Actin cytoplasmic type 5

Overview
NameActin cytoplasmic type 5
Smed IDSMED30015473
Length (bp)2100
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin cytoplasmic type 5 (SMED30015473) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin cytoplasmic type 5 (SMED30015473) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin cytoplasmic type 5 (SMED30015473) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin cytoplasmic type 5 (SMED30015473) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015473

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015473SMESG000080982.1 SMESG000080969.1 dd_Smed_v4_2624_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin cytoplasmic type 5 vs. Ensembl Fly
Match: udt (gene:FBgn0039113 transcript:FBtr0084464)

HSP 1 Score: 277.33 bits (708), Expect = 1.075e-83
Identity = 179/613 (29.20%), Postives = 293/613 (47.80%), Query Frame = 2
Query:  182 FSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXXXXXXXXXXXXXXMGFETGFVRSKSQQLDF--------NCKSIIEGIYQFNYK-LTKYSGICDRGSNLIKACQKQGSP-LRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTF 1990
            FS E G  T+T I +  + S      G C+      N +     +   ++  ++ +C+ C R I R+L V +                  ++ +    V+   Q +          NC+S +EG++ F Y+   +++G+CD+    I++CQ  G+  L  N  F + +  C  +    +G           + C G W   + + +       + +  +YRC +   D         G+S  A C +L++    +P R++  P     ++   +EPGC LP NF+G W   +  + +V I+ THI      D+ +Y +  +VCR+ + NR +MA +T   C  D+ CF F+PRHHNIIR+R G     ++              F   C W  F  N   W Y+ F+   PVPV CP+ G++ F Q G  E  + T++ GG+T  PR ++ C K+  SDL+ C  + K+L +D   C+ +D  GRP+  Y   D R+ C+G+W E+ KS+LITYD  DP +  +RCWVY+R +L+   MS++  + C   Q   S     GA++ ++  + E E D CPM FDDG NP+      N+  + D ++     L F
Sbjct:   40 FSWETGLPTLTVIDATSMSSR-----GYCI------NYMRHKGDEYSFVFKERSKDCYHCVRTIIRTLNVFE---KFEGPCVGIPAGQEPTVDYVCRGVKDDQQLITLFNENFVPINCRSSLEGVWHFTYQNRFRFTGVCDKPDARIQSCQTAGTQFLIQNQKFNVTYQQCEGMEGTFTG--------TVEFSCLGDWFVGKNHYFAVANTKESRKDEKYRCFLKNRDDDLYV----GVSITAECNTLKTPET-SPERLKLTP-----VKAEFVEPGCTLPQNFSGEWVNTANIDADVSISETHINETYYPDKARYRKTIYVCRERRGNRVMMARLTVDGCQKDYVCFDFMPRHHNIIRYRKGLAVIKDD--------------FSTVCSWVQFP-NSEAWKYDLFLARNPVPVRCPVAGKFNFTQRG--EHPFRTRILGGVTLSPRPDIHC-KQNISDLSVCDTDQKELAVDENYCLSVDHLGRPVDIYSDPDYRMKCIGFWKENLKSYLITYDDLDP-LSKYRCWVYQRADLNRVLMSQAVGAFCKLEQDVTSWNHSEGAAVAIDAVEYERERDDCPMHFDDGLNPWKPSDASNIIFDWDFYRAGAATLKF 601          
BLAST of Actin cytoplasmic type 5 vs. Ensembl Fly
Match: udt (gene:FBgn0039113 transcript:FBtr0084465)

HSP 1 Score: 277.33 bits (708), Expect = 1.075e-83
Identity = 179/613 (29.20%), Postives = 293/613 (47.80%), Query Frame = 2
Query:  182 FSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXXXXXXXXXXXXXXMGFETGFVRSKSQQLDF--------NCKSIIEGIYQFNYK-LTKYSGICDRGSNLIKACQKQGSP-LRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTF 1990
            FS E G  T+T I +  + S      G C+      N +     +   ++  ++ +C+ C R I R+L V +                  ++ +    V+   Q +          NC+S +EG++ F Y+   +++G+CD+    I++CQ  G+  L  N  F + +  C  +    +G           + C G W   + + +       + +  +YRC +   D         G+S  A C +L++    +P R++  P     ++   +EPGC LP NF+G W   +  + +V I+ THI      D+ +Y +  +VCR+ + NR +MA +T   C  D+ CF F+PRHHNIIR+R G     ++              F   C W  F  N   W Y+ F+   PVPV CP+ G++ F Q G  E  + T++ GG+T  PR ++ C K+  SDL+ C  + K+L +D   C+ +D  GRP+  Y   D R+ C+G+W E+ KS+LITYD  DP +  +RCWVY+R +L+   MS++  + C   Q   S     GA++ ++  + E E D CPM FDDG NP+      N+  + D ++     L F
Sbjct:   40 FSWETGLPTLTVIDATSMSSR-----GYCI------NYMRHKGDEYSFVFKERSKDCYHCVRTIIRTLNVFE---KFEGPCVGIPAGQEPTVDYVCRGVKDDQQLITLFNENFVPINCRSSLEGVWHFTYQNRFRFTGVCDKPDARIQSCQTAGTQFLIQNQKFNVTYQQCEGMEGTFTG--------TVEFSCLGDWFVGKNHYFAVANTKESRKDEKYRCFLKNRDDDLYV----GVSITAECNTLKTPET-SPERLKLTP-----VKAEFVEPGCTLPQNFSGEWVNTANIDADVSISETHINETYYPDKARYRKTIYVCRERRGNRVMMARLTVDGCQKDYVCFDFMPRHHNIIRYRKGLAVIKDD--------------FSTVCSWVQFP-NSEAWKYDLFLARNPVPVRCPVAGKFNFTQRG--EHPFRTRILGGVTLSPRPDIHC-KQNISDLSVCDTDQKELAVDENYCLSVDHLGRPVDIYSDPDYRMKCIGFWKENLKSYLITYDDLDP-LSKYRCWVYQRADLNRVLMSQAVGAFCKLEQDVTSWNHSEGAAVAIDAVEYERERDDCPMHFDDGLNPWKPSDASNIIFDWDFYRAGAATLKF 601          
BLAST of Actin cytoplasmic type 5 vs. TrEMBL
Match: A0A3Q0KIW4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 336/616 (54.55%), Postives = 439/616 (71.27%), Query Frame = 2
Query:  134 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSI--ENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXX-----XXXXXXXXXXXXMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYI-PYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITK-QSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANA 1954
            +++  C I   +V  +FS+E G+ET T I    L+   +   G+C  I  ENT +  VE   DI V+Y N T +CFFCY FI RS  V+QY  ++CQ     S+   +C SL +   ETGFVRS+    DFNCKSIIEG+Y F+Y++   +G+C    +LIKACQ+QGSPLRDN++    F  CP         D   +      W+CYGRW D    IW AI +DTN+ +FRYRC+ TRIDQQ+      WG+S++++CK L +   +APIR+E +PAFDP+ Q+ E++PGCKLPTNF+G WFYPSEY T V IN+THIY KR+     YD I+FVCRQ QE+RYLM  +T GKC+ DF C  F+PRHHNIIRFRMGRPF +  R+R S   +YM R++RE+CHW+SFTLNY++W YEYF+ DPP P+NCPIQG++ F Q GQ++E Y TK+PGGMTPRP ++VLC   WES++ AC  +PK L LDV++C RLDF+G+P+SEY++ DN +TCVGYWMEDTKSFL+TYD EDPV ++FRCW+Y+R+    Y MSR + + CSKIQTA+SS PE GASLLLELT++E +FD CPMS+DDG NPYANPA+ +VYA+ 
Sbjct:   17 ETEGTCEIPAKYVKTLFSIENGKETTTQILKSQLIQTLESLWGSCHMIVSENTNSDAVE---DIVVLYKNMTKDCFFCYDFIFRSPNVLQYRRSQCQRPEFGSNESTICGSLAASELETGFVRSREDYSDFNCKSIIEGVYAFDYRIVGSTGLCSSPFSLIKACQRQGSPLRDNSILEQTFGYCPNFQDQSILEDPNIVFGKANIWRCYGRWTDKSGTIWAAIAYDTNQLRFRYRCLTTRIDQQNPQDIYYWGMSTNSDCKVLYN-YNNAPIRLELRPAFDPESQLSELQPGCKLPTNFSGHWFYPSEYQTSVDINATHIYMKRKQANFLYDHIYFVCRQQQESRYLMTVITLGKCETDFMCMDFMPRHHNIIRFRMGRPFPLLHRERHSMGASYMQRLYREACHWSSFTLNYIEWTYEYFVQDPPTPINCPIQGKFKFIQRGQEQEKYITKIPGGMTPRPWVQVLCYNYWESNIEACLNDPKTLQLDVQKCWRLDFSGQPISEYNVVDNYMTCVGYWMEDTKSFLVTYDKEDPVSNNFRCWIYKRLSFRTYLMSRGRGNRCSKIQTAESSLPEEGASLLLELTEDEYQFDVCPMSWDDGRNPYANPAILDVYASG 628          
BLAST of Actin cytoplasmic type 5 vs. TrEMBL
Match: G4VLR1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_087870 PE=4 SV=1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 336/616 (54.55%), Postives = 439/616 (71.27%), Query Frame = 2
Query:  134 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSI--ENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXX-----XXXXXXXXXXXXMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYI-PYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITK-QSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANA 1954
            +++  C I   +V  +FS+E G+ET T I    L+   +   G+C  I  ENT +  VE   DI V+Y N T +CFFCY FI RS  V+QY  ++CQ     S+   +C SL +   ETGFVRS+    DFNCKSIIEG+Y F+Y++   +G+C    +LIKACQ+QGSPLRDN++    F  CP         D   +      W+CYGRW D    IW AI +DTN+ +FRYRC+ TRIDQQ+      WG+S++++CK L +   +APIR+E +PAFDP+ Q+ E++PGCKLPTNF+G WFYPSEY T V IN+THIY KR+     YD I+FVCRQ QE+RYLM  +T GKC+ DF C  F+PRHHNIIRFRMGRPF +  R+R S   +YM R++RE+CHW+SFTLNY++W YEYF+ DPP P+NCPIQG++ F Q GQ++E Y TK+PGGMTPRP ++VLC   WES++ AC  +PK L LDV++C RLDF+G+P+SEY++ DN +TCVGYWMEDTKSFL+TYD EDPV ++FRCW+Y+R+    Y MSR + + CSKIQTA+SS PE GASLLLELT++E +FD CPMS+DDG NPYANPA+ +VYA+ 
Sbjct:   18 ETEGTCEIPAKYVKTLFSIENGKETTTQILKSQLIQTLESLWGSCHMIVSENTNSDAVE---DIVVLYKNMTKDCFFCYDFIFRSPNVLQYRRSQCQRPEFGSNESTICGSLAASELETGFVRSREDYSDFNCKSIIEGVYAFDYRIVGSTGLCSSPFSLIKACQRQGSPLRDNSILEQTFGYCPNFQDQSILEDPNIVFGKANIWRCYGRWTDKSGTIWAAIAYDTNQLRFRYRCLTTRIDQQNPQDIYYWGMSTNSDCKVLYN-YNNAPIRLELRPAFDPESQLSELQPGCKLPTNFSGHWFYPSEYQTSVDINATHIYMKRKQANFLYDHIYFVCRQQQESRYLMTVITLGKCETDFMCMDFMPRHHNIIRFRMGRPFPLLHRERHSMGASYMQRLYREACHWSSFTLNYIEWTYEYFVQDPPTPINCPIQGKFKFIQRGQEQEKYITKIPGGMTPRPWVQVLCYNYWESNIEACLNDPKTLQLDVQKCWRLDFSGQPISEYNVVDNYMTCVGYWMEDTKSFLVTYDKEDPVSNNFRCWIYKRLSFRTYLMSRGRGNRCSKIQTAESSLPEEGASLLLELTEDEYQFDVCPMSWDDGRNPYANPAILDVYASG 629          
BLAST of Actin cytoplasmic type 5 vs. TrEMBL
Match: A0A0X3PZD8 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR149706 PE=4 SV=1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 328/613 (53.51%), Postives = 427/613 (69.66%), Query Frame = 2
Query:  149 CTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXXXXXXXXXXXX-----XXMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFT-WKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQ---DITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADK 1960
            C++   +    +S+E G+ET T I +  L  D  + DG+C  I N T         + ++Y NKTN+C+FCY  I RS  V+QY  ++CQ       +S        +  ETGFV ++    DFNCKSIIEG+Y F Y++   +G+C   ++++KACQ+QGSPLRDN+V+   F  CP         +   +    T W+CY RWVD +  +W A+E+DTN  KF+YRC+ TRIDQQ   DI +  WG++ DA+CK+L+     APIR+  +PAFD   Q+ EM+P CKLPTN +G WFYPSEY T VKINSTHIY +RR D   +++I+FVCRQ Q +RYLMA VTKG+C++D  CF  +PRHHNI RFRMGRPF ++ R + +   +YM R+F+E+CHW+SFTLNY++W YEYF+LDPPVP+NCPIQG++ F QTGQ+ E Y  KMP GMTPRP L+VLC   W+S++ AC E+PK L LDVE+C RLDF G P+SEY++ DN ++CVGYWMEDTKS+LITYD EDPV + FRCWVYRR+ L  Y MSRS  + C K+QTA+SS PE GASL LELT+NE EFD CPM+FDDG NPYANPAV NVYA   +
Sbjct:   38 CSVSRLYRKTFYSIENGRETTTRIMASELTQDIDRLDGSCYQILNITTMETAKKDSMKIVYKNKTNDCYFCYELISRSENVIQYRRSQCQPIQSGSSTSSICDLITGVELETGFVMARQDYSDFNCKSIIEGVYAFEYRIVGSTGMCRSPNSILKACQRQGSPLRDNSVYEQTFGYCPNFLEKSVLEEPNIVYGKATLWRCYARWVDDEGTVWAAVEYDTNMPKFKYRCLTTRIDQQNRQDIIQ--WGMTVDADCKNLKD-YFSAPIRLVLEPAFDTATQLIEMQPSCKLPTNISGDWFYPSEYQTSVKINSTHIYMRRRKDSYTFEDIYFVCRQQQLSRYLMAVVTKGQCEIDLMCFELMPRHHNIARFRMGRPFPLDPRTKAALGADYMLRMFKEACHWSSFTLNYIEWTYEYFVLDPPVPINCPIQGKFQFIQTGQEAEKYVFKMPRGMTPRPWLQVLCYDYWQSNMEACLEDPKILKLDVEQCWRLDFAGHPISEYNVPDNYISCVGYWMEDTKSYLITYDREDPVTNRFRCWVYRRLSLRTYAMSRSLGNQCGKMQTAESSLPEEGASLRLELTENEYEFDVCPMAFDDGKNPYANPAVLNVYAPGSR 647          
BLAST of Actin cytoplasmic type 5 vs. TrEMBL
Match: A0A183K1H1 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS8834 PE=4 SV=1)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 335/616 (54.38%), Postives = 438/616 (71.10%), Query Frame = 2
Query:  134 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSI--ENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXX-----XXXXXXXXXXXXMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYI-PYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITK-QSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANA 1954
            +++  C I   +V  +FS+E G+ET T I    L+   +   G+C  I  ENT +  VE   DI V+Y N T +CFFCY FI RS  V+QY  ++CQ     S+   +C SL +   ETGFVRS+    DFNCKSIIEG++ F+Y++   +G+C    +LIKACQ+QGSPLRDN++    F  CP         D   +      W+CYGRW D    IW AI +DTN+ +FRYRC+ TRIDQQ+      WG+S++++CK L +   +APIR+E +PAFDP  Q+ E++PGCKLPTNF+G WFYPSEY T V IN+THIY KR+     YD I+FVCRQ QE+RYLM  +T GKC+ DF C  F+PRHHNIIRFRMGRPF +  R+R S   +YM R++RE+CHW+SFTLNY++W YEYF+ DPP P+NCPIQG++ F Q GQ++E Y TK+PGGMTPRP ++VLC   WES++ AC  +PK L LDV++C RLDF+G+P+SEY++ DN +TCVGYWMEDTKSFL+TYD EDPV ++FRCW+Y+R+    Y MSR + + CSKIQTA+SS PE GASLLLELT++E +FD CPMS+DDG NPYANPA+ +VYA+ 
Sbjct:   18 ETEGTCEIPAKYVKTLFSIENGKETTTQILKSQLIQTLESLWGSCHMIVSENTNSDAVE---DIVVVYKNMTKDCFFCYDFIFRSPNVIQYRRSQCQRPEFGSNESTICGSLATSELETGFVRSREDYSDFNCKSIIEGVFAFDYRIVGSTGLCSSPFSLIKACQRQGSPLRDNSILEQTFGYCPNFQDQSILEDPNIVFGKANIWRCYGRWTDKSGTIWAAIAYDTNQLRFRYRCLTTRIDQQNPQDIYYWGMSTNSDCKVLYN-YNNAPIRLELRPAFDPTSQLSELQPGCKLPTNFSGHWFYPSEYQTSVDINATHIYMKRKQANFLYDHIYFVCRQQQESRYLMTVITLGKCETDFMCMDFMPRHHNIIRFRMGRPFPLLHRERHSMGASYMQRLYREACHWSSFTLNYIEWTYEYFVQDPPTPINCPIQGKFKFIQRGQQQEKYITKIPGGMTPRPWVQVLCYNYWESNIEACLNDPKTLQLDVQKCWRLDFSGQPISEYNVVDNYITCVGYWMEDTKSFLVTYDKEDPVSNNFRCWIYKRLSFRTYLMSRGRGNRCSKIQTAESSLPEEGASLLLELTEDEYQFDVCPMSWDDGRNPYANPAILDVYASG 629          
BLAST of Actin cytoplasmic type 5 vs. TrEMBL
Match: A0A0R3SQX1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7505 PE=3 SV=1)

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 327/611 (53.52%), Postives = 429/611 (70.21%), Query Frame = 2
Query:  149 CTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXXXXXXXXXXXX-----XXMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTI--NPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQ---DITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAEN-YMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYA 1948
            C++   +V  ++S+E G+ TIT IK+  L  D  + +G C  I  TT         I VIY N+TN+C+FCY  I RS  V+QY  ++CQ       ++        +  ETGF+ S+ Q  DFNCKSIIEGIY F Y++   +G+C   +N++KACQ+QGSPLRDN+V+   F  CP           +I Y   +  W+CY RWV     +W A+E+DTN  KF+YRC+ TRIDQQ   DI +  WG++ DA+CK+L++    APIR+  +PAFDP+ Q+ EM+P CKLPTN++G WFYPSEY T V INSTHIY +R+ D   Y++I+FVCRQ Q +RYLMA VT+G+C++DF CF  +PRHHNI RFRMGRPF +    + S  E+ YM R+++E+CHW+SFTLNY++W YEYF+LDPPVP+NCPIQG+Y F QTGQ+ E Y  KMP GMTPRP L+VLC   W++++ AC  +PK L LDV++C RLDF GRP+SEYD+ DN + CVG+WMEDTKS+LITYD EDPV + FRCWVY+R+ L  + MSRS  + C K+QTA+SS PE GASL LELT++E EFD CPM++DDG NPY NPAV NVYA
Sbjct:   23 CSLPSIYVKTLYSIENGKGTITTIKASELSQDIDRLNGTCYQILQTTTVEANKTDSINVIYKNRTNDCYFCYELIARSENVIQYRRSQCQPVLAGHRATEICDLITGVELETGFINSREQYSDFNCKSIIEGIYSFEYRIVGSTGVCRSPNNILKACQRQGSPLRDNSVYEQTFGFCPNFFETSVLQEPNIVYGKSNI-WRCYARWVADDGTVWAAVEYDTNMPKFKYRCLTTRIDQQNRQDIIQ--WGMTVDADCKNLKN-YFTAPIRLILEPAFDPETQLVEMQPTCKLPTNYSGNWFYPSEYQTSVHINSTHIYMRRKKDDYTYEDIYFVCRQQQLSRYLMAVVTRGQCEIDFMCFELIPRHHNIARFRMGRPFPLEPLVKSSLGESEYMLRMYKEACHWSSFTLNYIEWTYEYFVLDPPVPINCPIQGKYKFVQTGQEAEHYVFKMPNGMTPRPWLQVLCFSYWQTNIEACLNDPKILKLDVQKCWRLDFAGRPISEYDVTDNYIACVGFWMEDTKSYLITYDLEDPVSNRFRCWVYQRLSLRSFSMSRSLGNRCGKMQTAESSLPEEGASLRLELTEDEYEFDVCPMNYDDGRNPYVNPAVLNVYA 629          
BLAST of Actin cytoplasmic type 5 vs. Planmine SMEST
Match: SMESG000080982.1 (SMESG000080982.1)

HSP 1 Score: 1279.23 bits (3309), Expect = 0.000e+0
Identity = 625/627 (99.68%), Postives = 626/627 (99.84%), Query Frame = 2
Query:  134 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXXXXXXXXXXXXXXMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTFGVLTWFFY 2014
            KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTECQSSSENLCSSLNSMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRL+VLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTF VLTWFFY
Sbjct:   16 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTECQSSSENLCSSLNSMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLQVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTFCVLTWFFY 642          
BLAST of Actin cytoplasmic type 5 vs. Planmine SMEST
Match: SMESG000080982.1 (SMESG000080982.1)

HSP 1 Score: 1174.07 bits (3036), Expect = 0.000e+0
Identity = 585/627 (93.30%), Postives = 587/627 (93.62%), Query Frame = 2
Query:  134 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXXXXXXXXXXXXXXMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQENRYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTFGVLTWFFY 2014
            KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTECQSSSENLCSSLNSMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVK                    FF+                   DLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRL+VLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTF VLTWFFY
Sbjct:   16 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTECQSSSENLCSSLNSMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTEVK--------------------FFILFS----------------DLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAENYMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQKEELYYTKMPGGMTPRPRLQVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTFCVLTWFFY 606          
BLAST of Actin cytoplasmic type 5 vs. Planmine SMEST
Match: SMESG000080969.1 (SMESG000080969.1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 303/303 (100.00%), Postives = 303/303 (100.00%), Query Frame = 2
Query:  134 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTXXXXXXXXXXXXXXXMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTE 1042
            KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTECQSSSENLCSSLNSMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTE
Sbjct:   16 KSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLVSDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLYVMQYSHTECQSSSENLCSSLNSMGFETGFVRSKSQQLDFNCKSIIEGIYQFNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADSGGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQQDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCKLPTNFTGVWFYPSEYNTE 318          

HSP 2 Score: 389.808 bits (1000), Expect = 7.146e-128
Identity = 184/193 (95.34%), Postives = 186/193 (96.37%), Query Frame = 2
Query: 1436 QKEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTFGVLTWFFY 2014
            +K+     K  GGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTFGVLTWFFY
Sbjct:  336 KKKNCITQKCQGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMRLDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVYRRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACPMSFDDGTNPYANPAVFNVYANADKHKYSQILLTFGVLTWFFY 528          

HSP 3 Score: 63.1586 bits (152), Expect = 4.299e-10
Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 3
Query: 1383 QFLLIAQYKDGTCLSKRVKKKNCITQKCQG 1472
            +FLLIAQYKDGTCLSKRVKKKNCITQKCQG
Sbjct:  318 EFLLIAQYKDGTCLSKRVKKKNCITQKCQG 347          
The following BLAST results are available for this feature:
BLAST of Actin cytoplasmic type 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
udt1.075e-8329.20gene:FBgn0039113 transcript:FBtr0084464[more]
udt1.075e-8329.20gene:FBgn0039113 transcript:FBtr0084465[more]
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KIW40.000e+054.55Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
G4VLR10.000e+054.55Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0X3PZD80.000e+053.51Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A183K1H10.000e+054.38Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A0R3SQX10.000e+053.52Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin cytoplasmic type 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000080982.10.000e+099.68SMESG000080982.1[more]
SMESG000080982.10.000e+093.30SMESG000080982.1[more]
SMESG000080969.17.146e-128100.00SMESG000080969.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015473 ID=SMED30015473|Name=Actin cytoplasmic type 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2100bp
AACTGAACATTTTTTTTAAACACTATTTGTTTAAATCTGTCAAATAATTG
AACATAAGTTAAATTATTTGAAAACAAGGAAATTTATAATGTTTATATAT
ATTTCAATTGCTTATGCTATTTTTTTTATTGCTAAATCACAGCCACAATG
TACTATACGACCAGATCACGTTATGATGATATTTTCATTAGAGGGAGGAC
AAGAAACTATAACAGATATCAAATCACAATTTTTAGTTTCCGATACTAAA
AAATTTGATGGGGCCTGTGTTAGTATAGAAAACACAACAAATCCACTTGT
TGAATCGAATACGGATATTGGAGTTATTTATTTAAATAAAACGAACAATT
GTTTTTTTTGTTATCGATTTATCCAAAGAAGCTTGTATGTTATGCAATAC
TCACATACTGAGTGTCAATCCAGCTCTGAAAATCTTTGCAGTTCTTTAAA
CAGCATGGGATTTGAGACTGGATTTGTTAGGTCTAAATCACAACAGTTAG
ATTTCAATTGTAAAAGTATTATTGAAGGCATATATCAATTCAATTATAAG
CTGACTAAATATTCTGGAATTTGTGACCGAGGGTCAAATTTAATTAAAGC
TTGTCAAAAACAAGGCTCTCCTCTGAGAGATAATAACGTTTTTTACATGA
AATTTGATTTATGCCCAACTATAAATCCAGCTGATAGTGGTGGAGATATA
AAGTATATACCATATGATTTTACTTGGAAATGCTATGGCAGGTGGGTTGA
TCCCCAAAAAAATATATGGGGAGCTATTGAATTTGATACAAATGAAGAAA
AGTTCCGCTATCGTTGCATAATCACTCGTATTGATCAACAAGATATTACT
AAACAGTCATGGGGAATAAGTTCAGATGCCAATTGTAAAAGTTTAGAGTC
AGGAATAATTGATGCACCAATTCGAATAGAAACTAAACCAGCTTTTGATC
CAGATATCCAAATTCGAGAAATGGAACCTGGATGCAAATTACCTACTAAC
TTTACAGGAGTTTGGTTTTATCCTAGTGAATACAATACAGAGGTAAAAAT
TAATTCTACTCATATATATTACAAAAGAAGAATCGATCAAACAAAATACG
ATGAAATATTTTTTGTATGTAGGCAGTTTCAAGAAAATAGATATTTAATG
GCTACTGTAACTAAAGGAAAATGTGATCTTGATTTCACTTGTTTCCATTT
TCTACCACGACATCACAACATCATTCGTTTCCGAATGGGGCGGCCTTTTC
GCATGAATGAACGAGATCGATTGAGCAATGCAGAAAATTACATGAATAGA
GTTTTTCGGGAATCTTGTCATTGGAATTCGTTTACTTTGAATTATGTTGA
TTGGGTCTATGAATATTTTATTTTGGATCCTCCAGTTCCTGTTAATTGCC
CAATACAAGGACGGTACATGTTTAAGCAAACGGGTCAAAAAGAAGAATTG
TATTACACAAAAATGCCAGGGGGTATGACTCCAAGACCACGTCTAGAAGT
TCTTTGTGACAAAAAGTGGGAATCTGATCTTGCTGCTTGCTATGAAAATC
CAAAACAGTTAAATCTTGATGTCGAGCGATGTATGCGATTAGATTTTACT
GGTCGTCCAATGTCGGAATATGATATTGCCGATAATAGATTGACTTGCGT
TGGGTATTGGATGGAAGATACGAAATCTTTTCTTATTACCTACGATCCCG
AAGATCCAGTTATTCACCATTTTCGATGCTGGGTTTATCGACGAATAGAA
TTAAGCTACTATAAGATGTCTAGAAGTCAAAGCTCACACTGTAGTAAAAT
TCAAACTGCAGATTCATCGGGGCCTGAAACAGGTGCATCTTTACTTTTAG
AGTTAACACAAAATGAATTAGAATTTGATGCTTGTCCGATGTCATTTGAT
GACGGCACAAATCCATATGCTAATCCCGCTGTTTTCAACGTTTATGCTAA
TGCAGATAAACATAAATATTCTCAAATTTTACTAACATTTGGCGTTCTTA
CTTGGTTTTTTTACTGATTAATTTTTATCTCTTAAATGGCTGTGAATTGT
GAAACTATTCTGTATCTTTTTTATTATGTAAATGAATGTGAATTATTTGT
back to top

protein sequence of SMED30015473-orf-1

>SMED30015473-orf-1 ID=SMED30015473-orf-1|Name=SMED30015473-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=643bp
MFIYISIAYAIFFIAKSQPQCTIRPDHVMMIFSLEGGQETITDIKSQFLV
SDTKKFDGACVSIENTTNPLVESNTDIGVIYLNKTNNCFFCYRFIQRSLY
VMQYSHTECQSSSENLCSSLNSMGFETGFVRSKSQQLDFNCKSIIEGIYQ
FNYKLTKYSGICDRGSNLIKACQKQGSPLRDNNVFYMKFDLCPTINPADS
GGDIKYIPYDFTWKCYGRWVDPQKNIWGAIEFDTNEEKFRYRCIITRIDQ
QDITKQSWGISSDANCKSLESGIIDAPIRIETKPAFDPDIQIREMEPGCK
LPTNFTGVWFYPSEYNTEVKINSTHIYYKRRIDQTKYDEIFFVCRQFQEN
RYLMATVTKGKCDLDFTCFHFLPRHHNIIRFRMGRPFRMNERDRLSNAEN
YMNRVFRESCHWNSFTLNYVDWVYEYFILDPPVPVNCPIQGRYMFKQTGQ
KEELYYTKMPGGMTPRPRLEVLCDKKWESDLAACYENPKQLNLDVERCMR
LDFTGRPMSEYDIADNRLTCVGYWMEDTKSFLITYDPEDPVIHHFRCWVY
RRIELSYYKMSRSQSSHCSKIQTADSSGPETGASLLLELTQNELEFDACP
MSFDDGTNPYANPAVFNVYANADKHKYSQILLTFGVLTWFFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR22255:SF1LD32918Pcoord: 32..635
NoneNo IPR availablePANTHERPTHR22255UNCHARACTERIZEDcoord: 32..635
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.509