Splicing factor 3B subunit 2

Overview
NameSplicing factor 3B subunit 2
Smed IDSMED30015482
Length (bp)1686
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Splicing factor 3B subunit 2 (SMED30015482) t-SNE clustered cells

Violin plots show distribution of expression levels for Splicing factor 3B subunit 2 (SMED30015482) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Splicing factor 3B subunit 2 (SMED30015482) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Splicing factor 3B subunit 2 (SMED30015482) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015482

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015482SMESG000058116.1 SmedASXL_005279SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015482SMESG000058116.1 SmedASXL_005279SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30015482SMESG000058116.1 dd_Smed_v4_2932_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015482SMESG000058116.1 dd_Smed_v4_2932_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015482SMESG000058116.1 dd_Smed_v4_2932_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015482SMESG000058116.1 dd_Smed_v4_2932_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015482SMESG000058116.1 dd_Smed_v4_2932_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015482SMESG000058116.1 dd_Smed_v4_2932_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Human
Match: SF3B2 (splicing factor 3b subunit 2 [Source:HGNC Symbol;Acc:HGNC:10769])

HSP 1 Score: 432.18 bits (1110), Expect = 1.610e-141
Identity = 226/372 (60.75%), Postives = 281/372 (75.54%), Query Frame = 3
Query:  429 EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQV 1532
            E PK+ KK+L+RMNR T A+LK  V +P++VE  D  ++DP LL+ LK+ RN+VPVPRHWC KRKYLQGKRG EK PF+LPDFI +TGI EMR+ +Q+KE  KT+K+KMREK+RPK+G +DIDY KLHDAFFK Q KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR +LG+P GPNA K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP  CSFGYHA GWGKPPVDETG+P+YG+VF               + EE ++  WG    + E  +E+ SE+EEE+E  + + +  G  TPA+ GL+TP G SSV  G+ TP+ IELRKK IE+ +  +E P LFTV+P+ + A +G A+MGS  +Y +
Sbjct:  428 EAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVF----GTNAAEFQTKTEEEEIDRTPWG----ELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDM 791          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Human
Match: SF3B2 (splicing factor 3b subunit 2 [Source:HGNC Symbol;Acc:HGNC:10769])

HSP 1 Score: 432.18 bits (1110), Expect = 2.509e-141
Identity = 226/372 (60.75%), Postives = 281/372 (75.54%), Query Frame = 3
Query:  429 EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQV 1532
            E PK+ KK+L+RMNR T A+LK  V +P++VE  D  ++DP LL+ LK+ RN+VPVPRHWC KRKYLQGKRG EK PF+LPDFI +TGI EMR+ +Q+KE  KT+K+KMREK+RPK+G +DIDY KLHDAFFK Q KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR +LG+P GPNA K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP  CSFGYHA GWGKPPVDETG+P+YG+VF               + EE ++  WG    + E  +E+ SE+EEE+E  + + +  G  TPA+ GL+TP G SSV  G+ TP+ IELRKK IE+ +  +E P LFTV+P+ + A +G A+MGS  +Y +
Sbjct:  445 EAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVF----GTNAAEFQTKTEEEEIDRTPWG----ELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDM 808          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Human
Match: SF3B2 (splicing factor 3b subunit 2 [Source:HGNC Symbol;Acc:HGNC:10769])

HSP 1 Score: 237.269 bits (604), Expect = 4.804e-73
Identity = 137/235 (58.30%), Postives = 171/235 (72.77%), Query Frame = 3
Query:  837 KPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKPLFTVIPQIK-AEIGSAIMGSEKLYQV 1532
            KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR +LG+P GPNA K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP  CSFGYHA GWGKPPVDETG+P+YG+VF  N       +++    EE ++  WG    + E  +E+ SE+EEE+E  + + +  G  TPA+ GL+TP G SSV  G+ TP+ IELRKK IE+ +      LFTV+P+ + A +G A+MGS  +Y +
Sbjct:    2 KPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEE----EEIDRTPWG----ELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGETPQLFTVLPEKRTATVGGAMMGSTHIYDM 228          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Celegans
Match: sftb-2 (Splicing Factor ThreeB (3b) Subunit homolog [Source:UniProtKB/TrEMBL;Acc:O16997])

HSP 1 Score: 365.54 bits (937), Expect = 2.242e-119
Identity = 208/430 (48.37%), Postives = 284/430 (66.05%), Query Frame = 3
Query:  252 FELKGKFERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKARAAAILQDDHDRDENEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP--LFTVIPQIKAE-IGSAIMGSEKLYQV 1532
            F++    E   +Y     K E +DD    KV  A+ + +  M+ RA           EN E K+ +++L+   + + A+LK    + ++VE  D  S+DP LL+ +KS RN+VPVPRHW AKRKYL GKRGFE+ PF+LPDFI +TGI +MR+ + +KE  ++LK+KMRE+ RPK+G +DIDY KLHDAFFK Q KP +T  G++YYEGKE E  +++KKPG++SDELR ALG+P G NA K+PPPWLIAMQRYGPPPS+P++KIPGLNAPIP GC+FGYHA GWGKPPVDE G P+YG+VF    P   P  +  ++     ++WGEI SDE S+EE+  E+E  D+D            P EG++TPSG+++   G+ TP +IELR K  E  ++  + P   + +IP+ K E IG  +M S   Y +
Sbjct:   96 FKISTDSEDGFSYGHHVSKGEKKDDL--GKVGQAERIIQEEMEERAK----------ENTEEKLSRRKLRISLQPSIAKLKETTLRADVVEWADVTSRDPYLLVAMKSYRNSVPVPRHWNAKRKYLAGKRGFERPPFELPDFIKRTGIQDMREALLEKEESQSLKSKMRERARPKLGKIDIDYQKLHDAFFKWQTKPAMTKMGELYYEGKEMEAMMRDKKPGEMSDELRIALGMPIGSNAFKFPPPWLIAMQRYGPPPSFPHIKIPGLNAPIPEGCAFGYHAGGWGKPPVDEYGHPLYGDVFGLAAPAFEPEDESQIE----RRYWGEIGSDESSDEEESEEEEHADDDDADVEGGFQTPAPVEGMITPSGMTTGITGIETPDTIELR-KGKESSVLGTDTPAAAYHIIPEKKNERIGGQMMASSHTYDL 508          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Fly
Match: Sf3b2 (gene:FBgn0031493 transcript:FBtr0335484)

HSP 1 Score: 412.149 bits (1058), Expect = 1.575e-135
Identity = 212/356 (59.55%), Postives = 266/356 (74.72%), Query Frame = 3
Query:  471 RMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIKAE-IGSAIMGSEKLYQV 1532
            R++ A+LK  V +P++VE  D  ++DP LL++LK+ RNTV VPRHWC KRKYLQGKRG EK PF LP FI KTGIMEMR+++Q++E  KTLK KMRE++RPK+G +DIDY KLHDAFFK Q KP +TIHGD+YYEGKEFE +LKEKKPG LS+ELR ALG+P GPN+ K PPPWLIA QRYGPPPSYPNLKIPGLNAPIP G SFGYHA GWGKPPVDE G+P+YG+VF  N+             +E +    +    E   EE   E+EE+ ED+  + +  GL TP EGLVTPSG++SV  G+ TP++IELRKK IE ++  NE P L+ V+P+ + + IG+++MGS  +Y V
Sbjct:  309 RLSVAELKQLVSRPDVVEMHDVTARDPKLLVQLKAYRNTVQVPRHWCFKRKYLQGKRGIEKPPFDLPAFIKKTGIMEMRESLQEREDAKTLKAKMRERVRPKMGKIDIDYQKLHDAFFKWQTKPRMTIHGDLYYEGKEFETRLKEKKPGDLSEELRIALGMPVGPNSHKIPPPWLIAQQRYGPPPSYPNLKIPGLNAPIPDGTSFGYHAGGWGKPPVDENGKPLYGDVFGTNILDLDNGV------DEADIERNQWGELESESEESSEEEEEDGEDLGDQQDETGLVTPVEGLVTPSGLTSVPAGMETPENIELRKKKIEAEMEDNETPVLYQVLPEKRTDRIGASMMGSTHVYDV 658          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Fly
Match: Sf3b2 (gene:FBgn0031493 transcript:FBtr0077669)

HSP 1 Score: 412.149 bits (1058), Expect = 1.575e-135
Identity = 212/356 (59.55%), Postives = 266/356 (74.72%), Query Frame = 3
Query:  471 RMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIKAE-IGSAIMGSEKLYQV 1532
            R++ A+LK  V +P++VE  D  ++DP LL++LK+ RNTV VPRHWC KRKYLQGKRG EK PF LP FI KTGIMEMR+++Q++E  KTLK KMRE++RPK+G +DIDY KLHDAFFK Q KP +TIHGD+YYEGKEFE +LKEKKPG LS+ELR ALG+P GPN+ K PPPWLIA QRYGPPPSYPNLKIPGLNAPIP G SFGYHA GWGKPPVDE G+P+YG+VF  N+             +E +    +    E   EE   E+EE+ ED+  + +  GL TP EGLVTPSG++SV  G+ TP++IELRKK IE ++  NE P L+ V+P+ + + IG+++MGS  +Y V
Sbjct:  309 RLSVAELKQLVSRPDVVEMHDVTARDPKLLVQLKAYRNTVQVPRHWCFKRKYLQGKRGIEKPPFDLPAFIKKTGIMEMRESLQEREDAKTLKAKMRERVRPKMGKIDIDYQKLHDAFFKWQTKPRMTIHGDLYYEGKEFETRLKEKKPGDLSEELRIALGMPVGPNSHKIPPPWLIAQQRYGPPPSYPNLKIPGLNAPIPDGTSFGYHAGGWGKPPVDENGKPLYGDVFGTNILDLDNGV------DEADIERNQWGELESESEESSEEEEEDGEDLGDQQDETGLVTPVEGLVTPSGLTSVPAGMETPENIELRKKKIEAEMEDNETPVLYQVLPEKRTDRIGASMMGSTHVYDV 658          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Zebrafish
Match: sf3b2 (splicing factor 3b, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-070928-1])

HSP 1 Score: 433.335 bits (1113), Expect = 1.041e-142
Identity = 238/418 (56.94%), Postives = 302/418 (72.25%), Query Frame = 3
Query:  402 QDDHDRDEN---EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE---GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTTSGQKSSQPPEPTE 1628
            +D  D DE    + PK+ KK+L+RMNR+T A+LK  V +P++VE  D  +++P LL+ LK+ RNTVPVPRHWC KRKYLQGKRG EK PF+LP+FI +TGI EMR+ +Q+KE  KT+KTKMREK+RPK+G +DIDY KLHDAFFK Q+KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR ALG+PTGPN+ K PPPWLIAMQRYGPPPSYPNLKIPGLNAPIP GCSFGYHA GWGKPPVDETG+P+YG+VF               + EE ++  WG    + E  +E+ SE+EEE+E  + + +  G FTPA+   GL+TP G SSV  G+ TP+ IELRKK IE+ +  NE P LFTV+P+ +   +G+A+M S  +Y +    + ++K       G + G + +  PE  E
Sbjct:  358 RDSDDSDEEIKKDLPKLSKKKLRRMNRLTVAELKQLVARPDVVEMHDVTAQEPKLLVHLKATRNTVPVPRHWCFKRKYLQGKRGIEKPPFELPEFIRRTGIQEMREALQEKEDAKTMKTKMREKVRPKMGKIDIDYQKLHDAFFKWQIKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRVALGMPTGPNSHKVPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPEGCSFGYHAGGWGKPPVDETGKPLYGDVF----GTNSIDFQAKAEEEEVDRTPWG----ELEPSDEESSEEEEEEESDEEKPDETGFFTPADSHSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGNETPQLFTVLPERRTGPVGAAMMASTHIYDM-TTTVTSRKVGVSVLGGDSQGVEVALAPEELE 766          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Xenopus
Match: stt3b (STT3B, catalytic subunit of the oligosaccharyltransferase complex [Source:Xenbase;Acc:XB-GENE-969894])

HSP 1 Score: 424.861 bits (1091), Expect = 1.141e-140
Identity = 223/373 (59.79%), Postives = 276/373 (73.99%), Query Frame = 3
Query:  426 NEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQV 1532
             + PK+ KK+L+RMNR T A+LK  V +P++VE  D  + DP LL+ LK  RN+VPVPRHWC KRKYLQGKRG EK PF+LPDFI +TGI EMR+ +Q+KE  KT+K+KMREK+RPK+G +DIDY KLHDAFFK Q KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR  LG+P GPNA K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP GCSFGYHA GWGKPPVDE G+P+YG+VF               + E+ ++  WG    + E  +++ S +EEEDE  + + +  G  TPA+ GL+TP G SSV  G+ TP+ IELRKK IE+ +   E P LFTV+P+ + A +G A+MGS  +Y +
Sbjct:  252 QDAPKLSKKKLRRMNRFTVAELKQLVSRPDVVEMHDVTAPDPKLLVHLKGTRNSVPVPRHWCFKRKYLQGKRGIEKPPFQLPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQSKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRITLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPEGCSFGYHAGGWGKPPVDEMGKPLYGDVF----GTNASDFQSKNEEEDIDRTPWG----ELELSDDESSSEEEEDESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGTETPQLFTVLPEKRTATVGGAMMGSTHIYDM 616          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Xenopus
Match: stt3b (STT3B, catalytic subunit of the oligosaccharyltransferase complex [Source:Xenbase;Acc:XB-GENE-969894])

HSP 1 Score: 426.017 bits (1094), Expect = 2.046e-140
Identity = 223/373 (59.79%), Postives = 276/373 (73.99%), Query Frame = 3
Query:  426 NEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQV 1532
             + PK+ KK+L+RMNR T A+LK  V +P++VE  D  + DP LL+ LK  RN+VPVPRHWC KRKYLQGKRG EK PF+LPDFI +TGI EMR+ +Q+KE  KT+K+KMREK+RPK+G +DIDY KLHDAFFK Q KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR  LG+P GPNA K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP GCSFGYHA GWGKPPVDE G+P+YG+VF               + E+ ++  WG    + E  +++ S +EEEDE  + + +  G  TPA+ GL+TP G SSV  G+ TP+ IELRKK IE+ +   E P LFTV+P+ + A +G A+MGS  +Y +
Sbjct:  312 QDAPKLSKKKLRRMNRFTVAELKQLVSRPDVVEMHDVTAPDPKLLVHLKGTRNSVPVPRHWCFKRKYLQGKRGIEKPPFQLPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQSKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRITLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPEGCSFGYHAGGWGKPPVDEMGKPLYGDVF----GTNASDFQSKNEEEDIDRTPWG----ELELSDDESSSEEEEDESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGTETPQLFTVLPEKRTATVGGAMMGSTHIYDM 676          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Mouse
Match: Sf3b2 (splicing factor 3b, subunit 2 [Source:MGI Symbol;Acc:MGI:2441856])

HSP 1 Score: 431.795 bits (1109), Expect = 1.557e-141
Identity = 226/372 (60.75%), Postives = 281/372 (75.54%), Query Frame = 3
Query:  429 EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQV 1532
            E PK+ KK+L+RMNR T A+LK  V +P++VE  D  ++DP LL+ LK+ RN+VPVPRHWC KRKYLQGKRG EK PF+LPDFI +TGI EMR+ +Q+KE  KT+K+KMREK+RPK+G +DIDY KLHDAFFK Q KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR +LG+P GPNA K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP  CSFGYHA GWGKPPVDETG+P+YG+VF               + EE ++  WG    + E  +E+ SE+EEE+E  + + +  G  TPA+ GL+TP G SSV  G+ TP+ IELRKK IE+ +  +E P LFTV+P+ + A +G A+MGS  +Y +
Sbjct:  428 EAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVF----GTNAAEFQTKTEEEEIDRTPWG----ELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDM 791          
BLAST of Splicing factor 3B subunit 2 vs. UniProt/SwissProt
Match: sp|Q13435|SF3B2_HUMAN (Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2)

HSP 1 Score: 432.18 bits (1110), Expect = 1.205e-140
Identity = 226/372 (60.75%), Postives = 281/372 (75.54%), Query Frame = 3
Query:  429 EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQV 1532
            E PK+ KK+L+RMNR T A+LK  V +P++VE  D  ++DP LL+ LK+ RN+VPVPRHWC KRKYLQGKRG EK PF+LPDFI +TGI EMR+ +Q+KE  KT+K+KMREK+RPK+G +DIDY KLHDAFFK Q KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR +LG+P GPNA K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP  CSFGYHA GWGKPPVDETG+P+YG+VF               + EE ++  WG    + E  +E+ SE+EEE+E  + + +  G  TPA+ GL+TP G SSV  G+ TP+ IELRKK IE+ +  +E P LFTV+P+ + A +G A+MGS  +Y +
Sbjct:  445 EAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVF----GTNAAEFQTKTEEEEIDRTPWG----ELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDM 808          
BLAST of Splicing factor 3B subunit 2 vs. UniProt/SwissProt
Match: sp|Q9UUI3|SA145_SCHPO (Pre-mRNA-splicing factor sap145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sap145 PE=1 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 1.582e-89
Identity = 141/266 (53.01%), Postives = 183/266 (68.80%), Query Frame = 3
Query:  384 RAAAILQDDHDRDENEEPKIGKKQ--------LKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVF 1157
            +   +  DD    E EE  + K+Q        L+++ RMT AQLK+  ++ ++VE WD  S DP+ L  LK+  NTVPVPRHW  KR YL G+RG E+  F+LP +I  TGI++MR  V + E D  L+ KMRE+++PK+G +DIDY KLHDAFF+ Q KP LT  G+ Y+EGKE E  +KEK+PG +S+ELR ALG+  G      PPPWL AMQRYGPPPSYP+LKIPG+N PIP G  +G+H  GWGKPPVD+  RP+YG+VF
Sbjct:  149 KGQIMYSDDEILSEGEEDALQKQQEEKLSKKKLRKLKRMTVAQLKMLSEKADVVEWWDVSSLDPLFLTHLKAYPNTVPVPRHWNQKRDYLSGQRGIERQLFELPSYIRATGIVQMRNAVHENEADMPLRQKMRERVQPKMGKLDIDYQKLHDAFFRYQTKPVLTGFGECYFEGKELEADVKEKRPGDISEELREALGIAPGA-----PPPWLFAMQRYGPPPSYPDLKIPGVNCPIPTGAQWGFHPGGWGKPPVDQFNRPLYGDVF 409          
BLAST of Splicing factor 3B subunit 2 vs. UniProt/SwissProt
Match: sp|Q02554|CUS1_YEAST (Cold sensitive U2 snRNA suppressor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CUS1 PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 5.875e-41
Identity = 102/292 (34.93%), Postives = 155/292 (53.08%), Query Frame = 3
Query:  231 TLDNIVEFELKGKFERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKARAAAILQDDHDRDENEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTV----QDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFK--DQVKPP-LTIHGDIYYEGK------EFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPI 1067
             +D  +E E K   +RF    + D   E   D KN  V   +    +  K  A   L+D     +  E  +  ++ ++  + + +QLK  V  P+++E +D  ++ P LL  +K  +N +PVP HW +K++YL G+    K PF+LPD I KT I +MR T+     D + +K+LK   R +++PK+G +D+DY KLHD FFK     KP  L   GD+YYE +       ++  +  K+PG++S ELR  + LP G       PPW + M+  G P  YP+LKI GLN  I
Sbjct:   54 VVDAKLEKEFKDVLQRF-QVQENDTPKEITKDEKNNHVVIVEKNPVMNRKHTAEDELEDTPS--DGIEEHLSARKRRKTEKPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPQSGLDGQDEKSLKEASRARVQPKMGALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQELRAIMNLPEGQ-----LPPWCMKMKDIGLPTGYPDLKIAGLNWDI 337          
BLAST of Splicing factor 3B subunit 2 vs. TrEMBL
Match: A0A293MWQ8 (Splicing factor 3B subunit (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 1.889e-147
Identity = 240/391 (61.38%), Postives = 292/391 (74.68%), Query Frame = 3
Query:  429 EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIKAE-IGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTTSG 1595
            E+PK+ K+++K+++RM+ A LK  V++PELVE  D  +KDP+LLL LKS RNTVPVPRHWC KRKYLQGKRG EK PF LP FI KTGIMEMRQ +Q+KE  KT+K KMREK+RPK+G +DIDY KLHDAFFK Q KP +T+HGD+YYEGKEFE +LKEKKPG LSD+LR ALG+PTGPN+ K PPPWLIAMQRYGPPPSYPNLKIPGLNAPIP GCSFGYHA GWGKPPVDE GRP+YG+VF          S+   + E  +  WG    + ESE  +ESE EEE E+ +   +  GL TPAEGLVTPSG SS+  G+ TP+ IELRK+ IE ++   + P L+TV+P+ KA+ +G+A+MGS  +Y +     K  K VA T S    G
Sbjct:  210 EKPKLSKRKMKKLSRMSIADLKQKVNRPELVEMHDVTAKDPVLLLHLKSSRNTVPVPRHWCFKRKYLQGKRGIEKPPFDLPGFIKKTGIMEMRQALQEKEDQKTMKAKMREKVRPKLGKIDIDYQKLHDAFFKWQTKPRMTMHGDLYYEGKEFETRLKEKKPGDLSDDLRIALGMPTGPNSQKCPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPDGCSFGYHAGGWGKPPVDEMGRPLYGDVF---GTQSADGSNMLPEEEVDHTLWG----ELESESSEESEAEEESEEEEQPEDETGLVTPAEGLVTPSGFSSIPAGVETPEMIELRKRKIETEMEGGDTPSLYTVLPEKKADRVGAAMMGSTHIYDMSAALAKGAK-VAGTVSDRPGG 592          
BLAST of Splicing factor 3B subunit 2 vs. TrEMBL
Match: A0A2R5LHS0 (Putative splicing factor 3b subunit 2 (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 2.033e-146
Identity = 234/368 (63.59%), Postives = 284/368 (77.17%), Query Frame = 3
Query:  429 EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIKAE-IGSAIMGSEKLY 1526
            E+PK+ K+++K+++RM+ A LK  V++PELVE  D  +KDP+LLL LKS RNTVPVPRHWC KRKYLQGKRG EK PF LP FI KTGIMEMRQ +Q+KE  KT+K KMREK+RPK+G +DIDY KLHDAFFK Q KP +T+HGD+YYEGKEFE +LKEKKPG LSD+LR ALG+PTGPN+ K PPPWLIAMQRYGPPPSYPNLKIPGLNAPIP GCSFGYHA GWGKPPVDE GRP+YG+VF          S+   + E  +  WG    + ESE  +ESE EEE E+ +   +  GL TPAEGLVTPSG SS+  G+ TP+ IELRK+ IE ++   + P L+TV+P+ KAE +G+A+MGS  +Y
Sbjct:  445 EKPKLSKRKMKKLSRMSIADLKQKVNRPELVEMHDVTAKDPVLLLHLKSSRNTVPVPRHWCFKRKYLQGKRGIEKPPFDLPGFIKKTGIMEMRQALQEKEDQKTMKAKMREKVRPKLGKIDIDYQKLHDAFFKWQTKPRMTMHGDLYYEGKEFETRLKEKKPGDLSDDLRIALGMPTGPNSQKCPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPDGCSFGYHAGGWGKPPVDEMGRPLYGDVF---GTQSADGSNMLPEEEVDHTLWG----ELESESSEESEAEEESEEEEQAEDETGLVTPAEGLVTPSGFSSIPAGVETPEMIELRKRKIETEMEGGDTPSLYTVLPEKKAERVGAAMMGSTHIY 805          
BLAST of Splicing factor 3B subunit 2 vs. TrEMBL
Match: A0A293M0Z1 (Splicing factor 3B subunit (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 5.729e-146
Identity = 240/391 (61.38%), Postives = 292/391 (74.68%), Query Frame = 3
Query:  429 EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIKAE-IGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTTSG 1595
            E+PK+ K+++K+++RM+ A LK  V++PELVE  D  +KDP+LLL LKS RNTVPVPRHWC KRKYLQGKRG EK PF LP FI KTGIMEMRQ +Q+KE  KT+K KMREK+RPK+G +DIDY KLHDAFFK Q KP +T+HGD+YYEGKEFE +LKEKKPG LSD+LR ALG+PTGPN+ K PPPWLIAMQRYGPPPSYPNLKIPGLNAPIP GCSFGYHA GWGKPPVDE GRP+YG+VF          S+   + E  +  WG    + ESE  +ESE EEE E+ +   +  GL TPAEGLVTPSG SS+  G+ TP+ IELRK+ IE ++   + P L+TV+P+ KA+ +G+A+MGS  +Y +     K  K VA T S    G
Sbjct:  360 EKPKLSKRKMKKLSRMSIADLKQKVNRPELVEMHDVTAKDPVLLLHLKSSRNTVPVPRHWCFKRKYLQGKRGIEKPPFDLPGFIKKTGIMEMRQALQEKEDQKTMKAKMREKVRPKLGKIDIDYQKLHDAFFKWQTKPRMTMHGDLYYEGKEFETRLKEKKPGDLSDDLRIALGMPTGPNSQKCPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPDGCSFGYHAGGWGKPPVDEMGRPLYGDVF---GTQSADGSNMLPEEEVDHTLWG----ELESESSEESEAEEESEEEEQPEDETGLVTPAEGLVTPSGFSSIPAGVETPEMIELRKRKIETEMEGGDTPSLYTVLPEKKADRVGAAMMGSTHIYDMSAALAKGAK-VAGTVSDRPGG 742          
BLAST of Splicing factor 3B subunit 2 vs. TrEMBL
Match: A0A293LPF8 (Splicing factor 3B subunit (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 6.712e-146
Identity = 240/391 (61.38%), Postives = 292/391 (74.68%), Query Frame = 3
Query:  429 EEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIKAE-IGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTTSG 1595
            E+PK+ K+++K+++RM+ A LK  V++PELVE  D  +KDP+LLL LKS RNTVPVPRHWC KRKYLQGKRG EK PF LP FI KTGIMEMRQ +Q+KE  KT+K KMREK+RPK+G +DIDY KLHDAFFK Q KP +T+HGD+YYEGKEFE +LKEKKPG LSD+LR ALG+PTGPN+ K PPPWLIAMQRYGPPPSYPNLKIPGLNAPIP GCSFGYHA GWGKPPVDE GRP+YG+VF          S+   + E  +  WG    + ESE  +ESE EEE E+ +   +  GL TPAEGLVTPSG SS+  G+ TP+ IELRK+ IE ++   + P L+TV+P+ KA+ +G+A+MGS  +Y +     K  K VA T S    G
Sbjct:  374 EKPKLSKRKMKKLSRMSIADLKQKVNRPELVEMHDVTAKDPVLLLHLKSSRNTVPVPRHWCFKRKYLQGKRGIEKPPFDLPGFIKKTGIMEMRQALQEKEDQKTMKAKMREKVRPKLGKIDIDYQKLHDAFFKWQTKPRMTMHGDLYYEGKEFETRLKEKKPGDLSDDLRIALGMPTGPNSQKCPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPDGCSFGYHAGGWGKPPVDEMGRPLYGDVF---GTQSADGSNMLPEEEVDHTLWG----ELESESSEESEAEEESEEEEQPEDETGLVTPAEGLVTPSGFSSIPAGVETPEMIELRKRKIETEMEGGDTPSLYTVLPEKKADRVGAAMMGSTHIYDMSAALAKGAK-VAGTVSDRPGG 756          
BLAST of Splicing factor 3B subunit 2 vs. TrEMBL
Match: V5HP67 (Putative splicing factor 3b subunit 2 OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 1.189e-145
Identity = 227/387 (58.66%), Postives = 287/387 (74.16%), Query Frame = 3
Query:  435 PKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIKAE-IGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTT 1589
            PK+ K+++K+++RM+ A+LK  V++PELVE  D  ++DP+LLL LKS RNTVPVPRHWC KRKYLQGKRG EK PF LP FI KTGIMEMRQ +QDKE  KT+K KMREK+RPK+G +DIDY KLHDAFFK Q KP +++HGD+YYEGKEFE +LKEKKPG L+D+LR ALG+PTGPN+ + PPPWLIAMQRYGPPPSYP+LKIPGLNAPIP GCSFGYHA GWGKPPVDE GRP+YG+VF            D ++ E     WG     E   E  E E++E++E+ +   +  GL TPAEGLVTPSG SS+  G+ TP  IELRK+ IE ++   + P L+T++P+ KA+ +G+A+MGS  +Y +    M    ++ PT  G+ 
Sbjct:  199 PKLSKRKMKKLSRMSIAELKQKVNRPELVEMHDVTARDPVLLLHLKSSRNTVPVPRHWCFKRKYLQGKRGIEKPPFDLPGFIKKTGIMEMRQALQDKEDQKTMKAKMREKVRPKLGKIDIDYQKLHDAFFKWQTKPRMSMHGDLYYEGKEFETRLKEKKPGDLTDDLRIALGMPTGPNSHRCPPPWLIAMQRYGPPPSYPSLKIPGLNAPIPDGCSFGYHAGGWGKPPVDEMGRPLYGDVF---GTQSSDAMKDMVEEEVDRTLWG-----ELESESSEEEEDEDEEEEEALXDETGLVTPAEGLVTPSGFSSIPAGVETPDMIELRKRKIESEMEGGDTPALYTILPEKKADRVGAAMMGSAHVYDM-SAAMAKGAKLPPTVGGSV 576          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Cavefish
Match: sf3b2 (splicing factor 3b subunit 2 [Source:NCBI gene;Acc:103042319])

HSP 1 Score: 440.654 bits (1132), Expect = 4.417e-147
Identity = 233/401 (58.10%), Postives = 297/401 (74.06%), Query Frame = 3
Query:  384 RAAAILQDDHDRDENEE------PKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQVPEMDMKNK 1556
            R    L++  D D+++E      PK+ KK+L+RMNR+T A+LK  V +P++VE  D  +++P LL+ LK+ RNTVPVPRHWC KRKYLQGKRG EK PF+LP+FI +TGI EMR+ +Q+KE  KT+KTKMREK+RPK+G +DIDY KLHDAFFK Q+KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR ALG+PTGPN+ K PPPWLIAMQRYGPPPSYPNLKIPGLNAPIP  CSFGYHA GWGKPPVDETG+P+YG+VF               + EE ++  WG    + E  +E+ SE+EEE+E  + + +  G FTPA+ G++TP G SSV  G+ TP+ IELRKK IE+ +  NE P LFTV+P+ +   +GSA+M S  +Y +  + ++ K
Sbjct:  234 RKKGFLEEKKDSDDSDEELKPDAPKLSKKKLRRMNRLTVAELKQLVARPDVVEMHDVTAQEPKLLVHLKATRNTVPVPRHWCFKRKYLQGKRGIEKPPFELPEFIKRTGIQEMREALQEKEDAKTMKTKMREKVRPKMGKIDIDYQKLHDAFFKWQIKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRIALGMPTGPNSHKVPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPENCSFGYHAGGWGKPPVDETGKPLYGDVF----GTNAVDFQAKAEEEEVDRTPWG----ELEPSDEESSEEEEEEESDEDKPDETGFFTPADSGMITPGGFSSVPAGMETPELIELRKKKIEEAMDGNETPQLFTVLPERRTGPVGSAMMASTHIYDISAVSLRAK 626          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Cavefish
Match: sf3b2 (splicing factor 3b subunit 2 [Source:NCBI gene;Acc:103042319])

HSP 1 Score: 439.113 bits (1128), Expect = 2.965e-144
Identity = 238/425 (56.00%), Postives = 302/425 (71.06%), Query Frame = 3
Query:  384 RAAAILQDDHDRDENEE------PKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTTSGQKSSQPPEPTE 1628
            R    L++  D D+++E      PK+ KK+L+RMNR+T A+LK  V +P++VE  D  +++P LL+ LK+ RNTVPVPRHWC KRKYLQGKRG EK PF+LP+FI +TGI EMR+ +Q+KE  KT+KTKMREK+RPK+G +DIDY KLHDAFFK Q+KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR ALG+PTGPN+ K PPPWLIAMQRYGPPPSYPNLKIPGLNAPIP  CSFGYHA GWGKPPVDETG+P+YG+VF               + EE ++  WG    + E  +E+ SE+EEE+E  + + +  G FTPA+ G++TP G SSV  G+ TP+ IELRKK IE+ +  NE P LFTV+P+ +   +GSA+M S  +Y +       K        G + G + +  PE  E
Sbjct:  409 RKKGFLEEKKDSDDSDEELKPDAPKLSKKKLRRMNRLTVAELKQLVARPDVVEMHDVTAQEPKLLVHLKATRNTVPVPRHWCFKRKYLQGKRGIEKPPFELPEFIKRTGIQEMREALQEKEDAKTMKTKMREKVRPKMGKIDIDYQKLHDAFFKWQIKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRIALGMPTGPNSHKVPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPENCSFGYHAGGWGKPPVDETGKPLYGDVF----GTNAVDFQAKAEEEEVDRTPWG----ELEPSDEESSEEEEEEESDEDKPDETGFFTPADSGMITPGGFSSVPAGMETPELIELRKKKIEEAMDGNETPQLFTVLPERRTGPVGSAMMASTHIYDISAAAAGRKVGGVSGLGGDSQGVEVALAPEELE 825          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Sea Lamprey
Match: sf3b2 (splicing factor 3b, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-070928-1])

HSP 1 Score: 204.912 bits (520), Expect = 8.788e-62
Identity = 120/224 (53.57%), Postives = 153/224 (68.30%), Query Frame = 3
Query:  873 EGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKF-WGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP--LFTVIPQIKAEIGSAIMGSEKLYQV 1532
            +GKEFE +LKEKKPG LSD+LR ALG+P G N  K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP GC+FGYHA GWGKPPVDE GRP+YG+VF  +       +++    E+ ++  WG     E    ++E   EEE+E  D   +  GL TPA+ GLVTP G +SV  G+ TP  IELRKK IE+ +   + P  LF  +P+ +  +G+A+MGS  +Y +
Sbjct:    1 QGKEFETRLKEKKPGDLSDDLRIALGMPIGLNCAKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPEGCTFGYHAGGWGKPPVDEMGRPLYGDVFGVSAQDFQEKAEE----EDMDRTPWG-----ELEASDEEESSEEEEESEDEAPDASGLITPADSGLVTPGGFASVPTGMETPDMIELRKKKIEELMDGGDTPQQLFIPLPEKRIGVGAAMMGSAHIYDM 215          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Sea Lamprey
Match: SF3B2 (splicing factor 3b subunit 2 [Source:HGNC Symbol;Acc:HGNC:10769])

HSP 1 Score: 141.739 bits (356), Expect = 1.220e-36
Identity = 65/98 (66.33%), Postives = 81/98 (82.65%), Query Frame = 3
Query:  432 EPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDK 725
            +PK+ KK+L+RMNR+T A+LK  V +P++VE  D  ++DP LL++LKS RNTVPVPRHWC KRKYLQGKRG EK PF LPDFI +TGIMEMRQ +Q+K
Sbjct:  404 QPKLSKKKLRRMNRLTVAELKQLVMRPDVVEMHDVTARDPKLLVQLKSTRNTVPVPRHWCFKRKYLQGKRGIEKPPFDLPDFIKRTGIMEMRQALQEK 501          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Yeast
Match: CUS1 (Protein required for assembly of U2 snRNP into the spliceosome; forms a complex with Hsh49p and Hsh155p [Source:SGD;Acc:S000004853])

HSP 1 Score: 157.147 bits (396), Expect = 8.461e-43
Identity = 102/292 (34.93%), Postives = 155/292 (53.08%), Query Frame = 3
Query:  231 TLDNIVEFELKGKFERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKARAAAILQDDHDRDENEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTV----QDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFK--DQVKPP-LTIHGDIYYEGK------EFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPI 1067
             +D  +E E K   +RF    + D   E   D KN  V   +    +  K  A   L+D     +  E  +  ++ ++  + + +QLK  V  P+++E +D  ++ P LL  +K  +N +PVP HW +K++YL G+    K PF+LPD I KT I +MR T+     D + +K+LK   R +++PK+G +D+DY KLHD FFK     KP  L   GD+YYE +       ++  +  K+PG++S ELR  + LP G       PPW + M+  G P  YP+LKI GLN  I
Sbjct:   54 VVDAKLEKEFKDVLQRF-QVQENDTPKEITKDEKNNHVVIVEKNPVMNRKHTAEDELEDTPS--DGIEEHLSARKRRKTEKPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPQSGLDGQDEKSLKEASRARVQPKMGALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQELRAIMNLPEGQ-----LPPWCMKMKDIGLPTGYPDLKIAGLNWDI 337          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Nematostella
Match: EDO40194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W8])

HSP 1 Score: 413.305 bits (1061), Expect = 2.070e-139
Identity = 235/430 (54.65%), Postives = 304/430 (70.70%), Query Frame = 3
Query:  270 FERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKARAAAILQDDHDRD--ENEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEG--NKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPN--EKP-LFTVIPQIKAEIGSAIMGSEKLYQVP 1535
            FE F   D  + +   +DD K  KV N +   E+   A    + +DD +    E+++PK+ KK+L++MNR++ A+LK  V +P++VE  D  + DP LL+ LKS RNTVPVPRHWC KRKYLQGKRG  K  F LP+FI KTGIMEMR+ +Q+KE  KTLK KMREK+RPK+G ++IDY KLHDAFF+ Q KP ++IHGD+YYEGKEFE KLKEKKPG LSD+L+TALG+PTG  +   PPPWLIAMQRYGPPPSYPNLKI GLNAPIP G SFGYHA GWGKPPVDETGRP+YG+VF            ++   EEG   + WG      E E E+ESE+E E+E  + E ++ GL TPA+ GLVTPSG++S+  G+ TP  IELRKK   ++ M    E+P L+T++ + ++ +G A+MGS  +Y++P
Sbjct:   12 FEAFRLSDPAEKEGGKKDDQK--KVVNKKP--EVKDSALDTKMEEDDEEVKPPESDQPKLSKKKLRKMNRLSVAELKQLVPRPDVVEMHDVTAHDPKLLVFLKSCRNTVPVPRHWCFKRKYLQGKRGIVKPAFDLPEFIKKTGIMEMREAMQEKEEQKTLKAKMREKVRPKMGKINIDYQKLHDAFFRWQTKPKMSIHGDLYYEGKEFETKLKEKKPGDLSDDLKTALGMPTGQGSHLVPPPWLIAMQRYGPPPSYPNLKIAGLNAPIPEGASFGYHAGGWGKPPVDETGRPLYGDVF-----GVQSLDANEDVDEEGVERQPWG------ELESEEESEEESEEESSEEEEDHTGLITPADTGLVTPSGLTSIPAGMETPDMIELRKKKSIEEAMETGAEQPSLYTMLQEKRSNVGGAMMGSSHVYEIP 426          
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Medaka
Match: sf3b2 (splicing factor 3b subunit 2 [Source:NCBI gene;Acc:101159948])

HSP 1 Score: 432.18 bits (1110), Expect = 7.471e-142
Identity = 226/380 (59.47%), Postives = 285/380 (75.00%), Query Frame = 3
Query:  405 DDHDRDENEE-PKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAE-GLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKP-LFTVIPQIK-AEIGSAIMGSEKLYQV 1532
            DD D +  ++ PK+ KK+L+RMNR+T A+LK  V +P++VE  D  +++P LL+ LK+ RNTVPVPRHWC KRKYLQGKRG EK PF+LP+FI +TGI EMR+ +Q+KE  KT+KTKMREK+RPK+G +DIDY KLHDAFFK Q+KP LTIHGD+YYEGKEFE +LKEKKPG LSDELR ALG+P GPNA K PPPWLIAMQRYGPPPSYPNLKIPGLN+PIP  C+FGYHA GWGKPPVDE G+P+YG+VF               + E  +  WG    + E  +E+ SE+EEE+E  + + +  G FTPA+ GL+TP G SSV  G+ TP+ IELRKK IE+ +  NE P LFTV+P+ +   +G+A+M S  +Y +
Sbjct:  406 DDSDEEAKQDVPKLSKKKLRRMNRLTVAELKQLVARPDVVEMHDVTAQEPKLLVHLKATRNTVPVPRHWCFKRKYLQGKRGIEKPPFELPEFIRRTGIQEMREALQEKEDAKTMKTKMREKVRPKMGKIDIDYQKLHDAFFKWQIKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRIALGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPENCTFGYHAGGWGKPPVDEMGKPLYGDVF---GTNSADFQAKAEEEEVDHTPWG----ELEPSDEESSEEEEEEESDEEKPDETGFFTPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGNETPQLFTVLPERRTGPVGAAMMASTHIYDM 778          
BLAST of Splicing factor 3B subunit 2 vs. Planmine SMEST
Match: SMESG000058116.1 (SMESG000058116.1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 485/486 (99.79%), Postives = 486/486 (100.00%), Query Frame = 3
Query:  174 EFEIIKQEHVEIELIEYPTTLDNIVEFELKGKFERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKARAAAILQDDHDRDENEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLMPNEKPLFTVIPQIKAEIGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTTSGQKSSQPPEPTEP 1631
            EFEIIKQEHVEIELIEYPTTLDNIVEFELKGKFERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKARAAAILQDDHDRDENEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLDNLPIPPPPSDDDMDGEEGNKFWGEIESDEESEEEDESEKEEEDEDVDMETENEGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKA+EDDLMPNEKPLFTVIPQIKAEIGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTTSGQKSSQPPEPTEP
Sbjct:   31 EFEIIKQEHVEIELIEYPTTLDNIVEFELKGKFERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKARAAAILQDDHDRDENEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLDNLPIPPPPSDDDMDGEEGNKFWGEIESDEESEEEDESEKEEEDEDVDMETENEGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAVEDDLMPNEKPLFTVIPQIKAEIGSAIMGSEKLYQVPEMDMKNKKRVAPTPSGTTSGQKSSQPPEPTEP 516          
BLAST of Splicing factor 3B subunit 2 vs. Planmine SMEST
Match: SMESG000041240.1 (SMESG000041240.1)

HSP 1 Score: 448.743 bits (1153), Expect = 4.059e-153
Identity = 254/467 (54.39%), Postives = 326/467 (69.81%), Query Frame = 3
Query:  186 IKQEHVE-IELIEYPTTLDNIVEFELKGKFERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKARAAAILQDDHDRDE-NEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWDYCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIAKTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQVKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETGRPIYGEVFLXXXXXXXXXXXXXXXGEEGNKFWGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIEDDLM----PNEKPLFTVIPQIKAEIGSAIMGSEKLYQV--PEMDMKNKKR 1562
            +K++  E  E++ Y + LDNI EF+L G FERF N   ED K E   +  N KV   +   +LP KA AAAIL+ +H +DE ++  K+ KK+ K++NR++   LKI V +P+LVE WD CS+DPI LLELKS RNTVPVPRHWCA  KYLQGKRGF K PFKLP+FI+KTGIMEMRQT  DKE +K+LK KM++KIRPKVG VDI Y KL++AFF +Q KP LT  GDIYY+GKE E + KE +PG LSDELR ALG+ TGPNA+K PPPWLIA QRYGPPPSYPNLKIPGLN  IP GCSFG+HA GWGKPPVD+ G+P+YG+VF  N     P   D    E+  K+WGE+ES+ E  E +E E + ++E+       +    P+     PSG ++  QG     +IELRKK  E++++      +K LF +IP++K+ IGS IMGS+K+Y +   E +M+ +KR
Sbjct:   30 VKEDFTEQTEVVIYESNLDNIEEFQLTGGFERF-NLFYEDKKKE---NDANEKVKFNE---DLPRKAIAAAILESNHVKDELDDGGKMSKKRWKKLNRISIGDLKIRVKKPDLVEPWDNCSRDPIFLLELKSKRNTVPVPRHWCATGKYLQGKRGFVKPPFKLPEFISKTGIMEMRQTADDKESEKSLKNKMKDKIRPKVGLVDISYEKLYNAFFVEQTKPELTKFGDIYYQGKELEGRRKENRPGILSDELRVALGMTTGPNAEKTPPPWLIAQQRYGPPPSYPNLKIPGLNKGIPPGCSFGFHAGGWGKPPVDDDGKPLYGDVF-ANAFNTAPVLIDLDADEDDEKYWGEVESNGEDSEIEEEESDVKEEENSASESED--LAPSTSSTVPSGSTTFNQGFVPAMNIELRKKIKEEEVVEKIDKTDKQLFKIIPEVKSNIGSNIMGSDKVYSLSSSEKNMQLQKR 486          
The following BLAST results are available for this feature:
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SF3B21.610e-14160.75splicing factor 3b subunit 2 [Source:HGNC Symbol;A... [more]
SF3B22.509e-14160.75splicing factor 3b subunit 2 [Source:HGNC Symbol;A... [more]
SF3B24.804e-7358.30splicing factor 3b subunit 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sftb-22.242e-11948.37Splicing Factor ThreeB (3b) Subunit homolog [Sour... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Sf3b21.575e-13559.55gene:FBgn0031493 transcript:FBtr0335484[more]
Sf3b21.575e-13559.55gene:FBgn0031493 transcript:FBtr0077669[more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sf3b21.041e-14256.94splicing factor 3b, subunit 2 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stt3b1.141e-14059.79STT3B, catalytic subunit of the oligosaccharyltran... [more]
stt3b2.046e-14059.79STT3B, catalytic subunit of the oligosaccharyltran... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sf3b21.557e-14160.75splicing factor 3b, subunit 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q13435|SF3B2_HUMAN1.205e-14060.75Splicing factor 3B subunit 2 OS=Homo sapiens OX=96... [more]
sp|Q9UUI3|SA145_SCHPO1.582e-8953.01Pre-mRNA-splicing factor sap145 OS=Schizosaccharom... [more]
sp|Q02554|CUS1_YEAST5.875e-4134.93Cold sensitive U2 snRNA suppressor 1 OS=Saccharomy... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A293MWQ81.889e-14761.38Splicing factor 3B subunit (Fragment) OS=Ornithodo... [more]
A0A2R5LHS02.033e-14663.59Putative splicing factor 3b subunit 2 (Fragment) O... [more]
A0A293M0Z15.729e-14661.38Splicing factor 3B subunit (Fragment) OS=Ornithodo... [more]
A0A293LPF86.712e-14661.38Splicing factor 3B subunit (Fragment) OS=Ornithodo... [more]
V5HP671.189e-14558.66Putative splicing factor 3b subunit 2 OS=Ixodes ri... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sf3b24.417e-14758.10splicing factor 3b subunit 2 [Source:NCBI gene;Acc... [more]
sf3b22.965e-14456.00splicing factor 3b subunit 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sf3b28.788e-6253.57splicing factor 3b, subunit 2 [Source:ZFIN;Acc:ZDB... [more]
SF3B21.220e-3666.33splicing factor 3b subunit 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CUS18.461e-4334.93Protein required for assembly of U2 snRNP into the... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO401942.070e-13954.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sf3b27.471e-14259.47splicing factor 3b subunit 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Splicing factor 3B subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000058116.10.000e+099.79SMESG000058116.1[more]
SMESG000041240.14.059e-15354.39SMESG000041240.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015482 ID=SMED30015482|Name=Splicing factor 3B subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1686bp
ATTAATATGTTATTTTAAATTTAAAATTATAAATTTATTTTTAGTTTAAT
TTTATTGTTAATATATATCTTCCATTGTTGTAGATGACTGAAATAATTTC
AGAACCTATAGCTATCTCCAGTAGTAAAAAGCGCCGAGAAAGGAAAAAGA
AAGCTAAAGATCGAAAAAGGCGGGAATTCGAAATTATCAAACAAGAACAT
GTTGAAATTGAATTAATTGAATATCCCACAACTTTAGATAATATTGTTGA
ATTTGAATTAAAAGGGAAATTTGAACGTTTTATTAATTATGACAAAGAAG
ACTTAAAAAGTGAAAGTAGAGATGATACCAAAAATGCGAAGGTTTCTAAT
GCGCAATCACTTAATGAATTACCCATGAAAGCCAGAGCGGCTGCCATTTT
ACAAGATGATCATGATCGAGATGAAAATGAAGAACCAAAAATCGGAAAAA
AACAATTAAAAAGAATGAATCGAATGACCACTGCGCAACTAAAAATTAAC
GTTGATCAACCTGAATTAGTAGAAACATGGGATTACTGTAGCAAAGATCC
TATTTTATTGCTTGAATTGAAAAGTATGCGAAATACTGTTCCTGTTCCTC
GACATTGGTGTGCAAAAAGAAAATACTTACAAGGGAAACGTGGATTTGAA
AAATCCCCTTTTAAATTACCAGATTTTATAGCCAAAACCGGCATTATGGA
AATGAGACAAACTGTGCAAGACAAAGAAGGTGATAAGACTCTAAAAACTA
AAATGCGAGAAAAAATTCGACCCAAAGTTGGTCATGTGGATATTGATTAC
AATAAGCTCCATGATGCATTTTTCAAAGATCAAGTGAAACCTCCACTCAC
AATTCACGGAGATATCTATTATGAAGGTAAAGAATTTGAAGTTAAACTTA
AAGAAAAGAAACCCGGCCAATTATCTGATGAATTGCGAACTGCGTTAGGA
TTACCAACCGGCCCAAATGCTGATAAATATCCACCGCCTTGGTTAATCGC
AATGCAGCGTTATGGGCCCCCACCATCCTATCCAAATTTGAAAATTCCTG
GTTTGAATGCTCCAATTCCTTATGGATGTTCCTTTGGTTATCATGCTAAC
GGATGGGGTAAACCACCAGTCGATGAAACTGGCAGGCCGATATACGGTGA
AGTTTTCCTCGATAATTTACCGATTCCTCCTCCTCCTTCTGATGACGATA
TGGATGGGGAAGAAGGCAACAAATTTTGGGGTGAAATCGAATCAGACGAA
GAATCCGAAGAGGAAGACGAATCAGAGAAAGAGGAAGAAGACGAGGATGT
AGATATGGAAACCGAAAACGAAGGACTTTTCACTCCGGCCGAAGGTCTTG
TGACTCCTAGTGGTGTATCGAGTGTTGGGCAAGGTCTTACTACACCTCAA
AGCATTGAGTTGCGTAAGAAAGCCATCGAGGATGATTTGATGCCCAATGA
GAAGCCGCTATTCACTGTTATTCCACAGATCAAGGCGGAAATCGGCTCGG
CGATAATGGGCTCAGAAAAGCTCTATCAAGTACCGGAAATGGATATGAAA
AACAAGAAGCGAGTCGCTCCCACCCCCTCTGGAACAACTTCGGGACAGAA
ATCCAGTCAGCCCCCGGAACCAACAGAACCGAAATCAAAGAAACATAAAG
ACTTTAAATTTTAATTCTTGTAGTTTAATAATATAT
back to top

protein sequence of SMED30015482-orf-1

>SMED30015482-orf-1 ID=SMED30015482-orf-1|Name=SMED30015482-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=527bp
MTEIISEPIAISSSKKRRERKKKAKDRKRREFEIIKQEHVEIELIEYPTT
LDNIVEFELKGKFERFINYDKEDLKSESRDDTKNAKVSNAQSLNELPMKA
RAAAILQDDHDRDENEEPKIGKKQLKRMNRMTTAQLKINVDQPELVETWD
YCSKDPILLLELKSMRNTVPVPRHWCAKRKYLQGKRGFEKSPFKLPDFIA
KTGIMEMRQTVQDKEGDKTLKTKMREKIRPKVGHVDIDYNKLHDAFFKDQ
VKPPLTIHGDIYYEGKEFEVKLKEKKPGQLSDELRTALGLPTGPNADKYP
PPWLIAMQRYGPPPSYPNLKIPGLNAPIPYGCSFGYHANGWGKPPVDETG
RPIYGEVFLDNLPIPPPPSDDDMDGEEGNKFWGEIESDEESEEEDESEKE
EEDEDVDMETENEGLFTPAEGLVTPSGVSSVGQGLTTPQSIELRKKAIED
DLMPNEKPLFTVIPQIKAEIGSAIMGSEKLYQVPEMDMKNKKRVAPTPSG
TTSGQKSSQPPEPTEPKSKKHKDFKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006568PSP_pro-rich
IPR007180DUF382
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006568PSP, proline-richSMARTSM00581testneucoord: 272..330
e-value: 8.4E-30
score: 115.0
IPR006568PSP, proline-richPFAMPF04046PSPcoord: 276..326
e-value: 8.5E-21
score: 73.6
IPR007180Domain of unknown function DUF382PFAMPF04037DUF382coord: 142..267
e-value: 1.7E-55
score: 186.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 483..526
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..512
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 386..411
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 383..437
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 423..437
NoneNo IPR availablePANTHERPTHR12785:SF6SPLICING FACTOR 3B SUBUNIT 2coord: 15..501
NoneNo IPR availablePANTHERPTHR12785splicing factor 3Bcoord: 15..501