQRRKKLQAKIDDINKDIQKEMDQ-RDALTKMKEVYIKNPQMGDPNSVDPRLAEIAHNIEKLQVEAQKFEG 395          
BLAST of SMED30015503 vs. Ensembl Xenopus
Match: fnbp1l (formin binding protein 1 like [Source:NCBI gene;Acc:448740])

HSP 1 Score: 50.8322 bits (120), Expect = 3.220e-6
Identity = 70/353 (19.83%), Postives = 142/353 (40.23%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK--------EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ--------EMTEFVGKQCP----KYAAESNSVV---RNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNL-----AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            + EYA+QLQ +N+ +   +   +P++   L+ +D +R     +        ++  +  +    + + ++   +D + D+  +V   KS      D  F D  +      +        Q+  K +   T     G + L G + K         + PEQ    ++ R+DE+   ++        L  + + Y+ NP MGD S++ P+I      ++ L+         ++E  GK       +++AE+N +V   R +P      + +     +          +   +   L      K LY FD  +   +++     + I+  +D   GWT  ++ +    +GYVPT+YI
Sbjct:  186 KNEYAAQLQNYNAEQHKHFYIVIPQVYKHLQEMDERRTVKLSECYKGFADAERKVIPIISKCLEGMVQAAKSVDERRDSQIVVDCFKSGFEPNGDYPFEDYSQHIYRTVSDGTISTPKQESLKPDPRVTVGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKRLQQRIDELSRELQKEMDQKDALNKMKDVYEKNPQMGDPSSLHPKIAETTSNIERLRMEIHKNEAWLSEVEGKVSQRSERRHSAEANHLVAQGRESPEGSYTEDANQEGRVQPQPHAHPEFDDEFDDDEPLPAIGHCKSLYPFDGNNEGTLAMKEGEVLYIIE-EDKGDGWT--RARKQNGEEGYVPTSYI 535          
BLAST of SMED30015503 vs. Ensembl Xenopus
Match: fnbp1l (formin binding protein 1 like [Source:NCBI gene;Acc:448740])

HSP 1 Score: 50.8322 bits (120), Expect = 3.641e-6
Identity = 70/353 (19.83%), Postives = 142/353 (40.23%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK--------EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ--------EMTEFVGKQCP----KYAAESNSVV---RNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNL-----AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            + EYA+QLQ +N+ +   +   +P++   L+ +D +R     +        ++  +  +    + + ++   +D + D+  +V   KS      D  F D  +      +        Q+  K +   T     G + L G + K         + PEQ    ++ R+DE+   ++        L  + + Y+ NP MGD S++ P+I      ++ L+         ++E  GK       +++AE+N +V   R +P      + +     +          +   +   L      K LY FD  +   +++     + I+  +D   GWT  ++ +    +GYVPT+YI
Sbjct:  258 KNEYAAQLQNYNAEQHKHFYIVIPQVYKHLQEMDERRTVKLSECYKGFADAERKVIPIISKCLEGMVQAAKSVDERRDSQIVVDCFKSGFEPNGDYPFEDYSQHIYRTVSDGTISTPKQESLKPDPRVTVGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKRLQQRIDELSRELQKEMDQKDALNKMKDVYEKNPQMGDPSSLHPKIAETTSNIERLRMEIHKNEAWLSEVEGKVSQRSERRHSAEANHLVAQGRESPEGSYTEDANQEGRVQPQPHAHPEFDDEFDDDEPLPAIGHCKSLYPFDGNNEGTLAMKEGEVLYIIE-EDKGDGWT--RARKQNGEEGYVPTSYI 607          
BLAST of SMED30015503 vs. Ensembl Mouse
Match: Fnbp1l (formin binding protein 1-like [Source:MGI Symbol;Acc:MGI:1925642])

HSP 1 Score: 61.2326 bits (147), Expect = 1.106e-9
Identity = 78/364 (21.43%), Postives = 144/364 (39.56%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK--------EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEP--------------QIDVNERQLKSLQ-------------EMTEFV--GKQCPK--YAAESNSVVRNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            + EYA+QLQ FN  +   +   +P++  +L+ +D +R     +        ++  +  +    + +  +   +D + D+  +V   KS    P D  F D  +      +        Q+ GK++   T     G + L G + K         + PEQ    ++ R+DE+   ++        L  + + Y+ NP MGD  +++P              +I  NE  L  ++             ++   V  G++ P+  Y  ++N  VR  P Q    +E D  F++DD     G            K +Y FD  +   +++     + I+  +D   GWT  +       +GYVPT YI
Sbjct:  186 KNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTISAAKQESGKMDSKSTVGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKKLQQRIDELNRGLQKEADQKEALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGIRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHSEFDDEFEDDDPLPAIGH----------CKAIYPFDGHNEGTLAMKEGEVLYIIE-EDKGDGWTRARRQN--GEEGYVPTTYI 536          
BLAST of SMED30015503 vs. Ensembl Mouse
Match: Trip10 (thyroid hormone receptor interactor 10 [Source:MGI Symbol;Acc:MGI:2146901])

HSP 1 Score: 50.0618 bits (118), Expect = 4.845e-6
Identity = 54/215 (25.12%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAE-------VTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF--PGILQQGGKVEKNDTAKSLFGGVGLKGIETKEM--LPEQ-----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQI 713
            E  + EYA+QLQ FN  ++  Y + +P++  +L+ +D +RA        +  +A L +V I    LE +  + +SV       D K D+  L+   KS    P D+ F D  +      + S    P    +         AK    G   K + T++   LP +     ++ +L+E    ++  +     LK + + Y+  P MGD +++EP+I
Sbjct:  184 EESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELQVVPIIGKCLEGMKVAAESV-------DAKNDSQVLIELHKSGFARPGDLEFEDFSQVINRVPSDSSLGTPDGRPELRAASSRSRAKRWPFGKKNKTVATEDFSHLPPEQQRKRLQQQLEERNRELQKEEDQREALKKMKDVYEKTPQMGDPASLEPRI 391          
BLAST of SMED30015503 vs. Ensembl Mouse
Match: Trip10 (thyroid hormone receptor interactor 10 [Source:MGI Symbol;Acc:MGI:2146901])

HSP 1 Score: 49.6766 bits (117), Expect = 6.412e-6
Identity = 54/215 (25.12%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAE-------VTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF--PGILQQGGKVEKNDTAKSLFGGVGLKGIETKEM--LPEQ-----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQI 713
            E  + EYA+QLQ FN  ++  Y + +P++  +L+ +D +RA        +  +A L +V I    LE +  + +SV       D K D+  L+   KS    P D+ F D  +      + S    P    +         AK    G   K + T++   LP +     ++ +L+E    ++  +     LK + + Y+  P MGD +++EP+I
Sbjct:  184 EESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELQVVPIIGKCLEGMKVAAESV-------DAKNDSQVLIELHKSGFARPGDLEFEDFSQVINRVPSDSSLGTPDGRPELRAASSRSRAKRWPFGKKNKTVATEDFSHLPPEQQRKRLQQQLEERNRELQKEEDQREALKKMKDVYEKTPQMGDPASLEPRI 391          
BLAST of SMED30015503 vs. UniProt/SwissProt
Match: sp|Q5U3Q6|CIP4_DANRE (Cdc42-interacting protein 4 homolog OS=Danio rerio OX=7955 GN=trip10 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.275e-11
Identity = 61/222 (27.48%), Postives = 109/222 (49.10%), Query Frame = 3
Query:   93 ANGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF---PGILQQGGKVEKNDT-----AKSLFGGVGLKGIETK---EMLPEQIKMRLDE-IKNAVKVIDKGLSGLKVLG---ETYKNNPSMGDISNIEPQI 713
            A+ +T   E  + +YA+QLQ +N  +S  Y TD+P++ ++L+ +D +R +   Q  +     ++H +  +G   + +  +   ++ + D+  L+   KS    P D+ F D  +    A + S      G L+  GK  KN T      KS F     K ++T+    + PEQ + RL + I +  K + K +   + LG   + Y+ NP MGD +++ PQI
Sbjct:  176 AHLRTHIAEDCKNDYAAQLQKYNKGQSQFYFTDMPQIFNKLQDMDERRIKKMAQGYILFADTERHVMPIIGKCLEGMTRAGTNVNARNDSMVLIEQHKSGFERPGDLDFEDYSQGINRASSDSSLGTPKGPLELLGK-NKNKTFRLFNKKSKF--TPEKPVDTEGFTHLPPEQRRKRLQQKIDDMSKELQKEMDQSEALGKMKDVYEKNPQMGDPASLAPQI 394          
BLAST of SMED30015503 vs. UniProt/SwissProt
Match: sp|Q6DCZ7|FBP1L_XENLA (Formin-binding protein 1-like OS=Xenopus laevis OX=8355 GN=fnbp1l PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.425e-6
Identity = 70/353 (19.83%), Postives = 142/353 (40.23%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK--------EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ--------EMTEFVGKQCP----KYAAESNSVV---RNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNL-----AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            + EYA+QLQ +N+ +   +   +P++   L+ +D +R     +        ++  +  +    + + ++   +D + D+  +V   KS    P D  F D  +      +        Q+  K +   T     G + L G + K         + PEQ    ++ R+DE+   ++        L  + + Y+ NP MGD  ++ P+I      ++ L+         ++E  GK       +++AE+N +V   R +P      + +     +          +   +   L      K LY FD  +   +++     + I+  +D   GWT  ++ +    +GYVPT+YI
Sbjct:  186 KNEYAAQLQNYNAEQHKHFYIVIPQVYKHLQEMDERRTIKLSECYKGFADAERKVIPIISKCLEGMVQAAKSVDERRDSQIVVDCFKSGFEPPGDFPFEDYSQHIYRTVSDGTISTPKQESLKPDPRMTVGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKRLQQRIDELSRELQKEMDQKDALNKMKDVYEKNPQMGDPGSLHPKIAETTSNIERLRMEIHKNEGWLSEVEGKVSQRSERRHSAEANHLVAQGRESPEGSYTEDANQEGRVQPQHHAHPEFDDEFDDDEPLPAIGHCKSLYPFDGNNEGTLAMKEGEVLYIIE-EDKGDGWT--RARKQNGEEGYVPTSYI 535          
BLAST of SMED30015503 vs. TrEMBL
Match: A0A2C9KZE6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106073765 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.086e-14
Identity = 90/371 (24.26%), Postives = 168/371 (45.28%), Query Frame = 3
Query:   96 NGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAF--NASDFPGILQQ-----------GGKVEKNDTAKSLFGGVGLKGIETKE----MLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQE--------MTEFVGKQCPKYAAE------SNSVVRNTPH--QISR-GNXXXXXXXXXXXXXXXXXXXXXRNSGNL--AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            NGK  + E  + +YA+Q+Q +N+ +   Y   +P++   L+ +D KR    +++      I+K+ +  + T  + +A +   I    D+ S++   KS    P D+ F D+  S G     N++  P  +              GK +K      LFG    KG E +E    + P Q    ++ ++D IK  +    +   G+  L + Y +NP++GD S ++ +I+ N ++L +L++        M E  GK   +++A       S S   +TPH  Q+S  G   +        +  +   +   N   +   + LY F++ +   + +  N  ++IL  D  + GWT V+  +    +G+VPT+YI
Sbjct:  175 NGKVQQNEECKSDYANQVQQYNNAQHIFYTQTMPQVFQCLQDMDEKRINKIQESVFMCAEIEKNVIPIINTCIEGIARAAGNISPTHDSKSVIERYKSGFPIPDDLPFEDMSGS-GQQMESNSNTLPSRITSPSNTVNKSATLSGKSKKRGGIFGLFGSSKGKGDEQREDFSDLPPSQRRRKLQTKIDAIKKEMHKEQQEREGIMKLKDVYASNPALGDPSTLDKKIEENSQKLDALRQELLKYEGYMKEVDGKSNRRHSASEDSHSLSTSGSGDTPHIQQVSAPGTPQNQHNVYQPIDGDEDGEDDFDNFPVIGRCRALYAFEAINEGSVHMYENEDMQILEQDQGD-GWTRVRKAD--GTEGFVPTSYI 541          
BLAST of SMED30015503 vs. TrEMBL
Match: A0A2C9KZA4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106073765 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.672e-13
Identity = 90/371 (24.26%), Postives = 168/371 (45.28%), Query Frame = 3
Query:   96 NGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAF--NASDFPGILQQ-----------GGKVEKNDTAKSLFGGVGLKGIETKE----MLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQE--------MTEFVGKQCPKYAAE------SNSVVRNTPH--QISR-GNXXXXXXXXXXXXXXXXXXXXXRNSGNL--AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            NGK  + E  + +YA+Q+Q +N+ +   Y   +P++   L+ +D KR    +++      I+K+ +  + T  + +A +   I    D+ S++   KS    P D+ F D+  S G     N++  P  +              GK +K      LFG    KG E +E    + P Q    ++ ++D IK  +    +   G+  L + Y +NP++GD S ++ +I+ N ++L +L++        M E  GK   +++A       S S   +TPH  Q+S  G   +        +  +   +   N   +   + LY F++ +   + +  N  ++IL  D  + GWT V+  +    +G+VPT+YI
Sbjct:  175 NGKVQQNEECKSDYANQVQQYNNAQHIFYTQTMPQVFQCLQDMDEKRINKIQESVFMCAEIEKNVIPIINTCIEGIARAAGNISPTHDSKSVIERYKSGFPIPDDLPFEDMSGS-GQQMESNSNTLPSRITSPSNTVNKSATLSGKSKKRGGIFGLFGSS--KGDEQREDFSDLPPSQRRRKLQTKIDAIKKEMHKEQQEREGIMKLKDVYASNPALGDPSTLDKKIEENSQKLDALRQELLKYEGYMKEVDGKSNRRHSASEDSHSLSTSGSGDTPHIQQVSAPGTPQNQHNVYQPIDGDEDGEDDFDNFPVIGRCRALYAFEAINEGSVHMYENEDMQILEQDQGD-GWTRVRKAD--GTEGFVPTSYI 539          
BLAST of SMED30015503 vs. TrEMBL
Match: A0A2T7NL71 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17716 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.495e-12
Identity = 83/367 (22.62%), Postives = 159/367 (43.32%), Query Frame = 3
Query:   96 NGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKS-------LFGGVGLKGIETK-----EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQE--------MTEFVGKQCPKYAAESNSVV-----RNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNL-------AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            N K  + E  + EYAS LQ FNS +   Y T +P +  +L+ ++ KR    K   L    I+K  +  + T  + + ++   ++   D+  ++   KS    P D+ F DL    G   N ++     Q      K  T  S       LFG  G   ++ +     ++ P Q    ++ ++D IK  +        G+  L + Y +NP++GD + +  +++ N ++L +LQ+        + E  GK+  +++A  +S+       + PH IS                   +   +   G++        + LY F++ +   + +S N  ++IL  +D   GWT V+  +    +G+VP++Y+
Sbjct:  388 NQKAQQCEDCKNEYASVLQQFNSHQQEHYHTAMPMVFQQLQEMETKRITKMKDCVLQCAEIEKSVIPIINTCIEGMIKAAGSVNSAQDSKLVIDKYKSGFPIPQDVPFEDLSNMGGMVDNQNNSTSNKQTPSNPMKPSTVSSKQKKRGGLFGLFGSSKVDDQKEDFSDLPPNQRRRKLQQKIDLIKKDMAKETAEREGILKLKDVYVSNPALGDPNMLAEKVEENAQKLDALQQELLKYEGYLAECEGKR--RHSASGDSIHSSDSGHHAPHTISTPGTPHQQPHNVYAPIDGDEDGDEFGEGDVEFHVIGTCRALYPFEATNEGSVPMSENEEMQILE-EDQGDGWTRVRKVD--GTEGFVPSSYV 749          
BLAST of SMED30015503 vs. TrEMBL
Match: A0A3S1BUL9 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_000356 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.371e-11
Identity = 59/241 (24.48%), Postives = 122/241 (50.62%), Query Frame = 3
Query:   96 NGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKG-DAFNAS-----DFPGILQQGGKVE-KNDTAKSLFGGVGLKGIETK-----EMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSL-QEMTEFVG 767
            NGK  + E  + EYA+QLQ +N+ ++  +   +P++   L+ +D +R   T+++      I+K+ +  + T  + +A++   I+   D+ ++V   KS    P D+ F DL + +  D  ++S       P    +GG V  K+     +FG  G   ++ +     ++ P Q    ++ ++D IK  +        G+  L + Y NN ++GD S ++ +I+ N ++L++L +E+ ++ G
Sbjct:   95 NGKVQQCEEAKNEYAAQLQTYNNHQTEFFSQSMPQVFQGLQEMDERRILKTQESVFQCAEIEKNVIPIINTCIEGIAKAAGNINPTQDSKAVVERHKSGFPIPEDVQFEDLSQGQPVDPAHSSPAAHITTPSSTLKGGTVSGKSKKRGGIFGLFGSSKVDDQKEDFSDLPPTQRRRKLQQKIDSIKKEMSKEQSEREGILKLKDVYANNQALGDPSTLDKKIEENSQKLETLTRELQKYEG 335          
BLAST of SMED30015503 vs. TrEMBL
Match: A0A0X3PTP2 (SH3 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR93662 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.184e-11
Identity = 84/381 (22.05%), Postives = 157/381 (41.21%), Query Frame = 3
Query:   96 NGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAF--------------------NASDFPGILQQGGK-----VEKNDTAKSLFGGVGLKGIETKEMLPEQIKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQEMTEFVGKQC-----PKYAAESNSVVRNT-PHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGN-------------------LAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            NGK   F+  +  YA+ +  +NSF+   Y  ++  + +ELE +D +RA  ++   L   T+ +   ++V  ++ S A S   ID   D   ++   ++  L P D+ F++L++                           ++   GIL    K     V+ N    +  GG+GL  ++  +M   Q+  R+  +K  ++ +   L+  K L   Y+ N S+G++      +   ERQL S+ ++   + K        +  A++ S +  T P+  S    SD    +    +          SG+                   +A   YD++   +  ++     T  ++  D  NSGWT V S E+ +  G+VPT Y+
Sbjct:    4 NGKVKAFKDSQQTYAADMTKYNSFQRHFYAHNIYNVITELESLDSQRAACSRSLLLTCATLGQSMAKQVEEASSSFAASAEKIDPDKDCMDILERNRTEYLHPVDLPFLNLEQCSPATLESHSALMNQMLGTSNVNTQKTSTATSGILSMFSKSRAMSVDSNPLRTAFIGGIGLNPVKLDDMSVIQVSERIRAVKVNLEKVKNDLAATKRLQTAYQQNSSLGNLEEANAGVAKLERQLFSVSDLLSKLEKHFDSLGGARALAQAQSSLEATNPYTDSATASSDSLSRQGTRRESSFNDSDSDVSGDAPAPLAADFEMPSKPTYVGVATAKYDYEGEGSDYLTARVGQTFFVVELDKDNSGWTPVVS-EDGSQHGFVPTAYM 383          
BLAST of SMED30015503 vs. Ensembl Cavefish
Match: trip10a (thyroid hormone receptor interactor 10 [Source:NCBI gene;Acc:103037153])

HSP 1 Score: 66.2402 bits (160), Expect = 2.447e-11
Identity = 57/218 (26.15%), Postives = 101/218 (46.33%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF---PGILQQGGKVEKNDTAKSLFGGVGLKG-IETKEMLPEQIKMRLDE-IKNAVKVIDKGLSGLKVLG---ETYKNNPSMGDISNIEPQIDVNERQLKSLQ 746
            E  + +YA+QLQ +N  ++  Y TD+P + ++L+ +D KR     Q  +     ++H +  +G   + +  +   ++ K D+  L+   KS    P D+ F D  +    A + S      G L   GK         LF      G ++   + PEQ + RL + I +  K + K L   + LG   + Y+ NP MGD + + PQI+   + ++ L+
Sbjct:  185 EECKNDYAAQLQKYNKEQNQFYFTDMPLIFNKLQDMDEKRVRKLAQTYILFADTERHVMPIIGKCLEGITRAGTNVNEKNDSLVLIEQHKSGFERPGDLEFEDYSQGINRASSDSSLGTPKGPLDLLGK--NKSKPFWLFSKKSKVGTLDFGHLPPEQRRKRLQQKIDDISKELQKELDQSEALGKMKDVYEKNPQMGDPACLAPQINQTTQNIERLR 400          
BLAST of SMED30015503 vs. Ensembl Cavefish
Match: trip10a (thyroid hormone receptor interactor 10 [Source:NCBI gene;Acc:103037153])

HSP 1 Score: 64.3142 bits (155), Expect = 8.975e-11
Identity = 57/225 (25.33%), Postives = 100/225 (44.44%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF---PGILQQGGK--------VEKNDTAKSLFGGVGLKGIETKEMLPEQIKMRLDE-IKNAVKVIDKGLSGLKVLG---ETYKNNPSMGDISNIEPQIDVNERQLKSLQ 746
            E  + +YA+QLQ +N  ++  Y TD+P + ++L+ +D KR     Q  +     ++H +  +G   + +  +   ++ K D+  L+   KS    P D+ F D  +    A + S      G L   GK          K     SL         +   + PEQ + RL + I +  K + K L   + LG   + Y+ NP MGD + + PQI+   + ++ L+
Sbjct:  184 EECKNDYAAQLQKYNKEQNQFYFTDMPLIFNKLQDMDEKRVRKLAQTYILFADTERHVMPIIGKCLEGITRAGTNVNEKNDSLVLIEQHKSGFERPGDLEFEDYSQGINRASSDSSLGTPKGPLDLLGKNKSKPFWLFSKKSKKYSLERITPAASEDFGHLPPEQRRKRLQQKIDDISKELQKELDQSEALGKMKDVYEKNPQMGDPACLAPQINQTTQNIERLR 408          
BLAST of SMED30015503 vs. Ensembl Cavefish
Match: trip10a (thyroid hormone receptor interactor 10 [Source:NCBI gene;Acc:103037153])

HSP 1 Score: 64.3142 bits (155), Expect = 1.013e-10
Identity = 56/220 (25.45%), Postives = 102/220 (46.36%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF---PGILQQGGKVEKNDTAKSLFGGVGLKGIETKE---MLPEQIKMRLDE-IKNAVKVIDKGLSGLKVLG---ETYKNNPSMGDISNIEPQIDVNERQLKSLQ 746
            E  + +YA+QLQ +N  ++  Y TD+P + ++L+ +D KR     Q  +     ++H +  +G   + +  +   ++ K D+  L+   KS    P D+ F D  +    A + S      G L   G   KN +          K   +++   + PEQ + RL + I +  K + K L   + LG   + Y+ NP MGD + + PQI+   + ++ L+
Sbjct:  184 EECKNDYAAQLQKYNKEQNQFYFTDMPLIFNKLQDMDEKRVRKLAQTYILFADTERHVMPIIGKCLEGITRAGTNVNEKNDSLVLIEQHKSGFERPGDLEFEDYSQGINRASSDSSLGTPKGPLDLLG---KNKSKPFWLFSKKSKPAASEDFGHLPPEQRRKRLQQKIDDISKELQKELDQSEALGKMKDVYEKNPQMGDPACLAPQINQTTQNIERLR 400          
BLAST of SMED30015503 vs. Ensembl Cavefish
Match: fnbp1a (formin binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-081105-105])

HSP 1 Score: 58.5362 bits (140), Expect = 6.398e-9
Identity = 75/351 (21.37%), Postives = 143/351 (40.74%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETKEMLPEQIKMRLDEIKNAV-KVIDKGL---SGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ-EMTEFVGKQCP---KYAAESNSVVRNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNL----------------------AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            + EY S LQ FN  +   Y T +P +   ++ ++ +R E   ++      +++  L  V    D + ++   I+ K D   +V   KS    P D+ F D   S   A + S F     +  +  ++     +    G    +   + PEQ + +L    N V K I K +     L  + E Y  NP MGD ++++P+++  ++ ++ LQ +  ++ G       K   + ++  R + H  S+GN  +      +  D     +    +                          K LY F+  +   + ++    + ++  +D   GWT V+  E+   +GYVPT+YI
Sbjct:  154 KNEYLSYLQKFNKDQHEHYYTLIPHIFQRIQEMEERRIERIGESMRCYSEVERKVLPIVSKCLDGMTKAAESIEPKMDTKQVVETFKSGFEPPGDVDFEDYSVSMKRAVSESSFLNARGESRRRSRSKLWPLIKRNKGTGQEDYSHLPPEQRRKKLQAKLNDVSKDIQKEMDQRDALTKMKEVYIKNPHMGDPNSVDPRLEEVQQSIEKLQLDAHKYEGWLTDVERKLLEKGSTQRRQSAHFDSQGNTPNSCAQNRESPDGSYTEDPSTETVQFKSRSTEFDDEFDDEDPLPTIGTCKALYPFEGQNEGTIPLAEGEMLYVIE-EDKGDGWTRVRRNED--EEGYVPTSYI 501          
BLAST of SMED30015503 vs. Ensembl Cavefish
Match: fnbp1l (formin binding protein 1-like [Source:ZFIN;Acc:ZDB-GENE-040801-155])

HSP 1 Score: 58.151 bits (139), Expect = 1.018e-8
Identity = 77/353 (21.81%), Postives = 143/353 (40.51%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDK------SKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGV-GLKGIETKEMLP-----EQIKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQID---VNERQLKSLQEMTEFV------GKQCPKYAAE-SNSVVRNTPH--QISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNL--------AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYI 1088
            + EYA+QLQ FN+ +   + T +P++   L+ +D +R     +   +   +++  +  +    + +  +   +D + D+  +V   KS    P D  F D  +      S G      + PG       + K      LFG       +E    LP     ++++ R+DE+   ++        L  + + Y+ NP MGD  +++P+I     N  +L+S     E        GKQ  +     S  V  + PH  +   G+ +D    E          E D    +          K LY FD ++   + +  +  + ++  +D   GWT V+      ++GYVPT+Y+
Sbjct:  157 KNEYAAQLQNFNAEQWKHFNTAIPQIFKNLQDMDERRTVKLGETYRSFAEVERKVIPIISKCLEGMVTAAKNVDERRDSGIVVESFKSGFEPPGDFPFEDFSQNIQRTGSDGTIGTPKNDPGKPDPKHAIGKAKNKLWLFGKKPKAPNLEDLSHLPPEQRRKKLQQRIDELNRELQKEMDQRDALNKMKDVYEKNPQMGDPGSLQPKISETICNMEKLRSEIHKNETWLAEVEGGKQSTRSDRRPSTDVNHHAPHGRESPEGSYTDDHSQEHRTPPQPDPHEFDDEFDDDDPLPAIGHCKALYSFDGSNEGTLVMKEDEVLYVIE-EDKGDGWTRVRKQS--GVEGYVPTSYV 506          
BLAST of SMED30015503 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001997.1 (pep scaffold:Pmarinus_7.0:GL478230:377:34553:-1 gene:ENSPMAG00000001808.1 transcript:ENSPMAT00000001997.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 3.957e-8
Identity = 52/227 (22.91%), Postives = 103/227 (45.37%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSL-FGGVGLKGIETKEMLPE------------QIKMRLDEI-KNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSL-QEMTEF 761
            + EYA     FN  +   Y T +P +   L+ +D +R      A     + ++  L  +    + + ++ + +    DA  ++   KS    P D+ F DL  S+      S  P +   G    +   ++SL F  +G  G   K ++PE            +++ ++DE+ ++  K  D+ ++ L+ + + Y  NP +GD + ++PQI  N+ +L  L QE+ ++
Sbjct:  185 KAEYAMLHSTFNDEQKKHYFTVMPSVLKSLQELDGQRVSAVGAALTITASREQEVLPIMSKCVEGMKKAADSVQPDTDAQRVIEAYKSGFQIPGDVAFEDL--SQLCHAWPSTTPPVCPDGNPELRKTVSRSLKFSYLG--GHLNKSVVPEDFSHLPPEQRRKKLQHKMDELNRDIAKESDQSVA-LQKMRDVYTKNPQLGDTAILDPQIHENKLRLDKLKQELHKY 406          
BLAST of SMED30015503 vs. Ensembl Sea Lamprey
Match: fnbp1a (formin binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-081105-105])

HSP 1 Score: 46.9802 bits (110), Expect = 4.104e-6
Identity = 29/111 (26.13%), Postives = 51/111 (45.95%), Query Frame = 3
Query:   93 ANGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVD 425
            +N +    E  + EYA+QLQ FN  +   Y T +PK+  +L+ +D +R     ++      I +  +  +G   D +  +   I  + D+  +V   KS    P D+ F D
Sbjct:  177 SNQRMQMAEDCKSEYAAQLQKFNEEQHQHYFTVMPKVFQDLQAMDERRISNIAESITRFADIDRQVMPILGKCLDEMTSAAESISAEKDSGLVVEAYKSGFERPSDVDFED 287          
BLAST of SMED30015503 vs. Ensembl Nematostella
Match: EDO47148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMS6])

HSP 1 Score: 61.6178 bits (148), Expect = 2.937e-10
Identity = 84/352 (23.86%), Postives = 150/352 (42.61%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDS---VAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETK----EMLPEQIKMRLDEIKNAVKVIDKGLSGLKVLGET-------YKNNPSMGDISNIEPQIDVNERQLKSL-QEMTEFVG--------KQCPKYAAESNSVVRNTPHQI--SRGNXXXXXXXXXXXXXXXXXXXXXRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYISKL 1097
            +R R EY +QL+  NS ++  Y +++P + SEL+ ++  R +   +       I+   +  V T  D+   VA SFN      D+  L+   ++ L  P DI F +  K++         PG         K       F    LK +E      + LP   K+R+   K  V   +   S L+   E        Y+ NP++GD++++E Q+  N ++L ++  E+ ++          +  PK    S S V+  P  +   +              +     +G+ +     K+LYDF   +  +++V+    + ++  D  NSGWT +   ++   +GYVPT YI  L
Sbjct:  182 DRARDEYRNQLEKTNSKQTLHYSSEMPAVFSELQTMEENRIKRVGELLTEYSDIECRVMPIVQTCLDNIKKVAASFN---GPQDSLLLIEQNRTALQPPGDIEFEEFGKAQ-----TIQRPGQSTTPKDSNKKKGKSKNFFR-KLKKVEGDGNDFQSLPPGQKIRI--CKKKVSEYESQFSQLQASREAMVKMVGVYQQNPALGDVASVEQQLAENAKELDTVGDELFKYQSYLAILENKEAPPKPQKYSKSAVQPPPAPVDEQQPGPPPAPSLLVPPMEEADVEDGEFDEEQRCKILYDFQGTNEGELAVTQGEVLAVMEMDLDNSGWTRLCRDQD---EGYVPTAYIEML 519          
BLAST of SMED30015503 vs. Ensembl Nematostella
Match: EDO43345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ48])

HSP 1 Score: 60.8474 bits (146), Expect = 4.407e-10
Identity = 81/350 (23.14%), Postives = 144/350 (41.14%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETKEMLPEQ----IKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMG-DISNIEPQIDVNERQLKSLQEMTEFVGKQCPKY----AAESNSVVRNTPHQIS-------------RGNXXXXXXXXXXXXXXXXXXXXXRNSGNL-AKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYISKL 1097
            +R + EY +QLQ+ N+ +   Y TD+P +  E++ ++ KR     +  +    ++   +  +    D++      +D   D   L+   K+ L  P DI F +   S+          G L    K +     K   GG    G + + + P Q     K ++D+ +     +     G+  +   ++ NP+MG DI  +E ++  N +QL         VG++  KY    AA  N  V + P + S              G+                + E      +L   VLY+F + +  ++SV+    +++L  D  +SGWT V   E+   +GYVPT Y+  L
Sbjct:  182 DRAKEEYQNQLQMTNNKQMLHYNTDMPAIFDEIQKMEEKRIARVGELLVHYSEVESKVMPILQKCLDNIKTIGASVDGPKDTMQLIELNKTALTPPGDIQFEECTPSRQK--------GPLMIDRKAKLASFWKKHKGGSTSGGNDFQSLPPGQKIRICKKKVDKFQAEYTKLQTSRDGMVKMVSAFQQNPAMGVDIDKVEQELADNAQQLDK-------VGEELFKYQSFLAALENKPVPDPPPKYSTSAPVQPPPAPTPVGSTPSDPPPAPSLLVAPLEEEDIEFDDDLHCTVLYEFQATNDGELSVTVGEDLQVLEMDLDDSGWTKVLKGES---EGYVPTAYLQIL 513          
BLAST of SMED30015503 vs. Ensembl Medaka
Match: TRIP10 (cdc42-interacting protein 4 homolog [Source:NCBI gene;Acc:101166606])

HSP 1 Score: 68.5514 bits (166), Expect = 4.014e-12
Identity = 75/343 (21.87%), Postives = 151/343 (44.02%), Query Frame = 3
Query:   93 ANGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDF--PGILQQGGKVEKNDTAKSLFGGVGLKGIETKEMLP-----EQIKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQEMTEFVGKQCPKYAAESNSVV--RNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYISK 1094
            AN +T   +  R +YA++LQ +N  + + Y +++P++ ++L+ +D +R  +  +       I+K+ L  +    D +  +   ID K D+  L+   KS    P D+ F D  +    A + S    P +    GK+        LFG       E    LP     ++++ +++EI   ++        L  +   Y+  P MGD +++EPQI      L++ Q+++   G +  KY    + +V    +P  I+  ++      ++    F+  F+   +     + LY F       +S+     + I+  +D   GW  V   +    +GY+P++Y+ +
Sbjct:  175 ANVRTHIADECRTDYAAELQKYNKEQKSHYYSEIPQILNKLQDMDERRIRILAEKYCRFSEIEKNVLSIITKCLDGITAAGKQIDEKKDSKLLIEQHKSGFERPGDVEFEDYTQGVKKAISESSLNPPKVR---GKL-------RLFGKKHKAQSEDFSHLPPEQRKKKLQAKIEEISKDLQKTQDQSEALDKMKGVYEQTPQMGDPASLEPQI------LETSQKISRLKG-ELNKYETWLSDIVGGEESPSTINNNSQHGNDNSQNIYTSFEEDFDDIPSPIGHCEALYTFQGNSEGTVSILEGELLTIME-NDKGDGWMRV--LKGNGEEGYIPSSYVKQ 497          
BLAST of SMED30015503 vs. Ensembl Medaka
Match: trip10a (thyroid hormone receptor interactor 10 [Source:NCBI gene;Acc:101156577])

HSP 1 Score: 66.2402 bits (160), Expect = 2.708e-11
Identity = 80/350 (22.86%), Postives = 161/350 (46.00%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVE---KNDTAKSLFGGVGLKGIETKE---MLPEQIKMRLDE-----IKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ-EMTEF------VGKQCPKYAAESNSVVRNTPHQI-----SRGNXXXXXXXXXXXXXXXXXXXXXRNSGNLAKV--LYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYIS 1091
            E  + +YA+QLQ +N  ++  Y  D+P + ++L+ +D +RA+   Q  +     +K  +  +G   + + ++ + +D K D+  ++   KS    P D+ F D   S+G    +SD   +    G ++   KN +          K   T++   + PEQ + RL +      K   K +DK    L  + + Y+ NP MGD +++ PQI+   ++++ L+ +M+++       G +       + S   N  H +     +  +ES     +    +FD  F+ +  +  + +   LY+F       +++     + ++  +D   GWT V+   N   +GY+PT+Y+S
Sbjct:  184 EECKNDYAAQLQKYNKEQNQFYFNDMPLIFNKLQDLDERRAQKLAQGYILFSDTEKQVMPIIGKCLEGITKAGSSVDEKNDSRIVIEQNKSGFERPGDLEFEDY--SQGINRASSD-SSLGTPKGPIDLLGKNRSKNFWLFSRRTKPTVTEDFGHLPPEQRRKRLQQKFEEICKELQKEVDKS-EALGKMKDVYEKNPQMGDPASLAPQINQTSQKIEQLRGDMSKYETWLAEAGGRGDTLRYRAQSFNNNGAHDVYSPDGAHSDESTPDPSQAIYAEFDDDFDDEELTAPIGECIALYNFPGVSEGTIAMQEGEALAVVE-EDKGDGWTRVRR--NNGDEGYIPTSYVS 526          
BLAST of SMED30015503 vs. Ensembl Medaka
Match: trip10a (thyroid hormone receptor interactor 10 [Source:NCBI gene;Acc:101156577])

HSP 1 Score: 64.3142 bits (155), Expect = 8.922e-11
Identity = 56/227 (24.67%), Postives = 112/227 (49.34%), Query Frame = 3
Query:  117 ERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVE---KNDTAKSLFGGVGLKGIETKE---MLPEQIKMRLDE-----IKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQ-EMTEF 761
            E  + +YA+QLQ +N  ++  Y  D+P + ++L+ +D +RA+   Q  +     +K  +  +G   + + ++ + +D K D+  ++   KS    P D+ F D   S+G    +SD   +    G ++   KN +          K   T++   + PEQ + RL +      K   K +DK    L  + + Y+ NP MGD +++ PQI+   ++++ L+ +M+++
Sbjct:  184 EECKNDYAAQLQKYNKEQNQFYFNDMPLIFNKLQDLDERRAQKLAQGYILFSDTEKQVMPIIGKCLEGITKAGSSVDEKNDSRIVIEQNKSGFERPGDLEFEDY--SQGINRASSD-SSLGTPKGPIDLLGKNRSKNFWLFSRRTKPTVTEDFGHLPPEQRRKRLQQKFEEICKELQKEVDKS-EALGKMKDVYEKNPQMGDPASLAPQINQTSQKIEQLRGDMSKY 406          
BLAST of SMED30015503 vs. Ensembl Medaka
Match: fnbp1b (formin binding protein 1 [Source:NCBI gene;Acc:101160008])

HSP 1 Score: 61.6178 bits (148), Expect = 6.547e-10
Identity = 84/374 (22.46%), Postives = 144/374 (38.50%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDL------------------DKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETKEMLPEQIKMRL----DEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEP---QIDVNERQLKSLQE-----MTEFVGKQCPKYAAESNSVVRNTPHQISRGNXXXXXXX------XXXXXXXXXXXXXXRNSG--------------NLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYISKL 1097
            + +Y S LQ FN  +   Y T +P +   L+ ++ KR E           + +  L  VG   D +  +   I+ K D+N +V   KS    P D+ F D                    K K    + S     ++   K+  N   +SL  G   +      + PEQ + +L    DE+K  ++        L  + + Y  NP MGD ++++P   +I +N  +L+S ++     + E   +   K      SV+  T +     N +           E+   +   +   +R S                  K LY F+  +   +SV+    + ++  +D   GWT V+  E    +GYVPT+YI  L
Sbjct:  187 KNDYHSYLQKFNQEQHEHYYTVIPNIFQNLQDMEEKRIERLGVCMKTFAEVDRQVLPIVGKCLDGMTSAAEGIEPKTDSNQVVESYKSGFEPPGDVEFEDYGQAMKRTVSENSLSNSRESKEKPAGKSKSKLWPFIKNKNKITLNSHVRSLIEGSVPEDF--SHLPPEQRRKKLQGKIDELKKDIQKEMDQRDALTKMKDVYVKNPQMGDPASVDPRLAEIAMNIEKLQSEEQKFENWLAEVEERMPSKSETHRKSVIYETQNSTVSNNCAQDRESPDGSYTEEQSAETQVKAVANRTSCAPESDDEFDELETIGTCKALYTFEGQNEGTISVTEGELLYVIE-EDKGDGWTRVRRNEE--EEGYVPTSYIEVL 555          
BLAST of SMED30015503 vs. Ensembl Medaka
Match: fnbp1b (formin binding protein 1 [Source:NCBI gene;Acc:101160008])

HSP 1 Score: 59.3066 bits (142), Expect = 4.295e-9
Identity = 83/364 (22.80%), Postives = 144/364 (39.56%), Query Frame = 3
Query:  126 RGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKS---LFGGVGLKGI-----ETKEMLPEQIKMRL----DEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEP---QIDVNERQLKSLQE-----MTEFVGKQCPKYAAESNSVVRNTPHQISRGNXXXXXXX------XXXXXXXXXXXXXXRNSG--------------NLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYISKL 1097
            + +Y S LQ FN  +   Y T +P +   L+ ++ KR E           + +  L  VG   D +  +   I+ K D+N +V   KS    P D+ F D     G A   +     L    + ++    KS   L+  +  K       +   + PEQ + +L    DE+K  ++        L  + + Y  NP MGD ++++P   +I +N  +L+S ++     + E   +   K      SV+  T +     N +           E+   +   +   +R S                  K LY F+  +   +SV+    + ++  +D   GWT V+  E    +GYVPT+YI  L
Sbjct:  187 KNDYHSYLQKFNQEQHEHYYTVIPNIFQNLQDMEEKRIERLGVCMKTFAEVDRQVLPIVGKCLDGMTSAAEGIEPKTDSNQVVESYKSGFEPPGDVEFEDY----GQAMKRTVSENSLSNSRESKEKPAGKSKSKLWPFIKNKNKGSVPEDFSHLPPEQRRKKLQGKIDELKKDIQKEMDQRDALTKMKDVYVKNPQMGDPASVDPRLAEIAMNIEKLQSEEQKFENWLAEVEERMPSKSETHRKSVIYETQNSTVSNNCAQDRESPDGSYTEEQSAETQVKAVANRTSCAPESDDEFDELETIGTCKALYTFEGQNEGTISVTEGELLYVIE-EDKGDGWTRVRRNEE--EEGYVPTSYIEVL 543          
BLAST of SMED30015503 vs. Planmine SMEST
Match: SMESG000072876.1 (SMESG000072876.1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 334/335 (99.70%), Postives = 334/335 (99.70%), Query Frame = 3
Query:   93 ANGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETKEMLPEQIKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQEMTEFVGKQCPKYAAESNSVVRNTPHQISRGNXXXXXXXXXXXXXXXXXXXXXRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYISKL 1097
            ANGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETKEMLPEQIKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQEMTEFVGKQC KYAAESNSVVRNTPHQISRGNESDGSFDEDDEEDFDGQFEGDRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYISKL
Sbjct:  176 ANGKTTEFERMRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALVTIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFVDLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETKEMLPEQIKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVNERQLKSLQEMTEFVGKQCSKYAAESNSVVRNTPHQISRGNESDGSFDEDDEEDFDGQFEGDRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNSGWTLVQSTENLALKGYVPTNYISKL 510          
The following BLAST results are available for this feature:
BLAST of SMED30015503 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FNBP1L5.847e-1021.70formin binding protein 1 like [Source:HGNC Symbol;... [more]
FNBP1L6.698e-1021.70formin binding protein 1 like [Source:HGNC Symbol;... [more]
TRIP104.688e-724.43thyroid hormone receptor interactor 10 [Source:HGN... [more]
TRIP106.129e-725.11thyroid hormone receptor interactor 10 [Source:HGN... [more]
TRIP108.502e-726.03thyroid hormone receptor interactor 10 [Source:HGN... [more]
back to top
BLAST of SMED30015503 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015503 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cip41.188e-621.66gene:FBgn0035533 transcript:FBtr0333570[more]
back to top
BLAST of SMED30015503 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trip10a2.965e-1227.65thyroid hormone receptor interactor 10a [Source:NC... [more]
fnbp1l2.384e-1021.97formin binding protein 1-like [Source:ZFIN;Acc:ZDB... [more]
fnbp1l2.660e-1021.97formin binding protein 1-like [Source:ZFIN;Acc:ZDB... [more]
fnbp1b9.628e-923.01formin binding protein 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
fnbp1b1.570e-823.01formin binding protein 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30015503 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fnbp1l3.220e-619.83formin binding protein 1 like [Source:NCBI gene;Ac... [more]
fnbp1l3.641e-619.83formin binding protein 1 like [Source:NCBI gene;Ac... [more]
back to top
BLAST of SMED30015503 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fnbp1l1.106e-921.43formin binding protein 1-like [Source:MGI Symbol;A... [more]
Trip104.845e-625.12thyroid hormone receptor interactor 10 [Source:MGI... [more]
Trip106.412e-625.12thyroid hormone receptor interactor 10 [Source:MGI... [more]
back to top
BLAST of SMED30015503 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q5U3Q6|CIP4_DANRE3.275e-1127.48Cdc42-interacting protein 4 homolog OS=Danio rerio... [more]
sp|Q6DCZ7|FBP1L_XENLA1.425e-619.83Formin-binding protein 1-like OS=Xenopus laevis OX... [more]
back to top
BLAST of SMED30015503 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KZE64.086e-1424.26Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9KZA44.672e-1324.26Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7NL714.495e-1222.62Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A3S1BUL92.371e-1124.48Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0X3PTP23.184e-1122.05SH3 domain-containing protein OS=Schistocephalus s... [more]
back to top
BLAST of SMED30015503 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trip10a2.447e-1126.15thyroid hormone receptor interactor 10 [Source:NCB... [more]
trip10a8.975e-1125.33thyroid hormone receptor interactor 10 [Source:NCB... [more]
trip10a1.013e-1025.45thyroid hormone receptor interactor 10 [Source:NCB... [more]
fnbp1a6.398e-921.37formin binding protein 1a [Source:ZFIN;Acc:ZDB-GEN... [more]
fnbp1l1.018e-821.81formin binding protein 1-like [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of SMED30015503 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001997.13.957e-822.91pep scaffold:Pmarinus_7.0:GL478230:377:34553:-1 ge... [more]
fnbp1a4.104e-626.13formin binding protein 1a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30015503 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015503 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO471482.937e-1023.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433454.407e-1023.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30015503 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIP104.014e-1221.87cdc42-interacting protein 4 homolog [Source:NCBI g... [more]
trip10a2.708e-1122.86thyroid hormone receptor interactor 10 [Source:NCB... [more]
trip10a8.922e-1124.67thyroid hormone receptor interactor 10 [Source:NCB... [more]
fnbp1b6.547e-1022.46formin binding protein 1 [Source:NCBI gene;Acc:101... [more]
fnbp1b4.295e-922.80formin binding protein 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SMED30015503 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000072876.10.000e+099.70SMESG000072876.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015503 ID=SMED30015503|Name=SMED30015503|organism=Schmidtea mediterranea sexual|type=transcript|length=1289bp
ACCCACCATCTGTCACCTTCCACCCACCACCTGTCTCCCACCATCTGCCA
TCCACCATTTGACCTGTCCATATTATCTAGGTGCAAGTCATCGCCAATGG
AAAAACAACAGAATTCGAAAGAATGAGGGGGGAATATGCCTCCCAACTGC
AAGTGTTCAATTCATTCCGAAGCACAACCTATCTGACAGACCTGCCAAAA
CTGTGCTCAGAACTAGAAATGATAGACCGCAAGCGGGCAGAAGTTACTAA
ACAAGCCGGGCTAGCTCTAGTCACAATTCAGAAGCATCATTTAGAGCGCG
TCGGCACTAGCAATGATTCAGTGGCCGAATCATTCAATCTAATAGATTAC
AAGGCTGATGCCAATTCCTTGGTGACGGGACAAAAATCAAATCTCTTGTT
TCCTCCGGATATTGTGTTTGTCGATTTGGATAAGTCCAAGGGAGATGCTT
TCAACGCTTCGGATTTCCCGGGAATTCTCCAGCAAGGTGGAAAAGTGGAA
AAGAATGATACTGCAAAATCGCTTTTCGGTGGAGTGGGCCTGAAAGGAAT
AGAGACAAAGGAGATGCTGCCGGAGCAGATCAAAATGCGGCTGGACGAGA
TCAAAAACGCCGTCAAGGTAATTGATAAGGGCTTGAGTGGCCTGAAGGTG
CTCGGGGAGACATATAAGAATAATCCGAGCATGGGCGACATCAGCAATAT
TGAGCCACAGATTGATGTCAACGAGCGGCAGTTGAAATCGCTACAGGAAA
TGACGGAATTTGTGGGCAAGCAGTGTCCCAAATATGCGGCAGAGTCTAAC
AGTGTGGTTAGGAACACGCCTCACCAGATATCCCGTGGCAATGAGAGTGA
CGGCAGTTTCGATGAGGACGATGAGGAGGATTTTGACGGCCAATTTGAAG
GGGATCGCAATTCAGGGAATTTGGCGAAGGTTTTGTATGATTTTGATTCC
GCCGATGCCCAGCAAATGAGCGTCTCAGCAAACATGACAGTCAAAATCCT
CACCTACGACGACTCGAATTCAGGATGGACCTTGGTGCAGAGCACTGAGA
ATCTGGCACTCAAGGGCTACGTTCCAACCAATTACATCAGCAAGTTGTGA
GCAGGCTGTGTAATGGTGATGATATTGACACAGTTACACACGCAGACACA
CAATCACTACATCATTACTCTGTCTGTATCTGTGTCGGTTGTCGTAGTTG
TTGTTGTTGTTGTTGTAGCTTATCTTTCTATATTGTGCCGTATTGATTAT
GTTTATTGATTTACGGATTTATTCGGCAGATCGGAAGAG
back to top

protein sequence of SMED30015503-orf-1

>SMED30015503-orf-1 ID=SMED30015503-orf-1|Name=SMED30015503-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MRGEYASQLQVFNSFRSTTYLTDLPKLCSELEMIDRKRAEVTKQAGLALV
TIQKHHLERVGTSNDSVAESFNLIDYKADANSLVTGQKSNLLFPPDIVFV
DLDKSKGDAFNASDFPGILQQGGKVEKNDTAKSLFGGVGLKGIETKEMLP
EQIKMRLDEIKNAVKVIDKGLSGLKVLGETYKNNPSMGDISNIEPQIDVN
ERQLKSLQEMTEFVGKQCPKYAAESNSVVRNTPHQISRGNESDGSFDEDD
EEDFDGQFEGDRNSGNLAKVLYDFDSADAQQMSVSANMTVKILTYDDSNS
GWTLVQSTENLALKGYVPTNYISKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 1..112
e-value: 2.5E-11
score: 45.2
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 2..101
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 262..325
e-value: 6.7E-12
score: 46.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 226..260
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 226..240
NoneNo IPR availablePANTHERPTHR15735FCH AND DOUBLE SH3 DOMAINS PROTEINcoord: 4..322
NoneNo IPR availablePANTHERPTHR15735:SF12CDC42-INTERACTING PROTEIN 4, ISOFORM Bcoord: 4..322
IPR001452SH3 domainPROSITEPS50002SH3coord: 263..325
score: 15.776
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 265..324