DNA topoisomerase 2

Overview
NameDNA topoisomerase 2
Smed IDSMED30015481
Length (bp)2055
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA topoisomerase 2 (SMED30015481) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA topoisomerase 2 (SMED30015481) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA topoisomerase 2 (SMED30015481) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA topoisomerase 2 (SMED30015481) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015481

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30015481SMESG000070153.1 dd_Smed_v4_15570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015481SMESG000070153.1 dd_Smed_v4_15570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30015481SMESG000070153.1 dd_Smed_v4_15570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015481SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015481SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015481SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015481SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015481SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015481SMESG000070153.1 Contig50232newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015481SMESG000070153.1 Contig50232uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30015481SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v6_1626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015481SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v6_1626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015481SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v4_1626_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2A (DNA topoisomerase II alpha [Source:HGNC Symbol;Acc:HGNC:11989])

HSP 1 Score: 479.559 bits (1233), Expect = 7.474e-152
Identity = 250/491 (50.92%), Postives = 331/491 (67.41%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAE 1506
             Q   N++ S      +  +P L DAN AG  +S ECTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + YE ++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +  +FYS+ E E+W+  TP+   W++KYYKGLGT TS+EA EYF D KR+ I+F+Y+G +D  +I LAFS+ + ++RKEWL  ++E +   K L L +D        Y+T   FI  ELIL+    N+RSIPS++DGL PG RKVLFTC + +   E+ V+QLAGSV ++S+YH  E SLM  I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T L+ L +L+F P D   L  + DDN +    EPEWY PIIPM+LING   IG GWS  IP F   ++++ +++ ++GE  + + P Y+NF GTI E
Sbjct:  419 AQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHR-----FLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEE 901          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 465.692 bits (1197), Expect = 8.431e-150
Identity = 248/498 (49.80%), Postives = 330/498 (66.27%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S ECTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LLKH      F+E+F  PIVKA  N +  SFYSI E ++W+K   +  +W++KYYKGLGT T++EA EYF D +R+ I FRY G +D  +I LAFS+ K ++RKEWL  ++E +   + LH      L     K++T   FI  ELIL+    N+RSIPSL+DG  PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNNIN+L PIGQFGTRL GGKD A PRY++T L+ L +L+F   D  +L  + DDN +    EPEWY PIIPM+LING   IG GW+  +P +   ++++ +++ ++G +   + P Y+NF GTI E  + ++
Sbjct:  435 AQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHG-----FLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRR-QRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQY 923          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 464.922 bits (1195), Expect = 6.144e-146
Identity = 248/498 (49.80%), Postives = 330/498 (66.27%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S ECTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LLKH      F+E+F  PIVKA  N +  SFYSI E ++W+K   +  +W++KYYKGLGT T++EA EYF D +R+ I FRY G +D  +I LAFS+ K ++RKEWL  ++E +   + LH      L     K++T   FI  ELIL+    N+RSIPSL+DG  PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNNIN+L PIGQFGTRL GGKD A PRY++T L+ L +L+F   D  +L  + DDN +    EPEWY PIIPM+LING   IG GW+  +P +   ++++ +++ ++G +   + P Y+NF GTI E  + ++
Sbjct:  435 AQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHG-----FLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDR-RQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQY 923          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 465.307 bits (1196), Expect = 6.364e-146
Identity = 248/498 (49.80%), Postives = 330/498 (66.27%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S ECTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LLKH      F+E+F  PIVKA  N +  SFYSI E ++W+K   +  +W++KYYKGLGT T++EA EYF D +R+ I FRY G +D  +I LAFS+ K ++RKEWL  ++E +   + LH      L     K++T   FI  ELIL+    N+RSIPSL+DG  PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNNIN+L PIGQFGTRL GGKD A PRY++T L+ L +L+F   D  +L  + DDN +    EPEWY PIIPM+LING   IG GW+  +P +   ++++ +++ ++G +   + P Y+NF GTI E  + ++
Sbjct:  440 AQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHG-----FLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDR-RQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQY 928          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: top-2 (DNA topoisomerase 2 top-2 [Source:UniProtKB/Swiss-Prot;Acc:Q23670])

HSP 1 Score: 471.085 bits (1211), Expect = 2.945e-149
Identity = 234/478 (48.95%), Postives = 330/478 (69.04%), Query Frame = 1
Query:  112 VPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            +P L DAN AGT +S +CTLILTEG SAK+ A+S L+   RD YGVFPL+GKLLNVR+G+  +  + A++  ++KI+GL Y +KYE+++  K LRYGKLM+M D D +GSHIKGL+INFIH +WP L++ N     F+E+F  PIVKA    +  SFYS+ E  +W+  T +  S+++KYYKGLGT TS+EA EYF D  R+ I+F+YNG  D N++D+AFS+ K  ERK+WL K++  K   K   L ++       +++T + F+  EL+L+  + N+RSIP L+DG  PG RKVLF C +     E+ V+QLAG+V ++SAYH  E+SLM  I  LAQD+VGSNNIN+L+PIGQFGTRL GGKD A  RY++T+L+ +T+ +F   D  +L  + ++N +    EPEWY PIIPM+L+NG   IG GWS++IP ++P +++  +K+ I GE    + PWY+NF G I +    +F
Sbjct:  473 IPKLEDANDAGTKNSQQCTLILTEGDSAKTLAVSGLSVVGRDKYGVFPLRGKLLNVREGNMKQIADNAEVNAMIKILGLQYKKKYETEDDFKTLRYGKLMVMADQDQDGSHIKGLVINFIHHFWPSLIQRN-----FVEEFITPIVKATKGKEEVSFYSLPEYSEWRMNTDNWKSYKIKYYKGLGTSTSKEAKEYFLDMVRHRIRFKYNGADDDNAVDMAFSKKKIEERKDWLSKWMREKKDRKQQGLAEEYLYNKDTRFVTFKDFVNRELVLFSNLDNERSIPCLVDGFKPGQRKVLFACFKRADKREVKVAQLAGAVAEISAYHHGEQSLMGTIVNLAQDYVGSNNINLLLPIGQFGTRLQGGKDSASARYIFTQLSPVTRTLFPAHDDNVLRFLYEENQR---IEPEWYCPIIPMVLVNGAQGIGTGWSTNIPNYNPRELVKNIKRLIAGEPQKALAPWYKNFRGKIIQIDPSRF 942          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: cin-4 (DNA topoisomerase-like protein cin-4 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ8])

HSP 1 Score: 417.542 bits (1072), Expect = 6.628e-135
Identity = 217/496 (43.75%), Postives = 316/496 (63.71%), Query Frame = 1
Query:   58 QFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNV--RKGSEFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQDG-----KKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            Q  P R++S         +P L DAN AGT +S +CTLILTEG SAK+ A+S L+   RD YGVFP + KLLNV     ++  + A++  ++KI+GL Y +KYE+++  K LRYGKL+IM + D +GS  KGLL+NF H +WP L K      DF+E F  PI KA    +  SFYS+ E  +W+  T +  S+ +KYY GLGT TS+EA + F D  R+ I+F+YNG  D  ++++AFS+ K   R ++L K ++ K+  K   L ++       +++T++ F  YE++    +H   SIP L+DGL PG RKVLF C +     E+ V+QLAG+V ++SAYH  E+SLM  I  LAQD+VGS+NIN+L+PIGQFGTRL GGKD A  R ++ +L+++T+ +F   D  +L  + ++N +    EPEWY PIIPM+L+NG    G GWS++IP ++P +++  +K+ I GE    + PWY+NF G I +    +F
Sbjct:   27 QKCPKRKTSKLKG-----IPKLEDANDAGTKNSQQCTLILTEGDSAKTLAVSGLSVVGRDKYGVFPFRRKLLNVCDLNVNQIADSAEVNAIIKILGLQYTKKYETEDDFKTLRYGKLLIMANHDSDGSQFKGLLLNFFHRFWPALFKR-----DFVEDFITPIAKATEGKEEVSFYSLPEYSEWRMNTDNWKSYTIKYYNGLGTLTSKEAKKCFSDMVRHRIRFKYNGADDDKAVNMAFSKKKIEARTDYLMKLMQDKNQRKQQGLAEECLYNKETRFVTLKDFFNYEIVCSWNLH---SIPCLVDGLKPGQRKVLFACFKRANKREVKVAQLAGAVAEISAYHHGEQSLMGTIVNLAQDYVGSHNINLLLPIGQFGTRLQGGKDSASARSIFAQLSQVTRTLFPAHDDNVLRFLYEENQR---IEPEWYCPIIPMVLVNGAQGTGTGWSTNIPNYNPRELVKNIKRLIAGEPQKALAPWYKNFRGKIIQIDPSRF 506          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 372.474 bits (955), Expect = 8.271e-115
Identity = 207/492 (42.07%), Postives = 308/492 (62.60%), Query Frame = 1
Query:   64 MPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGSEFR--NRAKIENLVKIIGLDYNQKYESKELLK-GLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCL-EMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENT-VKIHPWYRNFTGTIAEKSEKKF 1524
            +P +  S +S + +V + +   A   GTA+  +CTLILTEG SAK+ A++ L    R+ YGVFPL+GKLLNV    + R     +I NL++I+GL +    +S  + +  LRYG+L+I+ D D +GSHIKGL++NFIH +WP L+  +     FI+ F  P++KA   +KV SF+S+ E  KW  +  +   W++KYYKGLGT TS EA EYF D   + + F+Y G  D ++I +AF  DK++ERKEW+ +          +  + DGK  I+ ++F+  +L+ +G++  KRSIPSL+DGL P  RK+L+T L  MD   E+ VSQLAG+V    +YH  EESL+  I ++ Q F GS+N+ +L PIGQFGTR +GG D A  RY++T L   T+L+F   D  +L + +++    +  EP W  PI+P+ILING   IG GWS+ I   +PID+ID ++++I+  +T  +I P+Y  F G +   +  KF
Sbjct:  444 LPGKRVSVSSVRDIVKLEDAEWAGITGTAE--KCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFE---DSNSITRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTD----GFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWA-DVEEGGKWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWIRRS------ENEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRSIPSLIDGLKPSQRKILWTLLNNMDESTEIKVSQLAGAVAHRQSYHHGEESLVRTIIRMGQTFCGSSNLPLLQPIGQFGTRHEGGNDAASARYIFTALAPTTRLLFPQADDDLLQKNVEEG---MVVEPTWLCPIVPLILINGTEGIGTGWSTKIANRNPIDIIDMIRRKIDSISTEYEIPPFYEEFRGKLEVVTPTKF 916          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 218.394 bits (555), Expect = 3.405e-61
Identity = 119/295 (40.34%), Postives = 182/295 (61.69%), Query Frame = 1
Query:   64 MPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGSEFR--NRAKIENLVKIIGLDYNQKYESKELL--KGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQDGKKYITIRKFIKYELILYGIMHNKRS 936
            +P +  S +S + +V + +   A   GTA+  +CTLILTEG SAK+ A++ L    R+ YGVFPL+GKLLNV    + R     +I NL++I+GL    K+E    +  + LRYG+L+I+ D D +GSHIKGL++NFIH +WP L+  +     FI+ F  P++KA   +KV SF+S+ E  KW  +  +   W++KYYKGLGT TS EA EYF D   + + F+Y G  D ++I +AF  DK++ERKEW+ +          +  + DGK  I+ ++F+  +L+ +G++  KR+
Sbjct:  444 LPGKRVSVSSVRDIVKLEDAEWAGITGTAE--KCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGL----KFEDSNSITRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTDG----FIQSFRTPLLKAKKGDKVRSFFSMNEYRKWA-DVEEGGKWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWIRRS------ENEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRT 721          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 218.394 bits (555), Expect = 3.405e-61
Identity = 119/295 (40.34%), Postives = 182/295 (61.69%), Query Frame = 1
Query:   64 MPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGSEFR--NRAKIENLVKIIGLDYNQKYESKELL--KGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQDGKKYITIRKFIKYELILYGIMHNKRS 936
            +P +  S +S + +V + +   A   GTA+  +CTLILTEG SAK+ A++ L    R+ YGVFPL+GKLLNV    + R     +I NL++I+GL    K+E    +  + LRYG+L+I+ D D +GSHIKGL++NFIH +WP L+  +     FI+ F  P++KA   +KV SF+S+ E  KW  +  +   W++KYYKGLGT TS EA EYF D   + + F+Y G  D ++I +AF  DK++ERKEW+ +          +  + DGK  I+ ++F+  +L+ +G++  KR+
Sbjct:  444 LPGKRVSVSSVRDIVKLEDAEWAGITGTAE--KCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGL----KFEDSNSITRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTDG----FIQSFRTPLLKAKKGDKVRSFFSMNEYRKWA-DVEEGGKWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWIRRS------ENEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRT 721          
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Match: Top2 (gene:FBgn0284220 transcript:FBtr0332320)

HSP 1 Score: 458.759 bits (1179), Expect = 4.670e-145
Identity = 244/481 (50.73%), Postives = 324/481 (67.36%), Query Frame = 1
Query:  103 VVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQ-----DGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            +  +P L DAN AG  +S +CTLILTEG SAKS A+S L    RD YGVFPL+GKLLNVR+ +  +    A+I NL KIIGL Y +KY +++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WPELL+       F+E+F  PIVKA   N+  SFYS+ E E+W+ +T +  ++ +KYYKGLGT TS+EA EYF+D  R+ I F+Y+G  D  SI +AFS+     RK WL  +++     K L L +      G K IT   FI  EL+L+    N+RSIPSL+DGL PG RKV+FTC + +   E+ V+QL+GSV ++SAYH  E SL   I  LAQ+FVG+NNIN+L P GQFGTRL GGKDCA  RY++T ++ LT+LI+HP D  +L+  +DD  K    EP WY PIIPM+L+NG   IG GWS+ I  ++P +++  L++ ING+    +HPWY+NF G +   S+ ++
Sbjct:  415 IKGIPKLEDANEAGGKNSIKCTLILTEGDSAKSLAVSGLGVIGRDLYGVFPLRGKLLNVREANFKQLSENAEINNLCKIIGLQYKKKYLTEDDLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHTNWPELLR-----LPFLEEFITPIVKATKKNEELSFYSLPEFEEWKNDTANHHTYNIKYYKGLGTSTSKEAKEYFQDMDRHRILFKYDGSVDDESIVMAFSKKHIESRKVWLTNHMDEVKRRKELGLPERYLYTKGTKSITYADFINLELVLFSNADNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLSGSVAEMSAYHHGEVSLQMTIVNLAQNFVGANNINLLEPRGQFGTRLSGGKDCASARYIFTIMSPLTRLIYHPLDDPLLDYQVDDGQK---IEPLWYLPIIPMVLVNGAEGIGTGWSTKISNYNPREIMKNLRKMINGQEPSVMHPWYKNFLGRMEYVSDGRY 887          
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Match: Top2 (gene:FBgn0284220 transcript:FBtr0081287)

HSP 1 Score: 458.759 bits (1179), Expect = 4.670e-145
Identity = 244/481 (50.73%), Postives = 324/481 (67.36%), Query Frame = 1
Query:  103 VVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQ-----DGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            +  +P L DAN AG  +S +CTLILTEG SAKS A+S L    RD YGVFPL+GKLLNVR+ +  +    A+I NL KIIGL Y +KY +++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WPELL+       F+E+F  PIVKA   N+  SFYS+ E E+W+ +T +  ++ +KYYKGLGT TS+EA EYF+D  R+ I F+Y+G  D  SI +AFS+     RK WL  +++     K L L +      G K IT   FI  EL+L+    N+RSIPSL+DGL PG RKV+FTC + +   E+ V+QL+GSV ++SAYH  E SL   I  LAQ+FVG+NNIN+L P GQFGTRL GGKDCA  RY++T ++ LT+LI+HP D  +L+  +DD  K    EP WY PIIPM+L+NG   IG GWS+ I  ++P +++  L++ ING+    +HPWY+NF G +   S+ ++
Sbjct:  415 IKGIPKLEDANEAGGKNSIKCTLILTEGDSAKSLAVSGLGVIGRDLYGVFPLRGKLLNVREANFKQLSENAEINNLCKIIGLQYKKKYLTEDDLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHTNWPELLR-----LPFLEEFITPIVKATKKNEELSFYSLPEFEEWKNDTANHHTYNIKYYKGLGTSTSKEAKEYFQDMDRHRILFKYDGSVDDESIVMAFSKKHIESRKVWLTNHMDEVKRRKELGLPERYLYTKGTKSITYADFINLELVLFSNADNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLSGSVAEMSAYHHGEVSLQMTIVNLAQNFVGANNINLLEPRGQFGTRLSGGKDCASARYIFTIMSPLTRLIYHPLDDPLLDYQVDDGQK---IEPLWYLPIIPMVLVNGAEGIGTGWSTKISNYNPREIMKNLRKMINGQEPSVMHPWYKNFLGRMEYVSDGRY 887          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2b (DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GENE-041008-136])

HSP 1 Score: 474.167 bits (1219), Expect = 1.440e-149
Identity = 247/497 (49.70%), Postives = 334/497 (67.20%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S ECTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ +  +    A+I N++KI+GL Y + Y+  E LK LRYG++MIMTD D +GSHIKGLLINF H  WP LLKH      F+E+F  PIVKA  N +  SFYSI E E+W+K T    +W +KYYKGLGT TS+EA EYF D +R+ I F+YNG +D  +I LAFS+ KT++RKEWL  ++E +   +   L +        ++++   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTC++ +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNN+NIL P+GQFGTR++GGKD A PRY++T L+ L KL+F   D ++L  + DDN K    EPEWY PIIPM+L+NG   IG GW+  IP + P ++++ + + +N ++ + + P Y+NF GTI E  + ++
Sbjct:  439 AQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKILGLQYKKSYDDPESLKSLRYGRIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHT-----FLEEFITPIVKASKNKQEVSFYSIPEFEEWKKHTESYKTWHIKYYKGLGTSTSKEAKEYFSDMERHRIMFKYNGTEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEQYLYGTSTRHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCVKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVNILQPLGQFGTRINGGKDAASPRYIFTMLSPLAKLLFPAVDSSLLKFLYDDNQK---VEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGTIHELGQNQY 927          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 448.743 bits (1153), Expect = 2.276e-140
Identity = 241/499 (48.30%), Postives = 323/499 (64.73%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKFNN 1530
             Q   N++ S      +  VP L DAN AG  +S  CTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y   E LK LRYGKLMIMTD D +GSHIKGLLINFIH  WP LL+HN     F+E+F  PI+KA N  +  SFYSI E  +W+++     SW++KYYKGLGT TS+EA EYF D  R+ I F+Y+G  D  +I LAFS+    ERKEWL  ++  +   +  +L ++       K ++   FI  EL+L+    N+RSIP ++DGL PG RKV+F C + +   E+ V+QLAGSV ++SAYH  E SLM  I  LAQ+FVGSNN+N+L P+GQFGTRL GGKD A PRY++T L+ L +L+F   D  +L    DDN   +  EPEWY PIIP++L NG   IG GW+S IP +   ++I+ + + +NGE  + + P Y+ F GTI E ++ ++ N
Sbjct:  418 AQAQLNKKCSAVKHTKIKGVPKLDDANDAGGKNSNSCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKILGLQYKKNYSDPESLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHN-----FLEEFITPIIKASNKKQEISFYSIPEFTEWKEKQSSIKSWKIKYYKGLGTSTSKEAKEYFSDMTRHRIPFKYSGPADDEAITLAFSKKMIEERKEWLTSFMINRRQRREHNLPEEYLYGQETKSLSYHDFINKELVLFSNSDNERSIPCMVDGLKPGQRKVVFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEVSLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSTLARLLFPVVDDNLLKYNYDDN---LRVEPEWYMPIIPLVLANGGEGIGTGWASRIPNYDVREIINNIHRMLNGEEPLPMLPSYKGFKGTIDELAKNQYVN 908          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 134.42 bits (337), Expect = 3.124e-32
Identity = 72/150 (48.00%), Postives = 100/150 (66.67%), Query Frame = 1
Query: 1081 SLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKFNN 1530
            SLM  I  LAQ+FVGSNN+N+L P+GQFGTRL GGKD A PRY++T L+ L +L+F   D  +L    DDN   +  EPEWY PIIP++L NG   IG GW+S IP +   ++I+ + + +NGE  + + P Y+ F GTI E ++ ++ N
Sbjct:    2 SLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSTLARLLFPVVDDNLLKYNYDDN---LRVEPEWYMPIIPLVLANGGEGIGTGWASRIPNYDVREIINNIHRMLNGEEPLPMLPSYKGFKGTIDELAKNQYVN 148          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2B (DNA topoisomerase II beta [Source:NCBI gene;Acc:779457])

HSP 1 Score: 460.685 bits (1184), Expect = 2.368e-147
Identity = 246/498 (49.40%), Postives = 330/498 (66.27%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S +CTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINF H  WP LLKH+     F+E+F  PIVKA  N +  SFYSI E E+W+K+T +   W++KYYKGLGT TS+EA EYF D  R+ I FRY G +D  +I LAFS+ K ++RKEWL  ++E +   + LH      L     K++T   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E +LM  I  LAQ+FVGSNN+++L PIGQFGTRL GGKD A PRY++T L+ L +L++   D  +L  + DDN +    EPEWY PIIP++L+NG   IG GW+  +P +   ++++ +K+ ++G +   + P Y+NF GTI E  + ++
Sbjct:  392 AQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSLDCTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDNESLKTLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHS-----FLEEFITPIVKATKNKQELSFYSIPEFEEWKKQTENQKLWKIKYYKGLGTSTSKEAKEYFADMDRHRIIFRYAGPEDDAAITLAFSKKKVDDRKEWLTNFMEDRR-QRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEVTLMMTIVNLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSPLARLLYPSVDDNLLKFLYDDNQR---VEPEWYIPIIPLVLVNGAEGIGTGWACKLPNYDTREIVNNVKRMLDGLDPYPLLPSYKNFKGTIQELGQNQY 880          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2B (DNA topoisomerase II beta [Source:NCBI gene;Acc:779457])

HSP 1 Score: 464.537 bits (1194), Expect = 2.707e-147
Identity = 246/498 (49.40%), Postives = 331/498 (66.47%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S +CTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINF H  WP LLKH+     F+E+F  PIVKA  N +  SFYSI E E+W+K+T +   W++KYYKGLGT TS+EA EYF D  R+ I FRY G +D  +I LAFS+ K ++RKEWL  ++E +   + LH      L     K++T   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNN+++L PIGQFGTRL GGKD A PRY++T L+ L +L++   D  +L  + DDN +    EPEWY PIIP++L+NG   IG GW+  +P +   ++++ +K+ ++G +   + P Y+NF GTI E  + ++
Sbjct:  402 AQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSLDCTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDNESLKTLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHS-----FLEEFITPIVKATKNKQELSFYSIPEFEEWKKQTENQKLWKIKYYKGLGTSTSKEAKEYFADMDRHRIIFRYAGPEDDAAITLAFSKKKVDDRKEWLTNFMEDRR-QRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSPLARLLYPSVDDNLLKFLYDDNQR---VEPEWYIPIIPLVLVNGAEGIGTGWACKLPNYDTREIVNNVKRMLDGLDPYPLLPSYKNFKGTIQELGQNQY 890          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2B (DNA topoisomerase II beta [Source:NCBI gene;Acc:779457])

HSP 1 Score: 463.766 bits (1192), Expect = 8.335e-147
Identity = 246/498 (49.40%), Postives = 331/498 (66.47%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S +CTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINF H  WP LLKH+     F+E+F  PIVKA  N +  SFYSI E E+W+K+T +   W++KYYKGLGT TS+EA EYF D  R+ I FRY G +D  +I LAFS+ K ++RKEWL  ++E +   + LH      L     K++T   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNN+++L PIGQFGTRL GGKD A PRY++T L+ L +L++   D  +L  + DDN +    EPEWY PIIP++L+NG   IG GW+  +P +   ++++ +K+ ++G +   + P Y+NF GTI E  + ++
Sbjct:  441 AQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSLDCTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDNESLKTLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHS-----FLEEFITPIVKATKNKQELSFYSIPEFEEWKKQTENQKLWKIKYYKGLGTSTSKEAKEYFADMDRHRIIFRYAGPEDDAAITLAFSKKKVDDRKEWLTNFMEDRR-QRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSPLARLLYPSVDDNLLKFLYDDNQR---VEPEWYIPIIPLVLVNGAEGIGTGWACKLPNYDTREIVNNVKRMLDGLDPYPLLPSYKNFKGTIQELGQNQY 929          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2B (DNA topoisomerase II beta [Source:NCBI gene;Acc:779457])

HSP 1 Score: 461.84 bits (1187), Expect = 1.183e-146
Identity = 246/498 (49.40%), Postives = 330/498 (66.27%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S +CTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINF H  WP LLKH+     F+E+F  PIVKA  N +  SFYSI E E+W+K+T +   W++KYYKGLGT TS+EA EYF D  R+ I FRY G +D  +I LAFS+ K ++RKEWL  ++E +   + LH      L     K++T   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E +LM  I  LAQ+FVGSNN+++L PIGQFGTRL GGKD A PRY++T L+ L +L++   D  +L  + DDN +    EPEWY PIIP++L+NG   IG GW+  +P +   ++++ +K+ ++G +   + P Y+NF GTI E  + ++
Sbjct:  383 AQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSLDCTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDNESLKTLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHS-----FLEEFITPIVKATKNKQELSFYSIPEFEEWKKQTENQKLWKIKYYKGLGTSTSKEAKEYFADMDRHRIIFRYAGPEDDAAITLAFSKKKVDDRKEWLTNFMEDRR-QRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEVTLMMTIVNLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSPLARLLYPSVDDNLLKFLYDDNQR---VEPEWYIPIIPLVLVNGAEGIGTGWACKLPNYDTREIVNNVKRMLDGLDPYPLLPSYKNFKGTIQELGQNQY 871          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 459.914 bits (1182), Expect = 2.181e-146
Identity = 246/492 (50.00%), Postives = 322/492 (65.45%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAE 1506
             Q   N++ S      +  +P L DAN AG+ +S +CTLILTEG SAK+ A+S L    RD YGVFPL+GKLLNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LLKH      F+E+F  PI+K   + +  SFYSI E E+W+  T    +W++KYYKGLGT TS+EA EYF D +R+ I F+Y G  D  +I LAFS  K ++RKEWL  +++ +   + LH      L     KY+T   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E SLM  I  LAQ+FVGSNN+++L PIGQFGTRL GGKD A PRY++T L+ L +L+F   D ++L  M DDN K    EPEWY PIIP +L+NG   IG GWS  IP +   +++  + + ++G   + + P Y+NF G I E
Sbjct:  416 AQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHR-----FLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRR-ERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQK---VEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQE 898          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2a (topoisomerase (DNA) II alpha [Source:MGI Symbol;Acc:MGI:98790])

HSP 1 Score: 482.641 bits (1241), Expect = 3.376e-153
Identity = 251/497 (50.50%), Postives = 335/497 (67.40%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG+ +S ECTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + YE ++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +  +FYS+ E E+W+  TP+   W++KYYKGLGT TS+EA EYF D KR+ I+F+Y+G +D  +I LAFS+ + ++RKEWL  ++E +   K L L +D        Y+T   FI  ELIL+    N+RSIPS++DGL PG RKVLFTC + +   E+ V+QLAGSV ++S+YH  E SLM  I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T L+ L +L+F P D   L  + DDN +    EPEWY PIIPM+LING   IG GWS  IP F   +V++ +++ ++GE  + + P Y+NF GTI E +  ++
Sbjct:  418 AQIQLNKKCSAVKHTKIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHR-----FLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQSTSYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQY 906          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2b (topoisomerase (DNA) II beta [Source:MGI Symbol;Acc:MGI:98791])

HSP 1 Score: 465.307 bits (1196), Expect = 3.628e-146
Identity = 248/498 (49.80%), Postives = 329/498 (66.06%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLH------LDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S ECTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LLKH      F+E+F  PIVKA  N +  SFYSI E ++W+K   +  +W++KYYKGLGT T++EA EYF D +R+ I FRY G +D  +I LAFS+ K ++RKEWL  ++E +   + LH      L     K++T   FI  ELIL+    N+RSIPSL+DG  PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNNIN+L PIGQFGTRL GGKD A PRY++T L+ L +L+F   D  +L  + DDN +    EPEWY PIIPM+LING   IG GW+  +P +   ++++ +++ + G +   + P Y+NF GTI E  + ++
Sbjct:  428 AQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHG-----FLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDR-RQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARLLFPAVDDNLLKFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLEGLDPHPMLPNYKNFKGTIQELGQNQY 916          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|Q01320|TOP2A_MOUSE (DNA topoisomerase 2-alpha OS=Mus musculus OX=10090 GN=Top2a PE=1 SV=2)

HSP 1 Score: 482.641 bits (1241), Expect = 2.362e-152
Identity = 251/497 (50.50%), Postives = 335/497 (67.40%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG+ +S ECTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + YE ++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +  +FYS+ E E+W+  TP+   W++KYYKGLGT TS+EA EYF D KR+ I+F+Y+G +D  +I LAFS+ + ++RKEWL  ++E +   K L L +D        Y+T   FI  ELIL+    N+RSIPS++DGL PG RKVLFTC + +   E+ V+QLAGSV ++S+YH  E SLM  I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T L+ L +L+F P D   L  + DDN +    EPEWY PIIPM+LING   IG GWS  IP F   +V++ +++ ++GE  + + P Y+NF GTI E +  ++
Sbjct:  418 AQIQLNKKCSAVKHTKIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHR-----FLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQSTSYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQY 906          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|P41515|TOP2A_CRIGR (DNA topoisomerase 2-alpha OS=Cricetulus griseus OX=10029 GN=TOP2A PE=1 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 7.775e-152
Identity = 252/497 (50.70%), Postives = 336/497 (67.61%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG+ +S ECTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + YE ++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +  +FYS+ E E+W+  TP+   W++KYYKGLGT TS+EA EYF D KR+ I+F+Y+G +D  +I LAFS+ + ++RKEWL  ++E +   K L L +D        Y+T   FI  ELIL+    N+RSIPS++DGL PG RKVLFTC + +   E+ V+QLAGSV ++S+YH  E SLM  I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T L+ LT+L+F P D   L  + DDN +    EPEWY PIIPM+LING   IG GWS  IP F   +V++ +++ ++GE  + + P Y+NF GTI E +  ++
Sbjct:  418 AQIQLNKKCSAVKHNRIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHR-----FLEEFITPIVKVSKNKQELAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLTRLLFPPKDDHTLKFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDIREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQY 906          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|P11388|TOP2A_HUMAN (DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3)

HSP 1 Score: 479.559 bits (1233), Expect = 3.589e-151
Identity = 250/491 (50.92%), Postives = 331/491 (67.41%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAE 1506
             Q   N++ S      +  +P L DAN AG  +S ECTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + YE ++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +  +FYS+ E E+W+  TP+   W++KYYKGLGT TS+EA EYF D KR+ I+F+Y+G +D  +I LAFS+ + ++RKEWL  ++E +   K L L +D        Y+T   FI  ELIL+    N+RSIPS++DGL PG RKVLFTC + +   E+ V+QLAGSV ++S+YH  E SLM  I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T L+ L +L+F P D   L  + DDN +    EPEWY PIIPM+LING   IG GWS  IP F   ++++ +++ ++GE  + + P Y+NF GTI E
Sbjct:  419 AQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHR-----FLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEE 901          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|O46374|TOP2A_PIG (DNA topoisomerase 2-alpha OS=Sus scrofa OX=9823 GN=TOP2A PE=2 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 1.844e-150
Identity = 251/491 (51.12%), Postives = 330/491 (67.21%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAE 1506
             Q   N++ S      +  +P L DAN AG  +S ECTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + YE ++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +  +FYS+ E E+W+  TP+   W++KYYKGLGT TS+EA EYF D KR+ I+F+Y+G +D  +I LAFS+ + ++RKEWL  ++E +   K L L +D        Y+T   FI  ELIL+    N+RSIPS++DGL PG RKVLFTC + +   E+ V+QLAGSV ++S+YH  E SLM  I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T L+ L +L+F P D   L  + DDN +    EPEWY PIIPM+LING   IG GWS  IP F   +V++ ++  ++GE  + + P Y+NF GTI E
Sbjct:  419 AQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHR-----FLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLKFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRLLMDGEEPLPMLPSYKNFKGTIEE 901          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|P41516|TOP2A_RAT (DNA topoisomerase 2-alpha OS=Rattus norvegicus OX=10116 GN=Top2a PE=1 SV=1)

HSP 1 Score: 472.241 bits (1214), Expect = 1.872e-148
Identity = 247/497 (49.70%), Postives = 333/497 (67.00%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG+ +S ECTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + YE ++ LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +  +FYS+ E E+W+   P+   W++KYYKGLGT TS+EA EYF + KR+ I+F+Y+G +D  +I LAFS+ + ++RKEWL  ++E +   K L L +D        Y+T   FI  ELIL+    N+RSIPS++DGL PG RKVLFTC + +   E+ V+QLAGSV ++S+YH  E SLM  I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T L+ L +L+F   D   L  + DDN +    EPEWY PIIPM+LING   IG GWS  IP F   +V++ +++ ++GE  + + P Y+N+ GTI E +  ++
Sbjct:  417 AQIQLNKKCSAVKHNRIKGIPKLDDANDAGSRNSAECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHR-----FLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSTNPNHKKWKVKYYKGLGTSTSKEAKEYFANMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTMYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPSKDDHTLRFLYDDNQR---VEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNYKGTIEELASNQY 905          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A5K3EPX2 (DNA topoisomerase 2 OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 1.157e-159
Identity = 256/490 (52.24%), Postives = 337/490 (68.78%), Query Frame = 1
Query:  112 VPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKG--SEFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKFNNMTLFDECGVI 1560
            +P L DAN AGT +S  CTLILTEG SAKS A++ L    RD YGVFPL+GKLLNVR+    +    A+I NL+KI+GL Y  KYE++E L  LRYGK+MIMTD D +GSHIKGL+I+FIH  WP+LL HN     F+EQF  PIVK F   +  +FYSI E E+WQK TP+  +WR+KYYKGLGT +S+EA EYF D  R+ I+FRY+G +D + I LAF+++K NERK+WL  ++E K     L L +D     G   +T   FI  EL+L+  M N+RSIPSL+DGL PG RKV+FTCL+ + V+E+ V+QL G+V ++S+YH  E SLM  I  LAQDFVGSNN+N+LMP GQFGTRL GGKD A  RY++T L+ LT+ IFH +D AIL+ + +DN K    EP WY P+IPM+LING   IG GWS+ +P +   +VI  +++ ++G + + + P YR + G I E  E ++    LF E  V+
Sbjct:  241 IPKLDDANDAGTKNSQHCTLILTEGDSAKSLAVAGLGVVGRDRYGVFPLRGKLLNVREAPTRQIMENAEINNLIKILGLQYKNKYETQESLANLRYGKIMIMTDQDQDGSHIKGLIISFIHHNWPKLLHHN-----FLEQFITPIVKIFKGKQEIAFYSIPEFEEWQKATPNWHTWRVKYYKGLGTSSSKEAKEYFSDMTRHRIRFRYSGPEDDSGIVLAFNKNKINERKQWLTSWMEEKRRRTELGLPEDYLYGAGTHTVTYHDFIHKELVLFSNMDNERSIPSLVDGLKPGQRKVMFTCLKRNQVKEIKVAQLCGAVSEMSSYHHGEMSLMGTIVGLAQDFVGSNNLNLLMPYGQFGTRLSGGKDSASARYIFTALSPLTRKIFHENDDAILHYLFEDNQK---IEPSWYIPVIPMVLINGAEGIGTGWSTKVPNYDTAEVIANIRRMLDGVDPLPMLPSYRGYRGKIVEVGENRY---ILFGEIAVL 719          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A183JF90 (Toprim domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS1356 PE=4 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 1.474e-158
Identity = 256/478 (53.56%), Postives = 337/478 (70.50%), Query Frame = 1
Query:  112 VPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD---GK--KYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            +P L DAN AGT +S +CTLILTEG SAK+ A++ L    RD YGVFPL+GKLLNVR+ S  +    A+I  L+KI+GL Y  KYES + LK LRYGK+MIMTD D +GSHIKGL+INF+H  WP LLKHN +E     +F  PIVK F   +  SFYS+ E E+WQK TP+  +WR+KYYKGLGT TS+EA EYF D  R+ I+FRY+G +D  SI LAF + K  +RK WL  + + +   + L L +    GK  + IT   F+  EL+L+  + N+RSIPS++DGL PG RKVLFTCL+ +L+ E+ V+QLAGSV +LSAYH  E+SLMS I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T LN LT+LIFH +D  +LN + DDN +    EPEWYAPIIPM+L+NG   IG G+++ I  ++ I++I+ L + ++GE   ++ P +R FTGTI +    ++
Sbjct:   25 IPKLDDANNAGTKNSSQCTLILTEGDSAKTLAVAGLGVVGRDNYGVFPLRGKLLNVREASNKQIMENAEINALIKILGLQYKLKYESADTLKDLRYGKIMIMTDQDQDGSHIKGLIINFVHCNWPNLLKHNVVE-----EFITPIVKVFKGKQEYSFYSLPEFEEWQKSTPNWHTWRVKYYKGLGTSTSKEAKEYFSDMNRHRIRFRYSGTEDDGSIQLAFDKSKIADRKNWLTNFTQERKRRRELGLPEPYLYGKDTRAITYHDFVHKELVLFSNLDNERSIPSVVDGLKPGQRKVLFTCLKRNLIREIKVAQLAGSVAELSAYHHGEQSLMSTIIGLAQNFVGSNNLNLLQPIGQFGTRLSGGKDAASPRYIFTALNSLTRLIFHLEDDPLLNYLYDDNQR---IEPEWYAPIIPMVLVNGADGIGTGYATHILNYNVIEIINNLYRMLDGEEPHRMLPNFRGFTGTIEDLGNNRY 494          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A401PNB4 (DNA topoisomerase 2 OS=Scyliorhinus torazame OX=75743 GN=scyTo_0003731 PE=3 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 2.571e-157
Identity = 270/540 (50.00%), Postives = 358/540 (66.30%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD---GK--KYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF----NNMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNY 1641
             Q M N++ S      +  +P L DAN AGT  S  CTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KIIGL Y + Y  +E LK LRYGKLMIMTD D +GSHIKGLLINFIH  WP LL+HN     FIE+F  PIVK   N +  +FYSI E E+W+    ++ +WR+KYYKGLGT TS+EA EYF + +R+ I F+Y G +D  +I LAFS  K +ERKEWL  ++  +   K   L +    GK  KY+T  +FI  EL+L+    N+RSIPSL+DGL PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E SLM  I  LAQ+FVGSNNIN+L PIGQFGTRL+GGKD A PRY++T L+ L + +F   D AIL  M DDN +    EPEWY PIIPM+L+NG   IG GW+  IP +   ++++ ++  ++G++ V + P Y+NF GTI E    ++        LFD  G ++KY++V++IL+ F+  RL+ Y  RK++
Sbjct:  421 AQNMLNKKCSGLKQTKIKGIPKLDDANDAGTKHSQGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLKGKILNVREASHKQIMENAEINNVIKIIGLQYKKDYNDQESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHN-----FIEEFITPIVKVSKNKQELAFYSIPEFEEWKSNVDNSRTWRIKYYKGLGTSTSKEAKEYFAEMQRHRIPFKYGGPEDDAAITLAFSRKKIDERKEWLTNFMVDRRQRKIDGLPEQYLYGKETKYLTYNEFINKELVLFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEISAYHHGEASLMMTIVGLAQNFVGSNNINVLQPIGQFGTRLNGGKDAASPRYIFTMLSTLARRLFPSVDDAILKYMDDDNQR---VEPEWYIPIIPMVLVNGADGIGTGWACRIPNYDVREIVNNIRHMLDGDDPVPMLPNYKNFKGTIFELGANQYMINGEISVLFDHTGCLKKYENVQDILKEFFNLRLKYYDLRKDW 952          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A402FGU0 (DNA topoisomerase 2 OS=Paroedura picta OX=143630 GN=parPi_0018086 PE=3 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 3.518e-157
Identity = 269/559 (48.12%), Postives = 355/559 (63.51%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKFN-----------------------NMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNY 1641
             Q   N++ S      +  +P L DAN AG+ +S  CTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I NL+KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +  +FYSI E E+W+   P+  SW++KYYKGLGT TS+EA EYF +  R+ I F+Y+G +D  +I LAFS+ K  +RKEWL  ++E +   K   L ++        Y+T   FI  ELIL+  M N+RSIPSL+DGL PG RKV+FTC + +   E+ V+QLAGSV ++SAYH  E SLM  I  LAQ+FVGSNN+N+L PIGQFGTRL GGKD A PRY++T L+ L +L+F P D  +LN + DDN +    EPEWY PI+PM+LING   IG GWS  +P +   +V+  L++ ++GE  + +HP Y+NF GTI E  +K++                           LFD  G ++KY   E+IL  FY  RL  YG RK++
Sbjct:  421 AQTQLNKKCSSVKHTRIKGIPKLDDANDAGSKNSINCTLILTEGDSAKTLAVSGLGIVGRDKYGVFPLRGKMLNVREASHKQIMENAEINNLIKIVGLQYKKNYDDPESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHR-----FLEEFITPIVKVSKNKEEVAFYSIPEFEEWKTTVPNYKSWKIKYYKGLGTSTSKEAKEYFAEMARHRIPFKYSGPEDDAAISLAFSKKKVEDRKEWLTNFMEDRRQRKLHGLPEEYLYGKATSYLTYNSFINKELILFSNMDNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEASLMMTIINLAQNFVGSNNMNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLVFPPVDDNVLNFLYDDNRR---VEPEWYIPILPMVLINGAEGIGTGWSCKVPNYDVREVVHNLRRMLDGEEPLPMHPNYKNFKGTIDELGQKQYLVNGEVSILDATTIEISELPVRTWTQVLFDHVGCLKKYDTAEDILREFYELRLRYYGLRKDW 971          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A0L8FFS9 (DNA topoisomerase 2 (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22023035mg PE=3 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 3.639e-157
Identity = 259/492 (52.64%), Postives = 340/492 (69.11%), Query Frame = 1
Query:  112 VPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLT-----KHLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF---NNMTLFDECGV 1557
            +P L DAN+AGT +S  CTLILTEG SAKS A++ L    RD YGVFPL+GK+LNVR+ +  +    A+I NL+KI+GL + +KYE  E L+ LRYGK+MIMTD D +GSHIKGL+INFIH +WP LLKHN +E     +F  PIVK   N    +FYSI E E+WQ+ T +  +W++KYYKGLGT T++EA EYF D +R+ I F+Y G +D  SI+LAFS+ K +ERKEWL  ++E K          L+L   G   I+  +FI  ELIL+    N RSIPSL+DGL PG RKV+FTC + +  +E+ V+QLAGSV +LSAYH  E SLMS I  LAQ+FVGSNNIN+L+PIGQFGTRL GGKD A PRY++T L+ + K IFH DD  +L  + DDN K    EPE+Y PIIPMIL+NG   IG GWS+ IP + P ++I  +++ ++G + + + PW++NF GTI E SE K+     +++ DE  V
Sbjct:  449 IPKLDDANWAGTKNSSHCTLILTEGDSAKSLAVAGLGIVGRDCYGVFPLKGKVLNVREATHKQIMENAEINNLIKILGLQFKEKYEDIEKLRTLRYGKIMIMTDQDNDGSHIKGLIINFIHHFWPNLLKHNVVE-----EFITPIVKVTKNKVEKAFYSIPEFEEWQRGTQNWHTWKIKYYKGLGTSTAKEAKEYFSDMERHRIPFKYEGPEDDASINLAFSKKKIDERKEWLTNWMEEKRRRLEMGLPELYLYGKGVNQISFNEFINRELILFSFTDNNRSIPSLVDGLKPGQRKVIFTCFKRNDKKEVKVAQLAGSVAELSAYHHGEASLMSTIINLAQNFVGSNNINLLLPIGQFGTRLHGGKDAASPRYIFTLLSSVGKRIFHSDDLPLLKNLYDDNQK---IEPEYYVPIIPMILVNGTDGIGTGWSTKIPNYDPREIITNIRRMLSGNDPLNMVPWFKNFKGTIEELSENKYLVSGEISVLDETTV 932          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2b (DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GENE-041008-136])

HSP 1 Score: 466.848 bits (1200), Expect = 6.055e-147
Identity = 243/497 (48.89%), Postives = 332/497 (66.80%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S ECTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ +  +    A+I N++KI+GL Y + Y+  E LK LRYGK+MIMTD D +GSHIKGLLINF H  WP LLKH      F+E+F  PIVKA  N +   FYSI E ++W+K+T +  +W +KYYKGLGT TS+EA EYF D +R+ I F+Y G +D  +I LAFS+ KT++RKEWL  ++E +   +   L +        ++++   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTC++ +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNN+NIL P+GQFGTR++GGKD A PRY++T L+ L KL+F   D  +L  + DDN K    EPEWY PIIPM+L+NG   IG GW+  IP + P ++++ + + ++ ++ + + P Y+NF G I E  + ++
Sbjct:  439 AQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLKSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHT-----FLEEFITPIVKASKNKQEIPFYSIPEFDEWKKQTENYKTWHIKYYKGLGTSTSKEAKEYFADMERHRIMFKYGGTEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEQYLYGTATRHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCMKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVNILQPLGQFGTRINGGKDAASPRYIFTMLSPLAKLLFPAVDSNLLKFLYDDNQK---VEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLDHQDPLPMLPSYKNFKGVIHELGQNQY 927          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 416.772 bits (1070), Expect = 4.257e-129
Identity = 229/486 (47.12%), Postives = 309/486 (63.58%), Query Frame = 1
Query:   70 NRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD---GKKY--ITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAE 1506
            N++ S      +  VP L DAN AG   S  CTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y   + LK LRYGKLMIMTD D +GSHIKGLLINFIH  WP LL+HN     F+E+F  PI+K  + N+  SFYSI E  +W+++  +  SW++KYYKGLGT TS+EA EYF D  R+ I FRY+G  D  +I LAFS  K  ERK+WL  ++  +   +  +L ++   GK+   +T   F+  EL+L+    N+RSIP L+DGL PG RKVLF C + +   E+ V+QLAGSV ++SAYH  E SLM  I              + +P+GQFGTRL GGKD A PRY++T L+ L++L+F   D  +L    DDN   V+ EPEWY PIIP++L+NG   IG GW+  +P F   ++I+ + + +NG+  + + P Y+ F GTI E
Sbjct:  423 NKKCSAVKHTKIKGVPKLDDANDAGGKHSAGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKIMGLQYRKNYSDPDSLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHN-----FLEEFITPIIKVSSKNQEFSFYSIPEFTEWKEKQNNIKSWKIKYYKGLGTSTSKEAKEYFSDMARHRIPFRYSGPADDEAITLAFSRKKIEERKDWLTSFMINRRQRREHNLPEEYLYGKETSSLTYHDFVNKELVLFSNSDNERSIPCLVDGLKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEISLMMTI--------------VGLPLGQFGTRLHGGKDSASPRYIFTMLSSLSRLLFPSVDDNLLKYNYDDN---VKVEPEWYIPIIPLVLVNGGDGIGTGWACKLPNFDVREIINNIHRMLNGDEPLPMLPSYKGFKGTIEE 886          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 416.387 bits (1069), Expect = 6.956e-129
Identity = 229/486 (47.12%), Postives = 309/486 (63.58%), Query Frame = 1
Query:   70 NRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD---GKKY--ITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAE 1506
            N++ S      +  VP L DAN AG   S  CTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y   + LK LRYGKLMIMTD D +GSHIKGLLINFIH  WP LL+HN     F+E+F  PI+K  + N+  SFYSI E  +W+++  +  SW++KYYKGLGT TS+EA EYF D  R+ I FRY+G  D  +I LAFS  K  ERK+WL  ++  +   +  +L ++   GK+   +T   F+  EL+L+    N+RSIP L+DGL PG RKVLF C + +   E+ V+QLAGSV ++SAYH  E SLM  I              + +P+GQFGTRL GGKD A PRY++T L+ L++L+F   D  +L    DDN   V+ EPEWY PIIP++L+NG   IG GW+  +P F   ++I+ + + +NG+  + + P Y+ F GTI E
Sbjct:  423 NKKCSAVKHTKIKGVPKLDDANDAGGKHSAGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKIMGLQYRKNYSDPDSLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHN-----FLEEFITPIIKVSSKNQEFSFYSIPEFTEWKEKQNNIKSWKIKYYKGLGTSTSKEAKEYFSDMARHRIPFRYSGPADDEAITLAFSRKKIEERKDWLTSFMINRRQRREHNLPEEYLYGKETSSLTYHDFVNKELVLFSNSDNERSIPCLVDGLKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEISLMMTI--------------VGLPLGQFGTRLHGGKDSASPRYIFTMLSSLSRLLFPSVDDNLLKYNYDDN---VKVEPEWYIPIIPLVLVNGGDGIGTGWACKLPNFDVREIINNIHRMLNGDEPLPMLPSYKGFKGTIEE 886          
BLAST of DNA topoisomerase 2 vs. Ensembl Sea Lamprey
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 479.559 bits (1233), Expect = 2.638e-155
Identity = 248/481 (51.56%), Postives = 332/481 (69.02%), Query Frame = 1
Query:  112 VPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYK---GLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD---GKK--YITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            +P L DAN AG  +S +CTLILTEG SAK+ A+S L    RD YG+FPL+GK+LNVR+ S  +    A+I NL+KI+GL Y +KY+  E LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+H      F+E+F  PIVK   N +   FYS+ E ++W+ ET +  +W++KYYK   GLGT TS+EA EYF D KR+ I+FRY+G +D N+I LAFS  K  +RKEWL  ++  +   +   L +    GK+  Y+T   FI  ELIL+    N+RSIPSL+DG  PG RKVLFTC + +   E+ V+QLAGSV ++SAYH  E+SLM  I  LAQ+FVGSNNIN+L PIGQFGTRL+GGKD A PRY++T ++ + +L+F P D  +L  + DDN +    EPEWY PIIP++L+NG   IG GW+S IP F+P ++I+ +++ ++GE  + + PWY+NF G+I E    +F
Sbjct:   83 IPKLDDANDAGGKNSQKCTLILTEGDSAKTLAVSGLGVVGRDHYGIFPLRGKMLNVREASYKQIMENAEINNLIKIVGLQYKKKYDDPESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLQHR-----FLEEFITPIVKVSKNKQELPFYSMPEFDEWKNETSNYKTWKIKYYKDMPGLGTSTSKEAKEYFADMKRHRIEFRYSGPEDDNAITLAFSRKKIEDRKEWLTNWMVDRRQRREQGLPESFLYGKQTAYLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQSLMMTIVSLAQNFVGSNNINVLQPIGQFGTRLNGGKDAASPRYIFTMISTVARLLFPPVDDNLLKFLWDDNQR---VEPEWYCPIIPLVLVNGADGIGTGWASRIPNFNPREIINNIRRLLDGEEPLPMLPWYKNFKGSIDELGPNQF 555          
BLAST of DNA topoisomerase 2 vs. Ensembl Yeast
Match: TOP2 (Topoisomerase II; relieves torsional strain in DNA by cleaving and re-sealing phosphodiester backbone of both positively and negatively supercoiled DNA; cleaves complementary strands; localizes to axial cores in meiosis; required for replication slow zone (RSZ) breakage following Mec1p inactivation; human homolog TOP2A implicated in cancers, and can complement yeast null mutant [Source:SGD;Acc:S000005032])

HSP 1 Score: 394.815 bits (1013), Expect = 2.823e-122
Identity = 222/483 (45.96%), Postives = 305/483 (63.15%), Query Frame = 1
Query:   73 RESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVS---SFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAE 1506
            ++S  T    + N P L DAN AGT + ++CTL+LTEG SA S A++ L    RD+YG +PL+GK+LNVR+ S  +    A+I+ + KI+GL + +KYE     K LRYG LMIMTD D +GSHIKGL+INF+   +P LL        F+ +F  PI+K           +FY++ + EKW++E     +W+ KYYKGLGT  ++E  EYF +  R++  F      D + IDLAFS+ K ++RKEWL +Y     L   L       K I I  FI  ELIL+ +  N RSIP+++DG  PG RKVL+ C + +L  E+ V+QLA  V + +AYH  E+SL   I  LAQ+FVGSNNI +L+P G FGTR  GGKD A  RY+YT+LNKLT+ IFHP D   L + + ++ K V  EPEWY PI+PMIL+NG   IG GWS+ IP F+P+++I  ++  +N E   ++HPW+R +TGTI E
Sbjct:  413 KKSDGTRKSRITNYPKLEDANKAGTKEGYKCTLVLTEGDSALSLAVAGLAVVGRDYYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMGLQHRKKYED---TKSLRYGHLMIMTDQDHDGSHIKGLIINFLESSFPGLLDIQ----GFLLEFITPIIKVSITKPTKNTIAFYNMPDYEKWREEESHKFTWKQKYYKGLGTSLAQEVREYFSNLDRHLKIFHSLQGNDKDYIDLAFSKKKADDRKEWLRQYEPGTVLDPTL-------KEIPISDFINKELILFSLADNIRSIPNVLDGFKPGQRKVLYGCFKKNLKSELKVAQLAPYVSECTAYHHGEQSLAQTIIGLAQNFVGSNNIYLLLPNGAFGTRATGGKDAAAARYIYTELNKLTRKIFHPADDP-LYKYIQEDEKTV--EPEWYLPILPMILVNGAEGIGTGWSTYIPPFNPLEIIKNIRHLMNDEELEQMHPWFRGWTGTIEE 878          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO29547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3B9])

HSP 1 Score: 147.517 bits (371), Expect = 3.016e-41
Identity = 76/167 (45.51%), Postives = 109/167 (65.27%), Query Frame = 1
Query:  592 LEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTK-----HLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSE 1077
            +E+W+  T +  SW++KYYKGLGT T +EA EYF D +R+ I F+Y G  D  +I +AFS+ K  ERK+WL + +E +   +      L+L +   K ++   F+  ELIL+    N+RSIPSL+DGL PG RKV+FTC + +   E+ V+QLAGS+ +LSAYH  E
Sbjct:    1 MEEWKAGTANHKSWKVKYYKGLGTSTPKEAKEYFSDMERHKINFKYEGPHDDEAIVMAFSKKKIQERKDWLTRGLEERKWRREQGLSELYLYEKDTKRVSYCDFVNKELILFSNTDNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLAGSIAELSAYHHGE 167          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU4])

HSP 1 Score: 130.183 bits (326), Expect = 9.550e-36
Identity = 65/118 (55.08%), Postives = 82/118 (69.49%), Query Frame = 1
Query:  301 NRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKG 654
            + A+I N++KI GL YN+KY+S++ LK LRYG LMIMTD D +GSHIKGL+INFIH  WP LLK       F+EQF  PIVK     +  SFYSI E E+W+    +  SW++KYYKG
Sbjct:    2 DNAEINNIIKITGLQYNKKYKSEDDLKSLRYGHLMIMTDQDQDGSHIKGLVINFIHSNWPGLLK-----LGFVEQFITPIVKVSKGKEEHSFYSIPEYEEWKAGNANHKSWKVKYYKG 114          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU3])

HSP 1 Score: 85.8853 bits (211), Expect = 6.213e-18
Identity = 39/108 (36.11%), Postives = 66/108 (61.11%), Query Frame = 1
Query: 1243 IFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKFN---NMTLFDECGV 1557
            +F P D+  L  + +DN +    EPEWY PIIP IL+NG   IG G+S+ +P + P  + + +++ +NGE   ++ PWY+NF GTI +  + K++   N+ + D+  +
Sbjct:    9 LFPPSDEPNLKFLNEDNQRI---EPEWYCPIIPTILVNGAEGIGTGYSTKVPNYDPRAIAENIRKMMNGEEPEEMLPWYKNFIGTITKVDDTKYSVTGNIEVIDDTTL 113          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44813 (DNA topoisomerase 2 [Source:UniProtKB/TrEMBL;Acc:A7RUU5])

HSP 1 Score: 82.0333 bits (201), Expect = 2.161e-16
Identity = 41/74 (55.41%), Postives = 51/74 (68.92%), Query Frame = 1
Query:   70 NRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS 291
            N++ S +    +  +P L DAN AG  +S  CTLILTEG SAK+ AIS L+   RD YGVFPL+GKLLNVR+ S
Sbjct:  439 NKKCSGSKHSKIRGIPKLDDANDAGGKNSRHCTLILTEGDSAKTLAISGLSIVGRDRYGVFPLRGKLLNVREAS 512          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO25698 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVR1])

HSP 1 Score: 72.7886 bits (177), Expect = 3.707e-14
Identity = 61/231 (26.41%), Postives = 106/231 (45.89%), Query Frame = 1
Query:  151 DSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGSE---FRNRAKIENLVKIIGLDYNQKYESKEL-LKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRL------KYYKGLGTFTSEEAGEYFRDKK-RNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEK 810
            D  +C + L EG SA   A       DR+F  + PL+GK+LNV K  +   F N  +I+N+   +G+    + + + L L  +RY K++IM D D +GSHI  L++ F   Y  E+     IE  ++    PP+       K    Y+      W     D  + ++      + YKGLG   +E+  +   + + R + +   +   + + +      D+   R+E++EK
Sbjct:   59 DPAQCEIFLVEGDSAGGTAKQ---GRDRNFQAILPLRGKILNVEKAMQHKVFENE-EIKNMFTALGVSIGTEEDPRALNLSKVRYHKVVIMCDADVDGSHIATLILTFFFRYMREM-----IEQGYVYIATPPLYLVKKGQKRE--YA------WDDNQRDLIAQKMGGGVTIQRYKGLGEMNAEQLWDTTMNPEFRTLRQVTIDNMTEADRVFSMLMGDEVPPRREFIEK 272          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 475.707 bits (1223), Expect = 9.173e-151
Identity = 251/497 (50.50%), Postives = 334/497 (67.20%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQ-----DGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S ECTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ +  +    A+I N++KI+GL Y + Y+  E L+ LRYGK+MIMTD D +GSHIKGLLINF H  WP LLKH      F+EQF  PIVKA  N +  SFYS+ E E+W+K+T +  SW +KYYKGLGT TS+EA EYF D +R+ I FRY G +D  +I LAFS+ KT++RKEWL  ++E +   +   L +        K+++   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTCL+ +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNNINIL P+GQFGTR++GGKD A PRY++T L+ LTKL+F   D  +L  + DDN K    EPEWY PIIPM+L+NG   IG GW+  IP + P ++++ + + +N ++ + + P Y+NF G I E  + ++
Sbjct:  350 AQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLRSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHT-----FLEQFITPIVKATKNKQELSFYSLPEFEEWKKQTDNYKSWHVKYYKGLGTSTSKEAKEYFADMERHRITFRYQGAEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEKYLYGTQTKHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCLKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINILQPLGQFGTRINGGKDAASPRYIFTMLSPLTKLLFPAVDSNLLKFLYDDNQK---VEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQY 838          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 475.322 bits (1222), Expect = 4.249e-150
Identity = 253/499 (50.70%), Postives = 336/499 (67.33%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLT-------KHLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
             Q   N++ S      +  +P L DAN AG   S ECTLILTEG SAKS A+S L    RD YGVFPL+GK+LNVR+ +  +    A+I N++KI+GL Y + Y+  E L+ LRYGK+MIMTD D +GSHIKGLLINF H  WP LLKH      F+EQF  PIVKA  N +  SFYS+ E E+W+K+T +  SW +KYYKGLGT TS+EA EYF D +R+ I FRY G +D  +I LAFS+ KT++RKEWL  ++E +          K+L+  Q   K+++   FI  ELIL+    N+RSIPSL+DGL PG RKVLFTCL+ +   E+ V+QLAGSV ++SAYH  E++LM  I  LAQ+FVGSNNINIL P+GQFGTR++GGKD A PRY++T L+ LTKL+F   D  +L  + DDN K    EPEWY PIIPM+L+NG   IG GW+  IP + P ++++ + + +N ++ + + P Y+NF G I E  + ++
Sbjct:  429 AQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLRSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHT-----FLEQFITPIVKATKNKQELSFYSLPEFEEWKKQTDNYKSWHVKYYKGLGTSTSKEAKEYFADMERHRITFRYQGAEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEKYLYGTQ--TKHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCLKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINILQPLGQFGTRINGGKDAASPRYIFTMLSPLTKLLFPAVDSNLLKFLYDDNQK---VEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQY 917          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2a (DNA topoisomerase II alpha [Source:NCBI gene;Acc:101158729])

HSP 1 Score: 453.751 bits (1166), Expect = 3.091e-142
Identity = 241/499 (48.30%), Postives = 321/499 (64.33%), Query Frame = 1
Query:   55 TQFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQD-----GKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKFNN 1530
             Q   N++ S      +  VP L DAN AG  +S  CTLILTEG SAK+ A+S L    RD YGVFPL+GK+LNVR+ S  +    A+I N++KI+GL Y + Y   E LK LRYGK+MIMTD D +GSHIKGLLINFIH  WP LL+HN     F+E+F  PI+KA N     SFYSI E   W++   +  SW++KYYKGLGT TS+EA EYF D +R+ I F+Y+G +D  +I LAFS+ K  ERKEWL  ++  +   +  +L +D       K ++   FI  EL+L+    N+RSIP L+DG  PG RKVLF C + +   E+ V+QLAGSV ++SAYH  E SLM  I  LAQ+FVGSNN+N+L P+GQFGTRL GGKD A PRY++T L+ L +L+F P D  +L    DDN +    EPEWY PIIP +L+NG   IG GW+S IP +   +++  + + ++GE  + + P Y+ F GTI +    ++ N
Sbjct:  415 AQTQLNKKCSAVKHTKIKGVPKLDDANDAGGKNSIGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNVIKILGLQYKKNYSDPESLKSLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHN-----FLEEFITPIIKASNKKNQLSFYSIPEFNAWKETQSNHKSWKIKYYKGLGTSTSQEAKEYFSDMERHRIPFKYSGPEDDEAISLAFSKKKVEERKEWLTNFMVNRRQRREHNLPEDYLYGQSTKSLSYNDFINKELVLFSNSDNERSIPCLVDGFKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEVSLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSPLARLVFPPVDDNLLKYNYDDNQR---VEPEWYIPIIPTVLVNGAEGIGTGWASKIPNYDIREIVSNIHRMLDGEEPLPMLPNYKGFRGTIDQVMSNQYMN 905          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 81.2629 bits (199), Expect = 5.441e-16
Identity = 35/94 (37.23%), Postives = 57/94 (60.64%), Query Frame = 1
Query: 1243 IFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            +F   D  +L  + DDN K    EPEWY PIIPM+L+NG   IG GW+  IP + P ++++ + + +N ++ + + P Y+NF G I E  + ++
Sbjct:   11 LFPAVDSNLLKFLYDDNQKV---EPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQY 101          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000070153.1 (SMESG000070153.1)

HSP 1 Score: 981.089 bits (2535), Expect = 0.000e+0
Identity = 484/497 (97.38%), Postives = 487/497 (97.99%), Query Frame = 1
Query:   64 MPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGSEFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKFNNMTLFDECG 1554
            MPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGSEFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRY GEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVS+LAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRYLYTKLNKLTKLIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSE  +      D+ G
Sbjct:    1 MPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGSEFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYKGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSRLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRYLYTKLNKLTKLIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSENSYTVKGKVDKIG 497          

HSP 2 Score: 137.887 bits (346), Expect = 1.347e-33
Identity = 89/116 (76.72%), Postives = 91/116 (78.45%), Query Frame = 1
Query: 1519 KFNNMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNYX--------------------XXXXXXXXXXXXXXXXRIKDKSKKEMWLEDLEKLENEIKVSYDSDIQESEEIEP 1806
            + +NMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNYL                        LKEIDDKLKELKRIKDKSKKEMWLEDLEKLENEIKVSYDSDIQESEEIEP
Sbjct:  645 RLSNMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNYLLDNLLKEIDDKLKELKEIDDKLKELKEIDDKLKELKRIKDKSKKEMWLEDLEKLENEIKVSYDSDIQESEEIEP 760          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037557.1 (SMESG000037557.1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 311/496 (62.70%), Postives = 366/496 (73.79%), Query Frame = 1
Query:   58 QFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQ-----DGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            Q + +++ S T    + ++P L DANFAGT +S +CTLILTEG SAKS A+S L    RD+YGVFPL+GKLLNVR+ S  +    A+I N++KIIGL Y+QKYE  E LK LRYGKLMIMTD D +GSHIKGLLINFIH  WP LLKHN     F+EQF  PIVKAF NN+V SFYSI EL +WQK TP A  WRLKYYKGLGT T +EA EYF D +R++IKFRY+GE+DG SI LAFS+ K +ERKEWL  ++E     + L +D+      G KYIT   FI  ELIL+    N+RSIP LMDG  PG RKVLF CL+ +LV+E+ V+QLAGSV +LSAYH  E SLMS I  LAQDFVGSNNIN+LMP GQFGTRL GGKD A PRY+ T+L+KLTKLIFH DD+A+L  +LDDN      EPEWYAPIIPM+LINGC  IG GWSS IP F+P DVID LK+ ING   VK+HPWYRNFTGTI E  E K+
Sbjct:  327 QALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLKGKLLNVREASAKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-----FVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTDKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQ---SIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKY 814          

HSP 2 Score: 57.3806 bits (137), Expect = 3.937e-8
Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 1
Query: 1522 FNNMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNY 1641
             +NM LFDECGVIRKY +  EILE F+  RLE+Y KRKNY
Sbjct:  904 LSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNY 943          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037557.1 (SMESG000037557.1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 311/496 (62.70%), Postives = 366/496 (73.79%), Query Frame = 1
Query:   58 QFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQ-----DGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            Q + +++ S T    + ++P L DANFAGT +S +CTLILTEG SAKS A+S L    RD+YGVFPL+GKLLNVR+ S  +    A+I N++KIIGL Y+QKYE  E LK LRYGKLMIMTD D +GSHIKGLLINFIH  WP LLKHN     F+EQF  PIVKAF NN+V SFYSI EL +WQK TP A  WRLKYYKGLGT T +EA EYF D +R++IKFRY+GE+DG SI LAFS+ K +ERKEWL  ++E     + L +D+      G KYIT   FI  ELIL+    N+RSIP LMDG  PG RKVLF CL+ +LV+E+ V+QLAGSV +LSAYH  E SLMS I  LAQDFVGSNNIN+LMP GQFGTRL GGKD A PRY+ T+L+KLTKLIFH DD+A+L  +LDDN      EPEWYAPIIPM+LINGC  IG GWSS IP F+P DVID LK+ ING   VK+HPWYRNFTGTI E  E K+
Sbjct:  191 QALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLKGKLLNVREASAKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-----FVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTDKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQ---SIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKY 678          

HSP 2 Score: 57.3806 bits (137), Expect = 3.757e-8
Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 1
Query: 1522 FNNMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNY 1641
             +NM LFDECGVIRKY +  EILE F+  RLE+Y KRKNY
Sbjct:  768 LSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNY 807          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037559.1 (SMESG000037559.1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 294/496 (59.27%), Postives = 346/496 (69.76%), Query Frame = 1
Query:   58 QFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQ-----DGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            Q + +++ S T    + ++P L DANFAGT +S +CTLILTEG SAKS A+S L    RD+YGVFPL+GKLLNVR+ S  +    A+I N++KIIGL Y+QKYE  E LK LRYGKLMIMTD D +GSHIKGLLINFIH  WP LLKHN     F+EQF  PIVKAF NN+V SFYSI EL +WQK TP A  WRLKYYKGLGT T +EA EYF D +R++IKFRY+GE+DG SI LAFS+ K +ERKEWL  ++E     + L +D+      G KYIT   FI  ELIL+    N+RSIP LMDG  PG RKVLF CL+ +LV+E+ V+QLAGSV +LSAYH  E SLMS I  LAQDFVGSNNIN+LMP GQFGTRL G K                 +  H    A+L  +LDDN      EPEWYAPIIPM+LINGC  IG GWSS IP F+P DVID LK+ ING   VK+HPWYRNFTGTI E  E K+
Sbjct:  413 QALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLKGKLLNVREASAKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-----FVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTDKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGAK-----------------IALHLVTYAVLKYLLDDNQ---SIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKY 883          

HSP 2 Score: 57.3806 bits (137), Expect = 3.418e-8
Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 1
Query: 1522 FNNMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNY 1641
             +NM LFDECGVIRKY +  EILE F+  RLE+Y KRKNY
Sbjct:  973 LSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNY 1012          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037565.1 (SMESG000037565.1)

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 289/496 (58.27%), Postives = 343/496 (69.15%), Query Frame = 1
Query:   58 QFMPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAISCLTATDRDFYGVFPLQGKLLNVRKGS--EFRNRAKIENLVKIIGLDYNQKYESKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECDFIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGTFTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKYVECKDLTKHLHLDQ-----DGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLIPGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQDFVGSNNINILMPIGQFGTRLDGGKDCALPRXXXXXXXXXXXXIFHPDDKAILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPIDVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKF 1524
            Q + +++ S T    + ++P L DANFAGT +S +CTLILTEG SAKS A+S L    RD+YGVFPL+GKLLNVR+    +    A+I N++KIIGL Y+QKYE  E LK LRYGKLMIMTD D +GSHIKGLLINFIH  WP LLKHN     F+EQF  PIVKAF NN+V SFYSI EL +WQ+ TPD+  WRLKYYKGLGT TS+EA EYF D +R++IKFRY+GE+DG SI LAFS+ K +ERKEWL  ++E     + L +D+      G KYIT   FI  ELIL+    N+RSIP LMDG  PG RKVLF CL+ +LV+E+ V+QLAGSV +LSAYH  E SLMS I  LAQDFVGSNNIN+LMP GQFGTRL GGKD A PRY                               +  + +WYAPIIPM+LINGC  IG GWSS IP F+P DVID LK+ ING   VK+HPWYRNFTGTI E  E K+
Sbjct:  410 QALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-----FVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRY-------------------------------ICTQLKWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKY 869          

HSP 2 Score: 57.3806 bits (137), Expect = 3.777e-8
Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 1
Query: 1522 FNNMTLFDECGVIRKYKDVEEILECFYLKRLEMYGKRKNY 1641
             +NM LFDECGVIRKY +  EILE F+  RLE+Y KRKNY
Sbjct:  959 LSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNY 998          
The following BLAST results are available for this feature:
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TOP2A7.474e-15250.92DNA topoisomerase II alpha [Source:HGNC Symbol;Acc... [more]
TOP2B8.431e-15049.80DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
TOP2B6.144e-14649.80DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
TOP2B6.364e-14649.80DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
top-22.945e-14948.95DNA topoisomerase 2 top-2 [Source:UniProtKB/Swiss... [more]
cin-46.628e-13543.75DNA topoisomerase-like protein cin-4 [Source:UniP... [more]
R05D3.128.271e-11542.07Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
R05D3.123.405e-6140.34Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
R05D3.123.405e-6140.34Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Top24.670e-14550.73gene:FBgn0284220 transcript:FBtr0332320[more]
Top24.670e-14550.73gene:FBgn0284220 transcript:FBtr0081287[more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
top2b1.440e-14949.70DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
top2a2.276e-14048.30DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
top2a3.124e-3248.00DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOP2B2.368e-14749.40DNA topoisomerase II beta [Source:NCBI gene;Acc:77... [more]
TOP2B2.707e-14749.40DNA topoisomerase II beta [Source:NCBI gene;Acc:77... [more]
TOP2B8.335e-14749.40DNA topoisomerase II beta [Source:NCBI gene;Acc:77... [more]
TOP2B1.183e-14649.40DNA topoisomerase II beta [Source:NCBI gene;Acc:77... [more]
TOP2A2.181e-14650.00DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Top2a3.376e-15350.50topoisomerase (DNA) II alpha [Source:MGI Symbol;Ac... [more]
Top2b3.628e-14649.80topoisomerase (DNA) II beta [Source:MGI Symbol;Acc... [more]
back to top
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01320|TOP2A_MOUSE2.362e-15250.50DNA topoisomerase 2-alpha OS=Mus musculus OX=10090... [more]
sp|P41515|TOP2A_CRIGR7.775e-15250.70DNA topoisomerase 2-alpha OS=Cricetulus griseus OX... [more]
sp|P11388|TOP2A_HUMAN3.589e-15150.92DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 ... [more]
sp|O46374|TOP2A_PIG1.844e-15051.12DNA topoisomerase 2-alpha OS=Sus scrofa OX=9823 GN... [more]
sp|P41516|TOP2A_RAT1.872e-14849.70DNA topoisomerase 2-alpha OS=Rattus norvegicus OX=... [more]
back to top
BLAST of DNA topoisomerase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EPX21.157e-15952.24DNA topoisomerase 2 OS=Mesocestoides corti OX=5346... [more]
A0A183JF901.474e-15853.56Toprim domain-containing protein OS=Schistosoma cu... [more]
A0A401PNB42.571e-15750.00DNA topoisomerase 2 OS=Scyliorhinus torazame OX=75... [more]
A0A402FGU03.518e-15748.12DNA topoisomerase 2 OS=Paroedura picta OX=143630 G... [more]
A0A0L8FFS93.639e-15752.64DNA topoisomerase 2 (Fragment) OS=Octopus bimaculo... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
top2b6.055e-14748.89DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
top2a4.257e-12947.12DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
top2a6.956e-12947.12DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
top2a2.638e-15551.56DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOP22.823e-12245.96Topoisomerase II; relieves torsional strain in DNA... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO295473.016e-4145.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448129.550e-3655.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448116.213e-1836.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448132.161e-1655.41DNA topoisomerase 2 [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO256983.707e-1426.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
top2b9.173e-15150.50DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
top2b4.249e-15050.70DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
top2a3.091e-14248.30DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
top2b5.441e-1637.23DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070153.11.347e-3397.38SMESG000070153.1[more]
SMESG000037557.13.937e-862.70SMESG000037557.1[more]
SMESG000037557.13.757e-862.70SMESG000037557.1[more]
SMESG000037559.13.418e-859.27SMESG000037559.1[more]
SMESG000037565.13.777e-858.27SMESG000037565.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015481 ID=SMED30015481|Name=DNA topoisomerase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2055bp
AAAGTATGAATTGATTTTATTTTTTCAATAGATTAATTTTTAGATATAGA
TTTGACACAGTTTATGCCTAATAGGGAAAGTTCCGATACCAGTGCGAAAG
TAGTCGTAAATGTGCCGAATTTAGTTGATGCAAATTTCGCCGGAACTGCG
GACTCTTGGGAGTGTACTTTGATCTTAACTGAAGGAAGCTCAGCCAAATC
TTTTGCTATTTCTTGTCTTACAGCTACTGACAGGGATTTTTACGGAGTAT
TTCCTCTACAGGGGAAACTACTTAATGTAAGAAAAGGTAGTGAATTCCGT
AACAGAGCTAAAATAGAAAACCTCGTGAAGATTATTGGCTTGGATTATAA
TCAAAAGTATGAATCAAAAGAATTATTGAAGGGCTTGCGATATGGAAAGC
TGATGATAATGACAGATCCAGATCCAGAAGGATCTCACATAAAGGGCTTG
CTGATAAATTTCATTCATTTTTATTGGCCTGAACTATTAAAGCACAACAC
TATTGAATGCGATTTCATCGAGCAATTCGCACCGCCGATAGTGAAAGCAT
TCAATAACAACAAAGTTTCATCTTTCTATAGTATTCTTGAGCTTGAAAAA
TGGCAAAAGGAAACTCCCGATGCTGCTAGTTGGCGATTGAAGTATTACAA
GGGGTTGGGCACTTTTACTAGTGAGGAAGCGGGAGAATATTTTAGGGACA
AAAAACGAAATGTTATAAAATTTCGATACAATGGTGAAAAAGATGGTAAC
AGTATAGATTTGGCCTTTTCAGAAGATAAAACCAATGAACGTAAAGAATG
GTTAGAGAAATATGTCGAGTGCAAGGATTTGACAAAGCATCTTCATTTAG
ATCAAGATGGCAAAAAATACATAACGATTAGAAAATTCATTAAATATGAG
CTTATTTTATACGGCATAATGCATAATAAGAGAAGCATTCCGAGTTTGAT
GGACGGATTGATACCCGGTCCGAGAAAGGTGTTATTTACCTGTTTGGAAA
TGGATCTAGTGGAGGAAATGAATGTTTCACAATTAGCTGGATCCGTTATT
AAATTATCAGCATATCACCAAAGTGAAGAATCGTTGATGTCAAATATCAA
AAAATTGGCTCAAGATTTCGTCGGCAGCAATAATATCAATATTCTGATGC
CAATTGGTCAATTCGGTACTCGGCTTGACGGTGGCAAAGATTGTGCTTTA
CCTCGTTACTTATATACTAAATTGAATAAGTTGACGAAATTAATTTTCCA
CCCCGACGACAAGGCGATATTGAACCGCATGCTGGATGACAATCATAAAC
CTGTGGAACCGGAACCAGAATGGTATGCACCAATCATTCCTATGATACTA
ATTAACGGTTGTACGGCTATCGGATATGGATGGAGTAGTTCAATTCCTTG
TTTCCACCCGATAGACGTGATAGATTATTTGAAACAGAGGATTAATGGGG
AAAACACCGTAAAAATTCATCCATGGTATCGTAATTTTACCGGAACAATT
GCTGAGAAGTCTGAAAAGAAATTTAACAACATGACATTGTTTGATGAATG
CGGAGTCATTAGGAAATATAAAGATGTAGAAGAAATCCTCGAGTGCTTTT
ATCTTAAACGCTTAGAAATGTATGGCAAAAGGAAAAATTATTTATTGGAT
AATTTATTAAAGGAGATAGACGACAAGTTAAAAGAATTAAAGAGGATAAA
AGATAAATCCAAGAAAGAAATGTGGTTAGAGGATTTAGAAAAGCTAGAAA
ATGAAATCAAAGTTTCCTATGATTCTGATATTCAGGAATCCGAGGAAATA
GAACCATAAACCGCTCCTTCGACATCCAGTTGTGGCCTTTAACTGAAAAT
AGAAAATAAATCGACTAAAACAAATATTTATCAGTGATCTCGATTTTATC
GCGTAAAGGTAGTGATTTATATAATTTTCCTGGTTTTATAGCACTTATAT
ATCTGATAGCATTATTTATGATATTTAATATAACAAAATGTGACCCATAA
AAGCACTGTAATGATTGGCTGTGATTATTGATTCATTTCAAATGTTTTGT
GAGTG
back to top

protein sequence of SMED30015481-orf-1

>SMED30015481-orf-1 ID=SMED30015481-orf-1|Name=SMED30015481-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=582bp
MPNRESSDTSAKVVVNVPNLVDANFAGTADSWECTLILTEGSSAKSFAIS
CLTATDRDFYGVFPLQGKLLNVRKGSEFRNRAKIENLVKIIGLDYNQKYE
SKELLKGLRYGKLMIMTDPDPEGSHIKGLLINFIHFYWPELLKHNTIECD
FIEQFAPPIVKAFNNNKVSSFYSILELEKWQKETPDAASWRLKYYKGLGT
FTSEEAGEYFRDKKRNVIKFRYNGEKDGNSIDLAFSEDKTNERKEWLEKY
VECKDLTKHLHLDQDGKKYITIRKFIKYELILYGIMHNKRSIPSLMDGLI
PGPRKVLFTCLEMDLVEEMNVSQLAGSVIKLSAYHQSEESLMSNIKKLAQ
DFVGSNNINILMPIGQFGTRLDGGKDCALPRYLYTKLNKLTKLIFHPDDK
AILNRMLDDNHKPVEPEPEWYAPIIPMILINGCTAIGYGWSSSIPCFHPI
DVIDYLKQRINGENTVKIHPWYRNFTGTIAEKSEKKFNNMTLFDECGVIR
KYKDVEEILECFYLKRLEMYGKRKNYLLDNLLKEIDDKLKELKRIKDKSK
KEMWLEDLEKLENEIKVSYDSDIQESEEIEP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001241Topo_IIA
IPR001154TopoII_euk
IPR002205Topo_IIA_A/C
IPR013759Topo_IIA_B_C
IPR031660TOPRIM_C
IPR013757Topo_IIA_A_a_sf
IPR013758Topo_IIA_A/C_ab
IPR006171TOPRIM_domain
IPR013760Topo_IIA-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006265DNA topological change
GO:0006259DNA metabolic process
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003677DNA binding
GO:0003918DNA topoisomerase type II (ATP-hydrolyzing) activity
GO:0000166nucleotide binding
GO:0003916DNA topoisomerase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 528..552
NoneNo IPR availablePRINTSPR00418TPI2FAMILYcoord: 36..50
score: 52.52
coord: 125..142
score: 50.47
coord: 107..123
score: 57.25
coord: 192..208
score: 48.49
NoneNo IPR availableGENE3DG3DSA:3.30.1490.30coord: 158..201
e-value: 1.6E-95
score: 321.3
NoneNo IPR availableGENE3DG3DSA:3.30.1360.40coord: 475..484
e-value: 2.7E-86
score: 292.2
NoneNo IPR availablePANTHERPTHR10169DNA TOPOISOMERASE/GYRASEcoord: 487..532
coord: 9..485
IPR001154DNA topoisomerase II, eukaryotic-typePRINTSPR01158TOPISMRASEIIcoord: 19..29
score: 54.86
coord: 365..387
score: 66.72
coord: 126..141
score: 71.77
coord: 395..415
score: 27.26
coord: 198..210
score: 65.25
coord: 80..93
score: 43.6
coord: 318..341
score: 50.29
coord: 34..41
score: 94.83
IPR002205DNA topoisomerase, type IIA, subunit A/C-terminalSMARTSM00434topIV4coord: 270..580
e-value: 5.9E-17
score: 68.2
IPR002205DNA topoisomerase, type IIA, subunit A/C-terminalPFAMPF00521DNA_topoisoIVcoord: 290..483
e-value: 1.1E-58
score: 199.1
IPR001241DNA topoisomerase, type IIASMARTSM00433topII5coord: 2..252
e-value: 1.5E-7
score: -252.4
IPR006171TOPRIM domainPFAMPF01751Toprimcoord: 36..147
e-value: 1.1E-8
score: 35.3
IPR006171TOPRIM domainPROSITEPS50880TOPRIMcoord: 34..157
score: 14.912
IPR013759DNA topoisomerase, type IIA, subunit B, C-terminalGENE3DG3DSA:3.40.50.670coord: 20..287
e-value: 1.6E-95
score: 321.3
IPR013758DNA topoisomerase, type IIA, subunit A/ C-terminal, alpha-betaGENE3DG3DSA:3.90.199.10coord: 288..474
e-value: 2.7E-86
score: 292.2
IPR013758DNA topoisomerase, type IIA, subunit A/ C-terminal, alpha-betaGENE3DG3DSA:3.90.199.10coord: 489..523
e-value: 6.6E-11
score: 43.6
IPR013757Type IIA DNA topoisomerase subunit A, alpha-helical domain superfamilyGENE3DG3DSA:1.10.268.10coord: 524..535
e-value: 6.6E-11
score: 43.6
IPR031660C-terminal associated domain of TOPRIMPFAMPF16898TOPRIM_Ccoord: 155..287
e-value: 3.9E-35
score: 120.9
IPR013760DNA topoisomerase, type IIA-like domain superfamilySUPERFAMILYSSF56719Type II DNA topoisomerasecoord: 13..566