T-complex protein 1 subunit delta

Overview
NameT-complex protein 1 subunit delta
Smed IDSMED30015458
Length (bp)1843
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015458

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30015458SMESG000060610.1 MF669565.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30015458SMESG000060610.1 MF669565.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogonial stem cellSMED30015458SMESG000060610.1 MF669565.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30015458SMESG000060610.1 MF669565.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30015458SMESG000060610.1 MF669565.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
reproductive organSMED30015458SMESG000060610.1 Contig40358newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015458SMESG000060610.1 Contig40358uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015458SMESG000060610.1 Contig52781newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015458SMESG000060610.1 Contig52781uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30015458SMESG000060610.1 PL08001B2D05ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30015458SMESG000060610.1 Contig4314_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testisSMED30015458SMESG000060610.1 PL08001B2D05_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30015458SMESG000060610.1 PL08001B2D05_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30015458SMESG000060610.1 PL08001B2D05_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-complex protein 1 subunit delta vs. Ensembl Human
Match: CCT4 (chaperonin containing TCP1 subunit 4 [Source:HGNC Symbol;Acc:HGNC:1617])

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 331/508 (65.16%), Postives = 420/508 (82.68%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAARMLVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS PV+L+DR  LL  A+TSLNSKVVSQYSS+LSP++V+AV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V S   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM++K I +E +EFICKTIG KP+A+++ F A+ LG A+  EEV + G+ +++ +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   30 PAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKV-SNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVV 536          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Human
Match: CCT4 (chaperonin containing TCP1 subunit 4 [Source:HGNC Symbol;Acc:HGNC:1617])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 306/508 (60.24%), Postives = 390/508 (76.77%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKM                              LVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS PV+L+DR  LL  A+TSLNSKVVSQYSS+LSP++V+AV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V S   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM++K I +E +EFICKTIG KP+A+++ F A+ LG A+  EEV + G+ +++ +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   30 PAQIRFSNISAAKAVADAIRTSLGPKGMDKM------------------------------LVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKV-SNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVV 506          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 317.775 bits (813), Expect = 9.579e-101
Identity = 194/505 (38.42%), Postives = 301/505 (59.60%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGM--SCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEH--HYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA-GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            S+I+AAKAVA+ +RTSLGP G+DKM+ +  GDVT+TNDGATIL  M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL +GIHP  I+D +  AA  A E ++ +  S  VD+ D   L++ A T+L SKVV+     ++ IAV+AVL + D    + V+ + + +  K+GG +EDT+L+ G+I+D+          VE+AKI  +     PPK + +  + V+       + K E++   E++++IK +G N+ + Q         D A H   + N+  V+ +   ++E I    G + +       AE LGFA  V+E+  G ++   +  IE   + + V+I +RG NK++++EA+RSLHDALCV+R L++   +V GGGA EI     ++  ++      QY  RAFADA++VIP  L+EN+G+NPI+T+TE+R         A GI+       ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   15 SHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRD-VDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQW-----GFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLV-IEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDI 512          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 317.39 bits (812), Expect = 2.018e-100
Identity = 195/508 (38.39%), Postives = 303/508 (59.65%), Query Frame = 1
Query:  163 NSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGM--SCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEH--HYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINI---KKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
             S+I+AAKAVA+ +RTSLGP G+DKM+ +  GDVT+TNDGATIL  M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL +GIHP  I+D +  AA  A E ++ +  S  VD+ D   L++ A T+L SKVV+     ++ IAV+AVL + D    + V+ + + +  K+GG +EDT+L+ G+I+D+          VE+AKI  +     PPK + +  + V+       + K E++   E++++IK +G N+ + Q         D A H   + N+  V+ +   ++E I    G + +       AE LGFA  V+E+  G ++   +  IE   + + V+I +RG NK++++EA+RSLHDALCV+R L++   +V GGGA EI     ++  ++      QY  RAFADA++VIP  L+EN+G+NPI+T+TE+R       +N  + I    KG   ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   35 KSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRD-VDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQW-----GFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLV-IEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTN-DMKQQHVIETLIGKKQQISLATQMVRMILKIDDI 533          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Human
Match: CCT5 (chaperonin containing TCP1 subunit 5 [Source:HGNC Symbol;Acc:HGNC:1618])

HSP 1 Score: 313.923 bits (803), Expect = 1.384e-99
Identity = 192/502 (38.25%), Postives = 298/502 (59.36%), Query Frame = 1
Query:  175 LAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGM--SCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEH--HYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA-GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            +AAKAVA+ +RTSLGP G+DKM+ +  GDVT+TNDGATIL  M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL +GIHP  I+D +  AA  A E ++ +  S  VD+ D   L++ A T+L SKVV+     ++ IAV+AVL + D    + V+ + + +  K+GG +EDT+L+ G+I+D+          VE+AKI  +     PPK + +  + V+       + K E++   E++++IK +G N+ + Q         D A H   + N+  V+ +   ++E I    G + +       AE LGFA  V+E+  G ++   +  IE   + + V+I +RG NK++++EA+RSLHDALCV+R L++   +V GGGA EI     ++  ++      QY  RAFADA++VIP  L+EN+G+NPI+T+TE+R         A GI+       ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:    1 MAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRD-VDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQW-----GFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLV-IEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDI 495          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Celegans
Match: cct-4 (T-complex protein 1 subunit delta [Source:UniProtKB/Swiss-Prot;Acc:P47208])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 306/508 (60.24%), Postives = 414/508 (81.50%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGA-SRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            P ++RNSNI+AAKAVADA+RTSLGP+GMDKMIQ G GDVTITNDGATIL +M ++HP A+MLVELSKAQDIEAGDGTTTVVV+AG+ LDA   LLSKGIHPTTIS+SF  AA++A +I++ MS PVDL++   L K+A+TSLNSKVVSQ+S +L+P+AV+AV +I +    + VNL  + I+ K+G TVE++EL++G +ID++         +E AKIG IQF I+PPK +ME  ++++DY QMDR LK+ER+Y+LEI K+IKA+GCNVLL+QK++LRD+V++LALHF  KM IM +K I +E +EF  + +GC+P+A+V++FNA+ LG+A  VEE+P G   +++ VTG+++    VSILLRGSNKLVL+EA+RS+HDALCV+RCLVKKKAL+ GGGAPE+E+  K+   + +  G +QYC+RAFADA+++IPYTLAENAGL+PI TVTELR+ HANG+ + G+N++KG V ++++EDV+QPLLV+ +A+  A+E V SILKIDD+V
Sbjct:   29 PESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGDVTITNDGATILNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQSAAAEAEKILDEMSSPVDLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKIINSENDSNVNLKMIKIIKKMGDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPKTDMENQVIITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFLAKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTGVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRNLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRKGYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIV 536          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Celegans
Match: cct-4 (T-complex protein 1 subunit delta [Source:UniProtKB/Swiss-Prot;Acc:P47208])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 306/508 (60.24%), Postives = 414/508 (81.50%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGA-SRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            P ++RNSNI+AAKAVADA+RTSLGP+GMDKMIQ G GDVTITNDGATIL +M ++HP A+MLVELSKAQDIEAGDGTTTVVV+AG+ LDA   LLSKGIHPTTIS+SF  AA++A +I++ MS PVDL++   L K+A+TSLNSKVVSQ+S +L+P+AV+AV +I +    + VNL  + I+ K+G TVE++EL++G +ID++         +E AKIG IQF I+PPK +ME  ++++DY QMDR LK+ER+Y+LEI K+IKA+GCNVLL+QK++LRD+V++LALHF  KM IM +K I +E +EF  + +GC+P+A+V++FNA+ LG+A  VEE+P G   +++ VTG+++    VSILLRGSNKLVL+EA+RS+HDALCV+RCLVKKKAL+ GGGAPE+E+  K+   + +  G +QYC+RAFADA+++IPYTLAENAGL+PI TVTELR+ HANG+ + G+N++KG V ++++EDV+QPLLV+ +A+  A+E V SILKIDD+V
Sbjct:   29 PESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGDVTITNDGATILNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQSAAAEAEKILDEMSSPVDLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKIINSENDSNVNLKMIKIIKKMGDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPKTDMENQVIITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFLAKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTGVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRNLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRKGYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIV 536          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 323.168 bits (827), Expect = 5.263e-103
Identity = 192/505 (38.02%), Postives = 306/505 (60.59%), Query Frame = 1
Query:  163 NSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKD-ERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEH--HYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
             S+ILAA+AVA+ +RTSLGP+G+DKM+    GDVTITNDGATI+++M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   KL+ +GIHP  I+D F+LA  KA E ++ +S    + +R  L++ A TSL SK+V++     + IAVDAVL + D    + VN + + +  K+GG +EDT LV G++ID+ +        ++NAK+  +     PPK + +  + ++  T+  + L+D ER+    +++++K SG  + + Q         D A H     ++  V+ +   ++E +      + +      + E LG A  V E+  GA++   +  IE   + + V+I +RG NK+++DEA+R+LHDALCV+R LV+   +V GGG+ E+    ++A  ++ + G  QY FRAFADA++ IP  LAEN+GL PI+ +++L+      G  + GI+       ++ ++ V++ LL     +SLA + V  ILKIDDV
Sbjct:   36 KSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDSISDKFPVENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIESKD-VNFEMIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITS-TEDFKALRDYERETFETMIRQVKESGATLAICQWG-----FDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAK-DRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDV 532          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 323.168 bits (827), Expect = 5.263e-103
Identity = 192/505 (38.02%), Postives = 306/505 (60.59%), Query Frame = 1
Query:  163 NSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKD-ERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEH--HYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
             S+ILAA+AVA+ +RTSLGP+G+DKM+    GDVTITNDGATI+++M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   KL+ +GIHP  I+D F+LA  KA E ++ +S    + +R  L++ A TSL SK+V++     + IAVDAVL + D    + VN + + +  K+GG +EDT LV G++ID+ +        ++NAK+  +     PPK + +  + ++  T+  + L+D ER+    +++++K SG  + + Q         D A H     ++  V+ +   ++E +      + +      + E LG A  V E+  GA++   +  IE   + + V+I +RG NK+++DEA+R+LHDALCV+R LV+   +V GGG+ E+    ++A  ++ + G  QY FRAFADA++ IP  LAEN+GL PI+ +++L+      G  + GI+       ++ ++ V++ LL     +SLA + V  ILKIDDV
Sbjct:   36 KSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDSISDKFPVENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIESKD-VNFEMIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITS-TEDFKALRDYERETFETMIRQVKESGATLAICQWG-----FDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAK-DRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDV 532          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Celegans
Match: cct-2 (T-complex protein 1 subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P47207])

HSP 1 Score: 271.937 bits (694), Expect = 1.257e-83
Identity = 180/513 (35.09%), Postives = 286/513 (55.75%), Query Frame = 1
Query:  160 RNSNILAAKAVADAIRTSLGPKGMDKMI----QEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLK------DERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            R S+ + A A+ D ++++LGPKGMDK++     E  G + +TNDGATILK + + +PAA++LV++S  QD E GDGTT+V VLA   L    KL+++ IHP TI   +  A   A E ++  S     N R++LLKIA T+L SK++SQ+    + +AVDAVLR++        NLD + I+ KLGG++ ++ L +G +++ ++  +     VE AKI      IA    + ++  V     ++D V K       E+  + E V KI A  CNV      + R  + +     F    +M ++    E +E +   +G + ++  +       G    +EE+ +G  R++  +G++   +  S++LRG+ + +LDE+ERSLHDALCV+   VK+   VAG GA EI +   +A  +  ++G+      AF  A+  +P  + +NAGL+  E VT LR  HANG  N GI+I+KG V ++    V++   V L  VS AAE    IL++DD++
Sbjct:   20 RLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKVTNDGATILKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHPQTIISGYRRALGIAQESLKKSSIESGDNIRDDLLKIARTTLGSKILSQHKEHFAQLAVDAVLRLKGSG-----NLDAIQIIKKLGGSMNESYLDEGFLLE-KLPGMFQPRRVEKAKI-----LIANTPMDTDKVKVFGSRVRVDGVAKVAELEAAEKLKMKEKVDKILAHNCNVF-----INRQLIYNYPEQLFADAKVMAIEHADFEGIERLALVLGGEIVSTFDSPQTAQFGSCDLIEEIMIGEDRLLRFSGVKLG-EACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEAQKVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRHNMGIDIEKGEVADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDII 515          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Fly
Match: CCT4 (gene:FBgn0032444 transcript:FBtr0080411)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 315/507 (62.13%), Postives = 407/507 (80.28%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            P  +R SNI AAKAV+DAIRTSLGP+GMDKMIQ G G+V+ITNDGATILK+M ++HPAA+MLVELS+AQD+ AGDGTT+VVV+AG+ L+AC KLL KG+HPT ISDSF   ++KA EI++ MS P++L+DR  L+K ASTSLNSKVVSQ SS+L+PIAVDAVL++ D      V+L ++ +++ LGGTVEDTELVDGL+   R         +E AKIG IQFCI+ PK +M+ +++VSDY  MDRVLK+ER YIL IVK+IK SGCNVLLVQK++LRD+VSDLA HF +K+  M+VK + +E +EF+CKT+ C+PIA++++F AE L  A  VEEV  G ++ V +TGI++  +TVSI+ RGSNKLVL+EA RSLHDALCVVRCLVK +A + GGGAPEIE+  ++AA + ++ G   YCFRAFADA++VIP TLAENAGLNPI TVTELR+ HA G  NAGIN++KG + +I  E+V+QPLLVS+++++LA ET+ SILKIDD+V
Sbjct:   23 PTDVRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITNDGATILKQMNVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSFQRCSNKAVEILKQMSTPIELDDRETLIKSASTSLNSKVVSQQSSLLAPIAVDAVLKVTDPGKETSVDLKNIKVISSLGGTVEDTELVDGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDMDHNVIVSDYAAMDRVLKEERSYILNIVKQIKKSGCNVLLVQKSILRDAVSDLAQHFLDKIKCMVVKDVEREDIEFVCKTLHCRPIASLDHFTAENLSSADLVEEVASGTNKFVKITGIQNMGRTVSIICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAALAQTVEGVDAYCFRAFADALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKGAITDIFAENVVQPLLVSISSITLATETIRSILKIDDIV 529          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Fly
Match: CCT5 (gene:FBgn0010621 transcript:FBtr0087988)

HSP 1 Score: 300.056 bits (767), Expect = 1.963e-94
Identity = 182/507 (35.90%), Postives = 297/507 (58.58%), Query Frame = 1
Query:  157 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMS--CPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            ++ ++I+AA+ +A  ++TSLGPKG+DK++    GDVT+TNDGATI+K M++ H  A+++V+LS++QD E GDGTT VVVLAG+ L+    L+ +GIHP  I+D F LAA  A + ++ ++   PVD  ++  L++IA T+L SK+V++    ++ +AVDAVL + D    + VN + + I  K+GG +ED+ LV G+I+D+ +        + N K+  +     PPK + +  + V+       + + E++   ++VK++K +G  + + Q         D A H   +  +  V+ +   ++E I    G + +   E    E LG A  V E+  G S+   +   E  + + V+I LRG N +++ EA+RS+HDA+CVVR LVK   +V GGGA EI     +A  ++ LS   QY FRAF+ A++ IP  LAEN+GL+PIET++EL+    A    + G++       ++   +V++ L      + L+ + V  ILKIDDV
Sbjct:    4 VQLTHIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPKNKEPLIQIAMTTLGSKIVNKCHRQMAEMAVDAVLNVADIEKKD-VNFELIKIETKVGGRMEDSMLVKGVIVDKTLSHSQMPKELRNVKLAILTCPFEPPKPKTKHKLDVTSAEDYRALREYEQEKFTQMVKQVKDAGATLAICQWG-----FDDEANHLLLQQELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEECKNSKAVTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEADQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSGDSDMKSHNVVESLHSKKQQILLSTQLVKMILKIDDV 504          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Fly
Match: CCT5 (gene:FBgn0010621 transcript:FBtr0087987)

HSP 1 Score: 300.056 bits (767), Expect = 5.053e-94
Identity = 182/505 (36.04%), Postives = 295/505 (58.42%), Query Frame = 1
Query:  163 NSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMS--CPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
             ++I+AA+ +A  ++TSLGPKG+DK++    GDVT+TNDGATI+K M++ H  A+++V+LS++QD E GDGTT VVVLAG+ L+    L+ +GIHP  I+D F LAA  A + ++ ++   PVD  ++  L++IA T+L SK+V++    ++ +AVDAVL + D    + VN + + I  K+GG +ED+ LV G+I+D+ +        + N K+  +     PPK + +  + V+       + + E++   ++VK++K +G  + + Q         D A H   +  +  V+ +   ++E I    G + +   E    E LG A  V E+  G S+   +   E  + + V+I LRG N +++ EA+RS+HDA+CVVR LVK   +V GGGA EI     +A  ++ LS   QY FRAF+ A++ IP  LAEN+GL+PIET++EL+    A    + G++       ++   +V++ L      + L+ + V  ILKIDDV
Sbjct:   36 KTHIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPKNKEPLIQIAMTTLGSKIVNKCHRQMAEMAVDAVLNVADIEKKD-VNFELIKIETKVGGRMEDSMLVKGVIVDKTLSHSQMPKELRNVKLAILTCPFEPPKPKTKHKLDVTSAEDYRALREYEQEKFTQMVKQVKDAGATLAICQWG-----FDDEANHLLLQQELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEECKNSKAVTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEADQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSGDSDMKSHNVVESLHSKKQQILLSTQLVKMILKIDDV 534          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084290)

HSP 1 Score: 263.848 bits (673), Expect = 3.827e-80
Identity = 165/523 (31.55%), Postives = 289/523 (55.26%), Query Frame = 1
Query:  151 AAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEII-EGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAV--LRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANV------EYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHIN--------AGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            A++R  N++AA ++++ +++SLGP G+DKM+ +  GDVT+TNDGATIL+ +++ HPAA++LVEL++ QD E GDGTT+VV+LA   L    +L+ + IHPT+I   + +A  +A + I E ++ PVD   R++L+ IA TS++SK++   +   S + VDA   ++I D       ++  +N++   G +  ++ L+ G  ++  + S      + NAKI  + F +   K +M   ++++D  +++ +   E     E +  I  +G NV+LV        V DL + +F +   M V+ + K  ++ I K  G   I ++      E F+A  +G A  V +  +    ++ + G +      SI+LRG N    DE ERS+HDALCVV+ +++ K +VAGGG  E  +   +  ++ SL+   Q     FA ++ VIP TL+ NA  +  + V +LR  H +             G+++ +G V +     V++P +  + ++  A E   +IL+IDD++
Sbjct:   18 ASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGG-----VDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKAR-AAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMI 534          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084291)

HSP 1 Score: 263.848 bits (673), Expect = 3.827e-80
Identity = 165/523 (31.55%), Postives = 289/523 (55.26%), Query Frame = 1
Query:  151 AAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEII-EGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAV--LRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANV------EYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHIN--------AGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            A++R  N++AA ++++ +++SLGP G+DKM+ +  GDVT+TNDGATIL+ +++ HPAA++LVEL++ QD E GDGTT+VV+LA   L    +L+ + IHPT+I   + +A  +A + I E ++ PVD   R++L+ IA TS++SK++   +   S + VDA   ++I D       ++  +N++   G +  ++ L+ G  ++  + S      + NAKI  + F +   K +M   ++++D  +++ +   E     E +  I  +G NV+LV        V DL + +F +   M V+ + K  ++ I K  G   I ++      E F+A  +G A  V +  +    ++ + G +      SI+LRG N    DE ERS+HDALCVV+ +++ K +VAGGG  E  +   +  ++ SL+   Q     FA ++ VIP TL+ NA  +  + V +LR  H +             G+++ +G V +     V++P +  + ++  A E   +IL+IDD++
Sbjct:   18 ASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGG-----VDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKAR-AAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMI 534          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Zebrafish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 327/508 (64.37%), Postives = 419/508 (82.48%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI A KAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAA+M+VELSKAQDIEAGDGTT+VVV+AG+ LDAC+KLL KGIHPT IS+SF  A  K  E++  +S P+ L+DR +LL  ASTSL SKVVSQ SS+L+P++VDAV+++ D +    V+L D+N+V KLGGT++D ELVDG+++ +RV S   V  VE AKIG IQFC++PPK +M+  IVVSDY QMDRVL++ER YIL +VK++K +GC VLL+QK++LRD++SDLALHF NKM IM++K I +E++EFICKTIG KPIA+++ F  E LG A+ VEEV + G+ ++V +TG     +TVSI++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++A Y+ SL G   YC RA+ADA++VIP TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDD+V
Sbjct:   24 PAQIRYSNINAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMMVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTIISESFQKAVDKGVEVLTSISTPLLLSDRESLLNSASTSLCSKVVSQNSSLLAPMSVDAVMKVIDPATATSVDLRDINVVKKLGGTIDDCELVDGMVLTQRVAS-TGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQVKKAGCTVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREEIEFICKTIGTKPIAHIDQFTPEMLGSAELVEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEYARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGETTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDLV 530          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 307.76 bits (787), Expect = 6.582e-97
Identity = 187/504 (37.10%), Postives = 300/504 (59.52%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIE--GMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA-GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            S+ILAAKAVA+ +RTSLGP G+DKM+ +  G+VT+TNDGATIL  M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL +GIHP  I+D ++ AA  A E ++  G S PVD N+  +L++ A T+L SKV+++    ++ IAV+A+L + D    + V+ + + +  K+GG +EDT+L+ G+I+D+          +++ KI  +     PPK + +  + V+       + K E+    E+++++K +G N+ + Q         D A H   +  +  ++ +   ++E I    G + +        E LG A  V+E+  G ++   +   E  + + V+I +RG NK++++EA+R+LHDALCV+R LV+   +V GGGA EI     +   ++      QY  RAFADA++VIP  LAEN+GLNPI+T+TE+R      + +A GI+       ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   36 SHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKD-VDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKDKFQEMIRQVKENGANLAICQW-----GFDDEANHLLLQNELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEKLGTAGLVKEICFGTTKDRMLVIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKENNSALGIDCLHLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Zebrafish
Match: cct3 (chaperonin containing TCP1, subunit 3 (gamma) [Source:ZFIN;Acc:ZDB-GENE-020419-5])

HSP 1 Score: 267.314 bits (682), Expect = 1.888e-81
Identity = 160/506 (31.62%), Postives = 289/506 (57.11%), Query Frame = 1
Query:  169 NILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ-DDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEV-PVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHAN-GHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAG 1674
            NI AAK +AD IRT LGP+ M KM+ +  G + +TNDG  IL+ +++ HPAA+ ++E+S+ QD E GDGTT+V++LAG  L    + L + +HPT +  ++  A      I++ +S PVD+++R+ +LKI ++++N+K +S++S++   IA+DAV  ++ +++    +++     V K+ GG +ED+ ++ G+++++ V        ++N +I  +   +   K E +  I ++      R+L+ E +Y+ +I + I     +++  +K      +SDLA H+  K NI  ++ I K     I +  G +  +  +    + +G    + EV  +G      VT  +   +  +ILLRG++K +L E ER+L DA+ V R ++    L+ GGGA E+EV  ++   S +++G  Q+ +RA A A++V+P TL +N G + I  +T LR  H   G+ + G+N + G + ++    + +PL V       A ET   +L+IDD+V+G
Sbjct:   25 NISAAKTIADIIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVIGAYRQALDDMLNILKDISTPVDVSNRDMMLKIINSAINTKALSRWSTLACNIALDAVRTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLRGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEIAREEDFARILQMEEEYVQQICEDIIRLKPDLIFTEK-----GISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELTEDDVGTGAGLFEVKKIGDEYFTFVTECKDP-KACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMEVSHRLTERSRAMTGVEQWPYRAVAQALEVVPRTLIQNCGASAIRVLTSLRAKHTQEGNSSWGVNGETGTLADMEQLGIWEPLAVKAQTYKTAVETAILLLRIDDIVSG 524          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 266.929 bits (681), Expect = 3.474e-81
Identity = 173/522 (33.14%), Postives = 292/522 (55.94%), Query Frame = 1
Query:  154 AIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEII-EGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ--DDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIG---CKPIANV---EYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA--------GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            ++R+ N++AA ++A+ +++SLGP G+DKM+ +  GDVTITNDGATILK +++ HPAA++L EL++ QD E GDGTT+VV++A   L +  +L+ + IHPT+I   + LA  +A   I E ++   D   R  LL  A TS++SK++   +   + + VDA + ++  D        ++ +N++   G + +++ LV+G  ++  V S   V  V NAKI  + F +   K ++   +V++D  ++D++ + E     E V+KI ASG NV+L         + D+ L +F  +  M V+ + K+ ++ I K  G   C  ++N+   E F    LG A+ V +  V    ++ +   +    + SI+LRG+N  + DE ERSLHDALCVV+ +++ K++V GGGA E  +   +  Y+ S+    Q     FA ++ VIP TLA NA  +  + V +LR  H    +N         G+++  G   +     V +P +V   ++  A E   +IL+IDD++
Sbjct:   17 SVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTT-----GGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKNTKAR-TSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 532          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 266.929 bits (681), Expect = 4.319e-81
Identity = 173/522 (33.14%), Postives = 292/522 (55.94%), Query Frame = 1
Query:  154 AIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEII-EGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ--DDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIG---CKPIANV---EYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA--------GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            ++R+ N++AA ++A+ +++SLGP G+DKM+ +  GDVTITNDGATILK +++ HPAA++L EL++ QD E GDGTT+VV++A   L +  +L+ + IHPT+I   + LA  +A   I E ++   D   R  LL  A TS++SK++   +   + + VDA + ++  D        ++ +N++   G + +++ LV+G  ++  V S   V  V NAKI  + F +   K ++   +V++D  ++D++ + E     E V+KI ASG NV+L         + D+ L +F  +  M V+ + K+ ++ I K  G   C  ++N+   E F    LG A+ V +  V    ++ +   +    + SI+LRG+N  + DE ERSLHDALCVV+ +++ K++V GGGA E  +   +  Y+ S+    Q     FA ++ VIP TLA NA  +  + V +LR  H    +N         G+++  G   +     V +P +V   ++  A E   +IL+IDD++
Sbjct:   19 SVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTT-----GGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKNTKAR-TSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 326/508 (64.17%), Postives = 420/508 (82.68%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI A KAVADA+RTSLGPKGMDKMIQ+GKGDVTITNDGATILK M+++HPAA+MLVELSKAQDIEAGDGTT+VVV+AG+ LDAC+KLL KGIHPTTIS+SF LA+ K  E++  MS  V+L+DR  LL  A+TSLNSKVVSQYSS+L+P++VDAV+++ D    N V+L D+ IV KLGGT++D E+VDGL++ ++  +   V  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E +EFICKTIG KP+A+++ F A+ L  A+  EEV + G+ ++V +TG  +  +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  Y+ +LSG   YC RAFADA+++IP+TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS+++++LA ETV SILKIDDVV
Sbjct:   33 PAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVV 539          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 326/508 (64.17%), Postives = 420/508 (82.68%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI A KAVADA+RTSLGPKGMDKMIQ+GKGDVTITNDGATILK M+++HPAA+MLVELSKAQDIEAGDGTT+VVV+AG+ LDAC+KLL KGIHPTTIS+SF LA+ K  E++  MS  V+L+DR  LL  A+TSLNSKVVSQYSS+L+P++VDAV+++ D    N V+L D+ IV KLGGT++D E+VDGL++ ++  +   V  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E +EFICKTIG KP+A+++ F A+ L  A+  EEV + G+ ++V +TG  +  +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  Y+ +LSG   YC RAFADA+++IP+TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS+++++LA ETV SILKIDDVV
Sbjct:   28 PAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVV 534          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 326/508 (64.17%), Postives = 420/508 (82.68%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI A KAVADA+RTSLGPKGMDKMIQ+GKGDVTITNDGATILK M+++HPAA+MLVELSKAQDIEAGDGTT+VVV+AG+ LDAC+KLL KGIHPTTIS+SF LA+ K  E++  MS  V+L+DR  LL  A+TSLNSKVVSQYSS+L+P++VDAV+++ D    N V+L D+ IV KLGGT++D E+VDGL++ ++  +   V  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E +EFICKTIG KP+A+++ F A+ L  A+  EEV + G+ ++V +TG  +  +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  Y+ +LSG   YC RAFADA+++IP+TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS+++++LA ETV SILKIDDVV
Sbjct:   19 PAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVV 525          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 326/508 (64.17%), Postives = 420/508 (82.68%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI A KAVADA+RTSLGPKGMDKMIQ+GKGDVTITNDGATILK M+++HPAA+MLVELSKAQDIEAGDGTT+VVV+AG+ LDAC+KLL KGIHPTTIS+SF LA+ K  E++  MS  V+L+DR  LL  A+TSLNSKVVSQYSS+L+P++VDAV+++ D    N V+L D+ IV KLGGT++D E+VDGL++ ++  +   V  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E +EFICKTIG KP+A+++ F A+ L  A+  EEV + G+ ++V +TG  +  +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  Y+ +LSG   YC RAFADA+++IP+TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS+++++LA ETV SILKIDDVV
Sbjct:   22 PAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVV 528          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Xenopus
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:448604])

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 326/508 (64.17%), Postives = 420/508 (82.68%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI A KAVADA+RTSLGPKGMDKMIQ+GKGDVTITNDGATILK M+++HPAA+MLVELSKAQDIEAGDGTT+VVV+AG+ LDAC+KLL KGIHPTTIS+SF LA+ K  E++  MS  V+L+DR  LL  A+TSLNSKVVSQYSS+L+P++VDAV+++ D    N V+L D+ IV KLGGT++D E+VDGL++ ++  +   V  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E +EFICKTIG KP+A+++ F A+ L  A+  EEV + G+ ++V +TG  +  +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  Y+ +LSG   YC RAFADA+++IP+TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS+++++LA ETV SILKIDDVV
Sbjct:   32 PAQIRFSNISAGKAVADAVRTSLGPKGMDKMIQDGKGDVTITNDGATILKLMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQLASDKGIEVLTNMSQSVELSDRETLLNSATTSLNSKVVSQYSSLLAPMSVDAVMKVIDPQTANSVDLRDIKIVKKLGGTIDDCEMVDGLVLTQKAAN-TGVTRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERTYILNLVKQIKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITGCANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNEYARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISSLTLATETVRSILKIDDVV 538          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Mouse
Match: Cct4 (chaperonin containing Tcp1, subunit 4 (delta) [Source:MGI Symbol;Acc:MGI:104689])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 329/508 (64.76%), Postives = 417/508 (82.09%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAARMLVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS PV L+DR  LL  A+TSLNSKVVSQYSS+LSP++V+AV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V +   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK + +E +EFICKTIG KP+A+++ F A+ LG A+  EEV + G+ ++  +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G    GIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   30 PAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVV 536          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Mouse
Match: Cct4 (chaperonin containing Tcp1, subunit 4 (delta) [Source:MGI Symbol;Acc:MGI:104689])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 304/508 (59.84%), Postives = 387/508 (76.18%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKM                              LVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS PV L+DR  LL  A+TSLNSKVVSQYSS+LSP++V+AV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V +   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK + +E +EFICKTIG KP+A+++ F A+ LG A+  EEV + G+ ++  +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G    GIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   30 PAQIRFSNISAAKAVADAIRTSLGPKGMDKM------------------------------LVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVV 506          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Mouse
Match: Cct5 (chaperonin containing Tcp1, subunit 5 (epsilon) [Source:MGI Symbol;Acc:MGI:107185])

HSP 1 Score: 307.375 bits (786), Expect = 9.072e-97
Identity = 191/505 (37.82%), Postives = 299/505 (59.21%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMS--CPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE--HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA-GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            S+I+AAKAVA+ +RTSLGP G+DKM+ +  GDVTITNDGATIL  M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL +GIHP  I+D +  AA  A + ++ +S    VD+N+   L++ A T+L SKV++     ++ IAV+AVL + D    + V+ + + +  K+GG +EDT+L+ G+I+D+          V +AKI  +     PPK + +  + V        + K E++   E++K+IK +G N+ + Q         D A H   +  +  V+ +   ++E I    G + +       +E LGFA  V+E+  G ++   +  IE   + + V+I +RG NK++++EA+RSLHDALCV+R L++   +V GGGA EI     ++  ++      QY  RAFADA++VIP  L+EN+G+NPI+T+TE+R         A GI+       ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   36 SHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTITNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARIAIQHLDKISDKVLVDINNPEPLIQTAKTTLGSKVINSCHRQMAEIAVNAVLTVADMERRD-VDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVVDAKIAILTCPFEPPKPKTKHKLDVMSVEDYKALQKYEKEKFEEMIKQIKETGANLAICQW-----GFDDEANHLLLQNGLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLV-IEKCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIETLIGKKQQISLATQMVRMILKIDDI 533          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 270.781 bits (691), Expect = 9.696e-83
Identity = 162/510 (31.76%), Postives = 289/510 (56.67%), Query Frame = 1
Query:  157 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ-DDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEV-PVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA-GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAG 1674
            +++ NI AAK +AD IRT LGPK M KM+ +  G + +TNDG  IL+ +++ HPAA+ ++E+S+ QD E GDGTT+V++LAG  L      L + +HPT +  ++ +A       ++ +S PVD+N+R  +L I ++S+ +KV+S++SS+   IA+DAV  +Q +++    +++     V K+ GG +ED+ ++ G++I++ V        ++N +I  +   +   K E +  I ++      R+L+ E +YI ++ + I     +V++ +K      +SDLA H+  + N+  ++ + K     I +  G + ++  E    + +G    + E+  +G      +T  +   +  +ILLRG++K +L E ER+L DA+ V R ++    LV GGGA E+ V   +   S +++G  Q+ +RA A A++VIP TL +N G + I  +T LR  H        G+N + G ++++ +  + +PL V L     A ET   +L+IDD+V+G
Sbjct:   22 VQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKG-----ISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDP-KACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSG 525          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 258.07 bits (658), Expect = 4.688e-78
Identity = 150/483 (31.06%), Postives = 273/483 (56.52%), Query Frame = 1
Query:  157 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ-DDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEV-PVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA-GINIKKGCVINIMDEDVMQP 1593
            +++ NI AAK +AD IRT LGPK M KM+ +  G + +TNDG  IL+ +++ HPAA+ ++E+S+ QD E GDGTT+V++LAG  L      L + +HPT +  ++ +A       ++ +S PVD+N+R  +L I ++S+ +KV+S++SS+   IA+DAV  +Q +++    +++     V K+ GG +ED+ ++ G++I++ V        ++N +I  +   +   K E +  I ++      R+L+ E +YI ++ + I     +V++ +K      +SDLA H+  + N+  ++ + K     I +  G + ++  E    + +G    + E+  +G      +T  +   +  +ILLRG++K +L E ER+L DA+ V R ++    LV GGGA E+ V   +   S +++G  Q+ +RA A A++VIP TL +N G + I  +T LR  H        G+N + G ++++ +  + +P
Sbjct:   22 VQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKG-----ISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDP-KACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGVNGETGTLVDMKELGIWEP 498          
BLAST of T-complex protein 1 subunit delta vs. UniProt/SwissProt
Match: sp|Q2T9X2|TCPD_BOVIN (T-complex protein 1 subunit delta OS=Bos taurus OX=9913 GN=CCT4 PE=1 SV=3)

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 331/508 (65.16%), Postives = 418/508 (82.28%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAARMLVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS P +L+DR  LL  A+TSLNSKVVSQYSS+LSP++VDAV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V +   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E +EFICKTIG KP+A+V+ F A+ LG A+  EEV + G+ +++ +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G    GIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   33 PAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPEELSDRETLLNSAATSLNSKVVSQYSSLLSPMSVDAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYVQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHVDQFTADMLGSAELAEEVSLNGSGKLIKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCIRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEQVVQPLLVSVSALTLATETVRSILKIDDVV 539          
BLAST of T-complex protein 1 subunit delta vs. UniProt/SwissProt
Match: sp|P50991|TCPD_HUMAN (T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 331/508 (65.16%), Postives = 420/508 (82.68%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAARMLVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS PV+L+DR  LL  A+TSLNSKVVSQYSS+LSP++V+AV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V S   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM++K I +E +EFICKTIG KP+A+++ F A+ LG A+  EEV + G+ +++ +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   30 PAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKV-SNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVV 536          
BLAST of T-complex protein 1 subunit delta vs. UniProt/SwissProt
Match: sp|Q5R637|TCPD_PONAB (T-complex protein 1 subunit delta OS=Pongo abelii OX=9601 GN=CCT4 PE=2 SV=3)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 330/508 (64.96%), Postives = 419/508 (82.48%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAARMLVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS PV+L+DR  LL  A+TSLNSKV SQYSS+LSP++V+AV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V S   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM++K I +E +EFICKTIG KP+A+++ F A+ LG A+  EEV + G+ +++ +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   30 PAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVASQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKV-SNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVV 536          
BLAST of T-complex protein 1 subunit delta vs. UniProt/SwissProt
Match: sp|P80315|TCPD_MOUSE (T-complex protein 1 subunit delta OS=Mus musculus OX=10090 GN=Cct4 PE=1 SV=3)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 329/508 (64.76%), Postives = 417/508 (82.09%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAARMLVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS PV L+DR  LL  A+TSLNSKVVSQYSS+LSP++V+AV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V +   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK + +E +EFICKTIG KP+A+++ F A+ LG A+  EEV + G+ ++  +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G    GIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   30 PAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVV 536          
BLAST of T-complex protein 1 subunit delta vs. UniProt/SwissProt
Match: sp|Q7TPB1|TCPD_RAT (T-complex protein 1 subunit delta OS=Rattus norvegicus OX=10116 GN=Cct4 PE=1 SV=3)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 329/508 (64.76%), Postives = 416/508 (81.89%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAARMLVELSKAQDIEAGDGTT+VV++AGS LD+C+KLL KGIHPT IS+SF  A  K  EI+  MS PV L+DR  LL  A+TSLNSKVVSQYSS+LSP++V+AV+++ D +    V+L D+ IV KLGGT++D ELV+GL++ ++V +   +  VE AKIG IQFC++ PK +M+  IVVSDY QMDRVL++ER YIL +VK+IK +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E +EFICKTIG KP+A+++ F  + LG A+  EEV + G+ ++  +TG     +TV+I++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +LSG   YC RAFADAM+VIP TLAENAGLNPI TVTELR+ HA G    GIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV
Sbjct:   30 PAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVAN-SGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTPDMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVV 536          
BLAST of T-complex protein 1 subunit delta vs. TrEMBL
Match: A0A183RSL5 (T-complex protein 1 subunit delta OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 351/510 (68.82%), Postives = 438/510 (85.88%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAGL 1677
            PAAIR+SNI+AAKAVADAIRTSLGPKGMDKMIQE KGDVTITNDGATILK+MKL+HPAA+MLVELSKAQDIEAGDGTT+VVVLAGS LDACSKLL KGIHPT+ISD+F  AA KA +I+EGMS PVDL +   L+K+A+TSLNSKVVSQ+S  L+PIAV +VL + D + PN V+LDD+ +V KLGGTVEDT+LVDGLI+++R ES C V  VE AKI  IQFCI+PPK +ME ++V++DYTQMDR++K+ER+YIL I+K +K +GCNVLL+QK++LRD+V++LALH+FNKM IM+VK I + +VEFICKT+ C PIA++++FN E +G A  VEE    A   VH+TGIE+  +T+SIL+RGSNKL+LDEAERSLHDALCV+RCLVKK+A+++GGGAPEIE+ QK+AA++N+  G  QYCFRAFADA +VIPYTLAENAGL+PI+TVTELR +HA G  NAGIN++ G V++I+ ++V+QP+LVS +AV+LA ETV SILKIDDVV+ L
Sbjct:   28 PAAIRSSNIVAAKAVADAIRTSLGPKGMDKMIQEAKGDVTITNDGATILKQMKLLHPAAKMLVELSKAQDIEAGDGTTSVVVLAGSLLDACSKLLDKGIHPTSISDAFQKAALKACDILEGMSVPVDLGNNEELIKVATTSLNSKVVSQHSDCLAPIAVKSVLSVIDPAYPNSVSLDDIRVVKKLGGTVEDTKLVDGLILNQRAESACGVKRVEKAKIALIQFCISPPKTDMENNVVITDYTQMDRIMKEERQYILNIIKAVKKAGCNVLLIQKSILRDAVNELALHYFNKMKIMVVKDIERTEVEFICKTLHCIPIASLDHFNPEYMGSASLVEESEATA-HCVHITGIENRGRTMSILVRGSNKLMLDEAERSLHDALCVIRCLVKKRAMISGGGAPEIEIAQKLAAFANTTPGLDQYCFRAFADAFEVIPYTLAENAGLSPIQTVTELRALHAKGEKNAGINVRTGAVVDILAQNVIQPMLVSYSAVTLATETVRSILKIDDVVSYL 536          
BLAST of T-complex protein 1 subunit delta vs. TrEMBL
Match: H2KNK7 (T-complex protein 1 subunit delta OS=Clonorchis sinensis OX=79923 GN=CLF_100351 PE=3 SV=1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 358/509 (70.33%), Postives = 429/509 (84.28%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAG 1674
            PAAIR+SNI AAKAVADAIRTSLGPKGMDKMIQE KGDVT+TNDGATIL++MKL+HPAA+MLVELSKAQDIE GDGTTTVVVLAGS LDACSKLL+KGIHPTTISD+F  AA KA EII+ M+ PV L+D   L+KIA+TSLNSKVVSQ+S  L+PIAV AVL   D S P+ V LDD+ +V KLGGTVEDTELVDGLI+ +RV   C V  VE AKIG IQFC++PPK +ME +++V+DYTQMDR++K+ER+YIL IVK +K +GCNVLL+QK++LRD+V+DLALH+F+KMNIM+VK I + +VEFICKT+ C PIA++++FN E LG A  VEE    A R V +TGI++  +TVSIL+RGSNKL+LDEAERSLHDALCV+RCLVKK ALVAGGGAPEIEV QK+A  +N+  G  QYCFRAFADA +V+PYTLAENAGLNPI+TVTELR +HA G +NAGI+++ G V +I+ +DVMQP+LVS + VSLAAETV SILKIDDV  G
Sbjct:   30 PAAIRSSNITAAKAVADAIRTSLGPKGMDKMIQEAKGDVTVTNDGATILRQMKLLHPAAKMLVELSKAQDIETGDGTTTVVVLAGSLLDACSKLLNKGIHPTTISDAFQRAAVKACEIIDNMAVPVKLDDMQQLIKIATTSLNSKVVSQHSGALAPIAVKAVLEAVDPSSPHTVTLDDVRVVKKLGGTVEDTELVDGLILTQRVAPGCGVKRVEKAKIGLIQFCVSPPKTDMENTVIVTDYTQMDRIMKEERQYILNIVKAVKKAGCNVLLIQKSILRDAVNDLALHYFSKMNIMVVKDIERTEVEFICKTLHCTPIASLDHFNPEYLGSANLVEESEATA-RCVRITGIQNKGRTVSILVRGSNKLMLDEAERSLHDALCVIRCLVKKGALVAGGGAPEIEVAQKLALLANTTPGLDQYCFRAFADAFEVVPYTLAENAGLNPIQTVTELRALHARGQVNAGIDVRMGAVADILSQDVMQPVLVSHSVVSLAAETVRSILKIDDVPHG 537          
BLAST of T-complex protein 1 subunit delta vs. TrEMBL
Match: A0A4S2M966 (T-complex protein 1 subunit delta OS=Opisthorchis felineus OX=147828 GN=CRM22_003092 PE=3 SV=1)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 356/508 (70.08%), Postives = 429/508 (84.45%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVA 1671
            PAAIR+SNI AAKAVADAIRTSLGPKGMDKMIQE KGDVT+TNDGATIL++MKL+HPAA+MLVELSKAQDIE GDGTTTVVVLAGS LDACSKLL+KGIHPTTISD+F  AA KA  II+ M+ PV L+D   L+KIA+TSLNSKVVSQ+S  L+PIAV AVL   D S P+ V LDD+ +V KLGGTVEDTELVDGLI+ +RV   C V  VE AKIG IQFC++PPK +ME +++V+DYTQMDR++K+ER+YIL IVK +K +GCNVLL+QK++LRD+V+DLALH+F+KMNIM+VK I + +VEFICKT+ C PIA++++FN E LG A  VEE    A R V +TGI++  +TVSIL+RGSNKL+LDEAERSLHDALCV+RCLVK+ ALVAGGGAPEIEV QK+A  +N+  G  QYCFRAFADA +V+PYTLAENAGLNPI+TVTELR +HA G +NAGI+++ G V +I+ +DVMQP+LVS + VSLAAETV SILKIDDVV+
Sbjct:   30 PAAIRSSNITAAKAVADAIRTSLGPKGMDKMIQESKGDVTVTNDGATILRQMKLLHPAAKMLVELSKAQDIETGDGTTTVVVLAGSLLDACSKLLNKGIHPTTISDAFQRAAVKACAIIDNMAVPVKLDDMQQLIKIATTSLNSKVVSQHSGALAPIAVKAVLEAVDPSSPHTVTLDDVRVVKKLGGTVEDTELVDGLILTQRVAPGCGVKRVEKAKIGLIQFCVSPPKTDMENTVIVTDYTQMDRIMKEERQYILNIVKAVKKAGCNVLLIQKSILRDAVNDLALHYFSKMNIMVVKDIERTEVEFICKTLHCTPIASLDHFNPEYLGSANLVEESEATA-RCVRITGIQNKGRTVSILVRGSNKLMLDEAERSLHDALCVIRCLVKRGALVAGGGAPEIEVAQKLALLANTTPGLDQYCFRAFADAFEVVPYTLAENAGLNPIQTVTELRALHARGQVNAGIDVRMGAVADILSQDVMQPVLVSHSVVSLAAETVRSILKIDDVVS 536          
BLAST of T-complex protein 1 subunit delta vs. TrEMBL
Match: A0A4S2M955 (T-complex protein 1 subunit delta OS=Opisthorchis felineus OX=147828 GN=CRM22_003092 PE=3 SV=1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 355/507 (70.02%), Postives = 428/507 (84.42%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PAAIR+SNI AAKAVADAIRTSLGPKGMDKMIQE KGDVT+TNDGATIL++MKL+HPAA+MLVELSKAQDIE GDGTTTVVVLAGS LDACSKLL+KGIHPTTISD+F  AA KA  II+ M+ PV L+D   L+KIA+TSLNSKVVSQ+S  L+PIAV AVL   D S P+ V LDD+ +V KLGGTVEDTELVDGLI+ +RV   C V  VE AKIG IQFC++PPK +ME +++V+DYTQMDR++K+ER+YIL IVK +K +GCNVLL+QK++LRD+V+DLALH+F+KMNIM+VK I + +VEFICKT+ C PIA++++FN E LG A  VEE    A R V +TGI++  +TVSIL+RGSNKL+LDEAERSLHDALCV+RCLVK+ ALVAGGGAPEIEV QK+A  +N+  G  QYCFRAFADA +V+PYTLAENAGLNPI+TVTELR +HA G +NAGI+++ G V +I+ +DVMQP+LVS + VSLAAETV SILKIDDV+
Sbjct:   30 PAAIRSSNITAAKAVADAIRTSLGPKGMDKMIQESKGDVTVTNDGATILRQMKLLHPAAKMLVELSKAQDIETGDGTTTVVVLAGSLLDACSKLLNKGIHPTTISDAFQRAAVKACAIIDNMAVPVKLDDMQQLIKIATTSLNSKVVSQHSGALAPIAVKAVLEAVDPSSPHTVTLDDVRVVKKLGGTVEDTELVDGLILTQRVAPGCGVKRVEKAKIGLIQFCVSPPKTDMENTVIVTDYTQMDRIMKEERQYILNIVKAVKKAGCNVLLIQKSILRDAVNDLALHYFSKMNIMVVKDIERTEVEFICKTLHCTPIASLDHFNPEYLGSANLVEESEATA-RCVRITGIQNKGRTVSILVRGSNKLMLDEAERSLHDALCVIRCLVKRGALVAGGGAPEIEVAQKLALLANTTPGLDQYCFRAFADAFEVVPYTLAENAGLNPIQTVTELRALHARGQVNAGIDVRMGAVADILSQDVMQPVLVSHSVVSLAAETVRSILKIDDVI 535          
BLAST of T-complex protein 1 subunit delta vs. TrEMBL
Match: A0A0R3TC91 (T-complex protein 1 subunit delta OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS4678 PE=3 SV=1)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 347/508 (68.31%), Postives = 432/508 (85.04%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVA 1671
            P AIR SNI+AAKAV+DAIRTSLGP+GMDKMI E KGDVTITNDGATILK+MKL+HPAA+MLVELSKAQDIEAGDGTT+VV+LAGS LDACSKLL+KG+HPT IS++F LAA KA E+I  M+ P+D+NDR  LLKIASTSLNSKVVSQYSS+LSPIAVD+VL + D   P+ VNL D+ IV KLGGTVED +L+DGL++ +RVES C V  VE AKI  +QFCI+PPK +ME ++VV+DYTQMDR++K+ER+YIL IVK +K SG NV+L+QK++LRD+V+DLALHFF K+ IM+VK I ++++EFICKT+ C P+A+V++   + LG A  VEE+  G S+IV +TGI++  +TVS+LLRGSNKLVL+EA+RSLHDALCV+RCLVK++AL+AGGGAPEIE+ QKMA  +N  +G  QYC RAFADAM+VIPYTLAENAGLNPI+TVTELR  H+NG +N GIN++KG V ++M E+V+QPL V+ +AV+LA ETV SILKIDDVV+
Sbjct:   23 PQAIRESNIVAAKAVSDAIRTSLGPRGMDKMILEAKGDVTITNDGATILKQMKLLHPAAKMLVELSKAQDIEAGDGTTSVVILAGSLLDACSKLLNKGLHPTVISEAFQLAAKKACEVITSMAQPIDINDREMLLKIASTSLNSKVVSQYSSILSPIAVDSVLAVTDMDDPDAVNLKDIRIVKKLGGTVEDAQLIDGLLLSQRVESGCGVRRVEKAKIALVQFCISPPKTDMENNVVVTDYTQMDRIMKEERQYILNIVKAVKKSGANVILIQKSILRDAVNDLALHFFGKLKIMVVKDIERDEIEFICKTLRCVPVASVDHLTPDVLGKADLVEEMESGGSKIVKITGIQNRGRTVSVLLRGSNKLVLEEADRSLHDALCVIRCLVKRRALIAGGGAPEIEISQKMAHMANESTGLDQYCLRAFADAMEVIPYTLAENAGLNPIQTVTELRARHSNGEVNCGINVRKGFVSDMMAENVLQPLQVTHSAVTLATETVRSILKIDDVVS 530          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Cavefish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 329/512 (64.26%), Postives = 420/512 (82.03%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEF---ICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVA 1671
            PA IR SNI A KAVADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M+++HPAA+MLVELSKAQDIEAGDGTT+VVV+AG+ LDAC+KLL KGIHPTTIS+SF  A  K  E++  +S PV+L+DR  LL  A+TSL SKVVSQYSS+L+P++VDAV+R+ D +    V+L D++IV KLGGT++D ELVDGL++ +RV +   V  VE AKIG IQFC++PPK +M+  IVVSDY QMDRVL++ER YIL ++K+IK +GCNVLL+QK++LRD++SDLA+HF NKM IM+VK I +E++E    IC TIG KPIA+++ F  E LG A+  EEV + G+ ++V +TG     +TVSI++RGSNKLV++EAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++A ++ SL G   YC RA+ADA++VIP TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVS++A++LA ETV SILKIDDVV+
Sbjct:   24 PAQIRYSNISAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQKAVDKGVEVLTSISQPVELSDRETLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATSVDLRDIHIVKKLGGTIDDCELVDGLVLTQRVVN-TGVSRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLIKQIKKAGCNVLLIQKSILRDALSDLAVHFLNKMKIMVVKDIEREEIEEQLNIC-TIGTKPIAHIDQFTPEMLGLAELAEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEFARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDVVS 533          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 301.982 bits (772), Expect = 9.793e-95
Identity = 184/504 (36.51%), Postives = 299/504 (59.33%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIE--GMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA-GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            S+I+AAKAVA+ ++TSLGP G+DKM+ +  G+VT+TNDGATIL  M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL +GIHP  I+D ++ AA  A E ++  G S PVD ++   L++ A T+L SKV+++    ++ IAV+A+L + D    + V+ + + +  K+GG +EDT+L+ G+I+D+          +++ KI  +     PPK + +  + ++       + K E++   E+++++K +G N+ + Q         D A H   +  +  V+ +   ++E I    G + +        E LG A  V E+  G ++   +   E  + + V+I +RG NK++++EA+R+LHDALCV+R LV+   +V GGGA EI     +   ++      QY  RAFADA++VIP  LAEN+GLNPI+T+TE+R        +A GI+  +    ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   36 SHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKD-VDFELIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDITSVEDYKALQKYEKEKFQEMIQQVKENGANLAICQW-----GFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 270.781 bits (691), Expect = 2.455e-83
Identity = 179/504 (35.52%), Postives = 279/504 (55.36%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIE--GMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA-GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            S+I+AAKAVA+ ++TSLGP G+DKM+ +  G+VT+TNDGATIL  M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL +GIHP  I+D ++ AA  A E ++  G S PVD ++   L++ A T+L SKV+++    ++ IAV+A+L + D    + V+ + + +  K+GG +EDT+L+ G+I+D+                                      + QM                K+K +G N+ + Q         D A H   +  +  V+ +   ++E I    G + +        E LG A  V E+  G ++   +   E  + + V+I +RG NK++++EA+R+LHDALCV+R LV+   +V GGGA EI     +   ++      QY  RAFADA++VIP  LAEN+GLNPI+T+TE+R        +A GI+  +    ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   36 SHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMERKD-VDFELIKMEGKVGGKLEDTQLIKGVIVDKEFS-----------------------------------HPQM---------------PKVKENGANLAICQW-----GFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGAAGLVRELCFGTTKDRMLIIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKESNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 483          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Cavefish
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:103023813])

HSP 1 Score: 271.166 bits (692), Expect = 5.012e-83
Identity = 164/510 (32.16%), Postives = 289/510 (56.67%), Query Frame = 1
Query:  157 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ-DDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEV-PVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHAN-GHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAG 1674
            ++  NI AAK +AD IRT LGP+ M KM+ +  G + +TNDG  IL+ +++ HPAA+ ++E+S+ QD E GDGTT+V++LAG  L    + L + +HPT +  ++  A      +++ +S PVD NDR+ +LKI ++++N+K +S++SS+   IA+DAV  ++ +++    +++     V K+ GG +ED+ ++ G+++++ V        ++N +I  +   +   K E +  I ++      ++L+ E +YI  I + I     +++  +K      +SDLA H+  K NI  ++ I K     I +  G +  +  +    E +G    + EV  +G      VT  +   +  +ILLRG++K +L E ER+L DA+ V R ++    L+ GGGA E+ V  ++   S +L+G  Q+ +RA A A++VIP TL +N G + I  +T LR  H   G  + G+N + G + ++++  + +PL V       A ET   +L+IDD+V+G
Sbjct:   21 VQTGNINAAKTIADVIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVISAYRQALDDMLSMLKEISTPVDQNDRSMMLKIINSAINTKALSRWSSLACNIALDAVRTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLKGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEITREEDFAKILQMEEEYIQLICEDIIRLKPDLIFTEKG-----ISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELREEDVGTGAGLFEVKKIGDEYFTFVTECKDP-KACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMAVSHRLTERSRALTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGSTSWGVNGETGTLADMVELGIWEPLAVKAQTYKTAVETAILLLRIDDIVSG 524          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Cavefish
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:103041096])

HSP 1 Score: 267.314 bits (682), Expect = 2.874e-81
Identity = 174/522 (33.33%), Postives = 289/522 (55.36%), Query Frame = 1
Query:  154 AIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEII-EGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ--DDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIG---CKPIANV---EYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA--------GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            ++R  N++AA ++A+ +++SLGP G+DKM+ +  GDVTITNDGATILK +++ HPAA++L EL+  QD E GDGTT+VV++A   L +  +L+ + IHPT+I   + LA  +A   I E ++   D   R  L+  A TS++SK++   S   + + VDA L ++  D        ++ +N++   G + +++ LV+G  ++  V S   +  V+NAKI  + F +   K ++   +V+SD  ++D++ + E     E ++KI ASG NV+L         + D+ L +F     M V+ +    ++ I K  G   C  ++N+   E F A  LG A+ V +  V    ++ V   +    + SI+LRG+N  + DE ERSLHDALCVV+ +++ K++V GGGA E  +   +  Y+ S+    Q     FA ++ VIP TLA NA  +  + V +LR  H    +N         G+++  G   +     V +P +V   ++  A E   +IL+IDD++
Sbjct:   19 SVRTQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGADDLGRECLVNAAKTSMSSKIIGVDSDFFANMVVDAALAVKFVDGKGVARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMLKRVQNAKIACLDFSLQKTKMKLGVQVVISDPEKLDQIRQRESDITKERIQKILASGANVVLTT-----GGIDDMCLKYFVDAGAMAVRRVLHRDLKRIAKATGATICPSLSNLEGEETFEATMLGQAEEVVQERVCDDELILVKNTKAR-TSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 334/507 (65.88%), Postives = 426/507 (84.02%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR+SNI AAKA+ADAIRTSLGPKGMDKMIQ+GKGDVTITNDGATILK+M++ HPAA+MLVELSKAQDIEAGDGTT+VVV+AG+ LDA +KLL KGIHPT IS+SF  A  KA EI+E MS P++L+DR +LL  A+T+LNSKVVSQY+S+L+P++VDAV+++ D +    V+L+D+ ++ KLGGT++D ELV+GL++ +R+ S   +  VE AKIG IQFC++PPK +ME  IV+SDYTQMDRVL++ER Y L +VK++K +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E +EFICKTIG KPIA+V++F AE L  A+ VEEV VG+S++V VTG  +  +T+SIL+RGSNKLVL+EAERSLHDALCV+RCLVKK+AL+AGGGAPEIE+  ++  Y+ +LS    YC RA+ +AM+VIPYTLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QPLLVSL+AVSL+ ETV SILKIDD+V
Sbjct:   37 PAMIRSSNICAAKAIADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILESMSLPLELSDRQSLLNSATTALNSKVVSQYASLLAPMSVDAVMKVIDPATATSVDLNDIKLIRKLGGTIDDCELVEGLVLTQRI-SNTGIIRVEKAKIGLIQFCLSPPKTDMENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPIASVDHFTAEMLASAELVEEVSVGSSKVVKVTGCANPGKTMSILVRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEAYCVRAYGEAMEVIPYTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSLSAVSLSTETVRSILKIDDIV 542          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 302.368 bits (773), Expect = 1.335e-95
Identity = 187/507 (36.88%), Postives = 299/507 (58.97%), Query Frame = 1
Query:  163 NSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGM--SCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE--HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGIN-IKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
             S+I+AAK+VA  +RTSLGPKG+DKM+    GD+T+TNDGATIL  M + H  A+++VELS++QD E GDGTT VVVLAG+ L+   +LL +GIHP  ISD +  AA  A   ++ +  S PVD  +  +L+  A T+L SK+V++   +++ IAV+AVL + D    + V+ + + +  K+GG ++DT L+ G+++D+          V NAKI  +     PPK + +  + V+       +L+ E++   E+V+++K +G N+ + Q         D A H   +  +  V+ +   ++E I    G + +       A+ LG A  V E+  G ++  H+  IE  H+ + V+I +RG NK++++EA+RS+HDALCV+R LV+   +V GGG+ EI     ++  ++  +   QY  RAFADA++VIP  LAEN+GLN I  + E+R    A      GIN ++     ++ ++ V++ L+     +SLA + V  ILKIDD+
Sbjct:   35 KSHIMAAKSVASTLRTSLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQVAKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTESLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVADLERKD-VDFELIKVEGKVGGRLDDTALIKGVVVDKDFSHPQMPKEVINAKIAILTCPFEPPKPKTKHKLDVTCVEDYKALLQYEKEKFAEMVRQVKETGANLAICQWG-----FDDEANHLLLQNQLPAVRWVGGHEIELIAIATGGRIVPRFSELTADKLGHAGIVRELSFGTTKD-HMLVIEQCHNSRAVTIFIRGGNKMIIEEAKRSIHDALCVIRNLVRDNRVVYGGGSAEISCSLAVSEAADKCATLEQYAMRAFADALEVIPMALAENSGLNSIGALAEVRSRQLAEKKPYLGINCMQSSSKGDMKEQHVIETLIGKKQQISLATQMVKMILKIDDI 534          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 233.417 bits (594), Expect = 3.009e-70
Identity = 153/445 (34.38%), Postives = 244/445 (54.83%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNN----LLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESL---CNVFTVENAKIGFIQFCIAPPKAEMEQSIV-VSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLN 1476
            SNI A   VADA+RT+LGP+GMDK+I + +G  TI+NDGATILK +++VHPA + LV+++++QD E GDGTT+V +LA   L    + + +G+HP  I+ +F  A   A E I+ +S PV   D+      L+K A+T+L+SK+VSQ     + + VDAV  + D+ +P  +N+  +  V   GG +ED+ LV G+   +            T    KI  +   +   KAE E + V V++      ++  E   + + + KI+ASG  V+L +       + D+A  +F   ++     + +E ++      G     +V     + LG  +  EEV +G  R     G     +T +I+LRG  +  +DE ERSLHDA+ +VR  +K  ++V GGGA E+EV + +   S ++ G+ Q    A+A A++V P  L +NAG +
Sbjct:   23 SNITACLVVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILKLLEVVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKIKEISVPVKKEDKGELRALLVKCAATALSSKLVSQQKDFFAAMVVDAV-SMLDELMP--LNMIGMKKVQ--GGGLEDSHLVAGVAFKKTFSYAGFEMQPKTYAQPKIALLNVEL-ELKAERENAEVRVTNVQDYQAIVDAEWGILYDKLAKIEASGARVVLSKL-----PIGDVATQYFADRDMFCAGRVVEEDLKRTMMACGGSIQTSVSSMTDDVLGRCELFEEVQIGGDRYNFFKGCPQA-KTCTIILRGGAEQFMDETERSLHDAIMIVRRAIKNDSVVGGGGAVEMEVSRYLRDVSRTIPGKEQMLLGAYARALEVPPRQLCDNAGFD 455          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002042.1 (pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 gene:ENSPMAG00000001837.1 transcript:ENSPMAT00000002042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 1.600e-47
Identity = 112/370 (30.27%), Postives = 201/370 (54.32%), Query Frame = 1
Query:  157 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSC-PVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ-DDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEV-PVGASRIVHVTGIEHHYQTVSILLRGSNKLVL 1254
            ++  NI AAK +AD IRT LGP+ M KM+ +  G + +TNDG  IL+ +++ HPAA+ ++E+S+ QD E GDGTT+V++LAG  L    + L + +HPT I  ++  A       ++ +S   VD+ DR  +L+I  +++++K +S+ S +   IA+DAVL +Q +D+    +++ +   + K+ GG +E++ ++ G+++++ V        +E  +I  +   +   K E +  I +S      ++L+ E  YI +I   I     ++L  +K      +SDLA HF  K NI  ++ I K     I +  G + ++       E +G    + EV  +G      +T  +   +  +ILLRG++K +L
Sbjct:   24 VQQGNISAAKMIADVIRTCLGPRAMMKMLMDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLAVAEQFLEQQMHPTVIISAYRKALEDMLSTLKDISSVAVDVTDRVMMLRIVKSAIDTKALSRVSELACGIALDAVLTVQREDNGRREIDIKNYAKIEKVPGGILEESCVLRGVMLNKDVTHPRMRRRIETPRILLLDCSLEFKKGESQTDIEMSREEDFAKILQAEEDYIQQICADIVRLKPDLLFTEKG-----ISDLAQHFLVKANITAIRRIRKTDNNRIARACGARIVSRTSDAKEEDVGTGAGLFEVKKIGDDYFTFITECKDP-KACTILLRGASKDIL 387          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 9.442e-35
Identity = 76/201 (37.81%), Postives = 127/201 (63.18%), Query Frame = 1
Query:  160 RNSNILAAKAVADAIRTSLGPKGMDKMI----QEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRN----NLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDG 738
            R S+ + A  + D ++++LGPKGMDK++      G+  VT+TNDGATILK + + +PAA++LV++SK QD E GDGTT+V VLA   L     L++K IHP TI   +  + + A + +E ++     +D+     +LL I+ T+L+SK+++ +    + +AV+AVLR++         L+ ++++ KLGGT+ D+ L +G
Sbjct:   23 RLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHPQTIITGWRKSTAAAGKALE-LAAVDHGHDKEKFHVDLLNISRTTLSSKLLTHHKDHFAKLAVEAVLRLRGKG-----TLEAIHVIKKLGGTLLDSYLDEG 217          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 277/509 (54.42%), Postives = 396/509 (77.80%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRR-VESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHH--YQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            P  +R +NI+AA++VADAIRTSLGPKGMDKMI+  +G++ I+NDG TILK+M ++HP ARMLVE+S AQD EAGDGTT+VV+L G+ L A  +LL+KGIHPT I+DSF  AA ++ +I+  M   V L+DR  L++ ASTSL+SK+VSQYSS L+P+AVD+VL+I D++  N V+L+D+ +V K+GGT++DTE++DG+++ +  ++S       E AKIG IQF I+PPK + E +I+V+DY QMD++LK+ER Y+L I KKIK + CNVLL+QK++LRD+V+DLALHF +K+NIM+VK I +E++EF+ K +GCKPIA++E F  + LG A  VEE+    S+IV VTGI ++    TVS+++RG+N +++DE ERSLHDALCV+RCLVK++ L+AGGGAPEIE+ ++++  + S+ G   + ++ FA A++VIP TLAENAGLN I+ VTELR  H NG +N GI++++    N  +E ++QP+LVS +A++LA+E V SIL+IDD+
Sbjct:   17 PQEVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCHKVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKISDENSKN-VDLNDIRLVKKVGGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEIDSDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELNDGISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDI 524          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 283.108 bits (723), Expect = 3.754e-88
Identity = 183/517 (35.40%), Postives = 299/517 (57.83%), Query Frame = 1
Query:  160 RNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFN----LAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVE----SLCNVFTVENA---KIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASR-IVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHI-NAGINIKKGCVINIMDE-DVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            + S+ILAA++VA  I+TSLGP+G+DK++    G++TITNDGATIL +M+L +  A++LV+LSK+QD E GDGTT VVVLA + LD   +L+ KGIHP  I++ F+    LA SK  E  + +S   D   R+ LL+ A TSL SK+VS+     + +AV+AV+ + D    + V+ D + +  ++GG++ D++L++G+I+D+         C V   E +   K+  +     PPK + +  + +S   +  ++   E+    E++  +K +G +V++ Q         D A H   + ++  V+ +  +++E I  +   + +   +  + + LG   R+ E   G ++  + +       +TV+  +RGSNK+++DEAER+LHD+LCVVR LVK   +V GGGA E+ +   ++  ++   G  QY FR FA A+D IP TLAEN+GL+PI T++ L+       I N G++   G   N M E  V+ P +     + LA +    ILKID+V+
Sbjct:   47 KKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKD-VDFDLIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKC-VLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWG-----FDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDC-LGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVI 555          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Yeast
Match: CCT3 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; capable of binding Q/N rich proteins and mediating their folding [Source:SGD;Acc:S000003551])

HSP 1 Score: 263.848 bits (673), Expect = 3.921e-81
Identity = 166/513 (32.36%), Postives = 284/513 (55.36%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSK-LLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDD------SLPNC-VNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAGL 1677
            SNI AAKAVAD IRT LGPK M KM+ +  G + +TNDG  IL+ + + HPAA+ ++ELS+ QD E GDGTTTV++LAG  L  C+  L+ K IHP  I  +   A + A E+I+ +S PVD+ +   + K+   S+ +K V  +S  +  +A+DAV  ++ D        PN  +++     V K+ GG V D+ ++ G+++++ V        +EN ++  +   +   K E + +I +      +R+L+ E + +  + ++I A    +++ +K      VSDLA H+  K    +++ + K     I +  G   +  VE      +G    + +V +               +  +I+LRG +K +L+E +R+L DA+ V R ++   +L  GGGA E+ V  K+A  +  L G  Q+ ++A ADAM+ IP TL +NAG +PI  +++LR  HA G+   GI+  KG +++++   + +P ++   +V  A E+ C +L++DD+V+G+
Sbjct:   23 SNITAAKAVADVIRTCLGPKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEILAQCAPYLIEKNIHPVIIIQALKKALTDALEVIKQVSKPVDVENDAAMKKLIQASIGTKYVIHWSEKMCELALDAVKTVRKDLGQTVEGEPNFEIDIKRYVRVEKIPGGDVLDSRVLKGVLLNKDVVHPKMSRHIENPRVVLLDCPLEYKKGESQTNIEIEKEEDWNRILQIEEEQVQLMCEQILAVRPTLVITEK-----GVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGATIVNRVEDLKESDVGTNCGLFKVEMIGDEYFSFLDNCKEPKACTIMLRGGSKDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQNAGGDPIRLLSQLRAKHAQGNFTTGIDGDKGKIVDMVSYGIWEPEVIKQQSVKTAIESACLLLRVDDIVSGV 530          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Yeast
Match: TCP1 (Alpha subunit of chaperonin-containing T-complex; complex mediates protein folding in the cytosol; involved in actin cytoskeleton maintenance; overexpression in neurons suppresses formation of pathogenic conformations of huntingtin protein [Source:SGD;Acc:S000002620])

HSP 1 Score: 251.521 bits (641), Expect = 2.905e-76
Identity = 169/527 (32.07%), Postives = 278/527 (52.75%), Query Frame = 1
Query:  157 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEII-EGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVN--LDDLNIVNKLGGTVEDTELVDGLIIDRRV--ESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANV------EYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHI------------NAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            IRN N+LA  AVA+ +++SLGP G+DKM+ +  GD T+TNDGATIL  + + HPA ++LVEL++ QD E GDGTT+VV++A   L   ++L+   IHPTTI   F +A  +A   I E +S  VD   +  L+ IA TS++SK++   S   S + VDA+L ++  +    +   +  +N++   G +  ++ LV G  ++  V  +++       N KI  +   +   +  M   I + D  Q++++ K E   +LE VKKI  +G  V+L  K      + DL L  F +  IM V+   KE +  I +  G   ++++      E F +  LG    V +        + + G   H  + SI+LRG+N   LDE ERSLHD+L VV+  ++   +V GGG  E  +   +  ++ ++    Q     FA A+ +IP TLA NA  +  E V +LR  HA   +            N G+++ +G +++ +   V++P +  + ++  A E   +IL+ID ++
Sbjct:   25 IRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTKG-----IDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECILIKGTSKHSSS-SIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMI 545          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Yeast
Match: CCT7 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000003647])

HSP 1 Score: 221.861 bits (564), Expect = 3.226e-65
Identity = 163/511 (31.90%), Postives = 270/511 (52.84%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPV---DLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRR-----VESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKD-ERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            SNI A  AV +A++ +LGP G D +I       TI+NDGATILK + +VHPAA+ LV++S+AQD E GDGTT+V +LAG  +      L +GI    I   +  A S A E I  ++  +     + R  L + A T+++SK++   +     + VDAVL +  + L      D L  + K+ GG +E++  ++G+   +       E     F   N KI  +   +   KAE + + V  ++ +  + + D E + I E +++++ +G N++L      +  + DLA  FF   NI     ++ + +  + + +G    +       E LG     EE+ +G+ R     G     +T ++LLRG  + V+ E ERSLHDA+ +V+  ++ K +VAGGGA E+EV + +  YS +++G+ Q    AFA A++VIP  L ENAG + IE + +LR  H+ G    G+  +   + +   + V +P LV +NA++ A E    IL +D+ +
Sbjct:   28 SNINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKINELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAVLSLDRNDLD-----DKLIGIKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFN--NPKILSLNVEL-ELKAEKDNAEVRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLS-----KLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCALFEEMQIGSERYNLFQGCPQA-KTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHSKGEKWYGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETI 524          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Nematostella
Match: EDO29932 (T-complex protein 1 subunit delta [Source:UniProtKB/TrEMBL;Acc:A7T288])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 313/477 (65.62%), Postives = 406/477 (85.12%), Query Frame = 1
Query:  241 IQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCN-VFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            IQ G GDVTITNDGATILK+M+++HPAARMLVELSKAQDIEAGDGTTTVVV+AGS L+A +KLL +GIHPTT+S+SF LA+ KA EI+ GMS P+ LNDR +LLK A+TSLNSKVVSQYS++L+PI+VDAVL++ + S+ + V+L D+ IV KLGGTVEDTELV+GL++ +++  L   +  VE AKIG +QFCI+PPK +ME  ++VSDY QMDRVL++ER+YILEI KKIK +GCNVLL+QK++LRD+V+DLALHF +KM I++V+ I ++++EFICK+IGCKPIA++++FN + L  A+ VEEV VG S++V +TG+ +   TVS+L+RGSNKLVL+EA+RSLHDALCV+RCLVKK+AL+AGGGAPEIEV  ++A YS +L+    YC RAFA+A+++IPYTLAENAGLNPI TVTELR+ HA G + AGIN++KG V NI++E+V+QPLLVS +AV LA+ETV SILKIDD+V
Sbjct:    7 IQGGNGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTTVVVIAGSLLNAAAKLLERGIHPTTVSESFELASRKAVEILSGMSTPLALNDRESLLKSATTSLNSKVVSQYSNLLAPISVDAVLKVINPSVVDNVDLRDIRIVKKLGGTVEDTELVEGLVLQQKISHLAGGISQVEKAKIGLLQFCISPPKTDMENQVIVSDYAQMDRVLREERQYILEICKKIKKAGCNVLLIQKSILRDAVNDLALHFLSKMKILVVRDIERDEIEFICKSIGCKPIASLDHFNPDMLASAELVEEVSVGTSKVVKITGVSNPGNTVSVLVRGSNKLVLEEADRSLHDALCVIRCLVKKRALIAGGGAPEIEVALRLAEYSQTLTSMDAYCVRAFAEALEIIPYTLAENAGLNPIATVTELRNRHAQGEVTAGINVRKGTVTNILEENVLQPLLVSTSAVQLASETVRSILKIDDIV 483          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Nematostella
Match: EDO49571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP0])

HSP 1 Score: 314.694 bits (805), Expect = 4.713e-100
Identity = 191/506 (37.75%), Postives = 305/506 (60.28%), Query Frame = 1
Query:  160 RNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMS--CPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            + S+ILAA+AVA  ++TSLGPKGMDKM+    G+VT+TNDGATIL  M++ H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL  GIHP  I+D + LAA  A E ++ ++   PVD +++ +L++ A T+L SK+VS+    L+ IAVDAVL + D    + V+ + + +  K GG ++DT LV G+++D+ +        V++AKI  +     PPK + +  + V+      ++ + ER+   E++K++K +G N+ + Q         D A H   + ++  V+ +   ++E I    G + +       +E LG A  V E+  G ++   +   E H+ + V+I +RG NK+++ EA+RS+HDALCVVR LV+   +V GGGA E+     +A  ++ +S   QY  RA+ADA+D IP  LAEN+GLNPI+TV +++    A  +   G++     + ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   40 QKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPVDKDNKESLIQTAMTTLGSKIVSRCHRPLAEIAVDAVLSVADLERKD-VDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWG-----FDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKISTIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAEKNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDI 539          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Nematostella
Match: EDO27411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9B6])

HSP 1 Score: 286.574 bits (732), Expect = 1.332e-89
Identity = 183/504 (36.31%), Postives = 292/504 (57.94%), Query Frame = 1
Query:  160 RNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            + S+ILAA+AVA  ++TSLGPKGMDKM+    G+VT+TNDGATIL  M++ H  A+++VELSK+QD E GDGTT VVVLAG+ L+   +LL  GIHP  I+D + LAA  A E ++ ++        N  L +  +      VS+    L+ IAVDAVL + D    + V+ + + +  K GG ++DT LV G+++D+ +        V++AKI  +     PPK + +  + V+      ++ + ER+   E++K++K +G N+ + Q         D A H   + ++  V+ +   ++E I    G + +       +E LG A  V E+  G ++   +   E H+ + V+I +RG NK+++ EA+RS+HDALCVVR LV+   +V GGGA E+     +A  ++ ++   QY  RA+ADA+D IP  LAEN+GLNPI+TV +++    A  +   G++     + ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   28 QKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIA-------DNFPLPLGYS------VSRCHRPLAEIAVDAVLSVADLERKD-VDFELIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWG-----FDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKIATIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAEKNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDI 512          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Nematostella
Match: EDO35415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL4])

HSP 1 Score: 268.47 bits (685), Expect = 2.064e-82
Identity = 165/507 (32.54%), Postives = 286/507 (56.41%), Query Frame = 1
Query:  169 NILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEII-EGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ-DDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEV-PVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAG 1674
            N+ AAK +AD IRT LGP+ M KM+ +  G + +TNDG  IL+ +++ HPAA+ ++E+S+ QD E GDGTT+V++LAG F+      L + +HPT I  ++ LA     +I+ + +S PVD+++R  +LKI  +S+ +K ++++  +   IA+DAV  +  D      +++ +   V K+ GG +ED++++ G++I++ V        +EN +I  +   +   K E + S+ +S  T   RVL+ E ++I ++  ++ A   ++++ +K      +SDLA HF  K NI  ++ + K     I +  G   +   E    E +G    + EV   G      +T   ++ +  +ILLRG++K VL+E ER+L DA+ V R ++    LV GGGA E+ +   +   +  ++G  Q+ ++A A  ++VIP TL +N G N I T+T LR  H A G+ + GI+ + G ++++ +  V     V       A ET   +L+IDD+V+G
Sbjct:   22 NVQAAKTIADIIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQISVPVDIDNREEMLKIIRSSVGTKFINKWGDLACNIALDAVKTVALDRGDRKEIDIKNYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEK-----GISDLAQHFLMKANITAIRRVRKTDNNRIARACGATIVNRTEELKEEDIGTGAGLFEVNKFGDEYFTFITEC-NNPKACTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRAKHAAEGNTSWGIDGESGQIVDMQELGVWDTYAVKAQTFKTALETAMLLLRIDDIVSG 522          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Nematostella
Match: EDO48692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF0])

HSP 1 Score: 254.988 bits (650), Expect = 3.505e-77
Identity = 168/512 (32.81%), Postives = 280/512 (54.69%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLND----RNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESL---CNVFTVENAKIGFIQFCIAPPKAEMEQSIV----VSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            SNI A + +ADA+RT+LGP+GMDK+I +G+G  TI+NDGATI+  + +VHPAA+ LV+++K+QD E GDGTT+V +L G FL    + + +G+HP  I  S+  AA+ A + I+ ++  V  ND    R  L + A+T+L+SK+++      + + VDAV+ + D+ LP    LD + +    GG +ED+ L++G+   +            T  + KI  +   +   KAE E + V    V DY     ++  E   + + + K+  SG  V+L +       + D+A  +F   ++     + +E ++   K  G     +V     + LG     EE  VG  R    +G +    T +I++RG  +  ++E ERSLHDA+ +VR  +K  A+VAGGGA E+E+ + +  YS +++G+ Q    A A A ++IP  L +NAG +    + +LR  H  G    G++I +  + +  +  V +P +V +NA++ A E  C IL +D+ +
Sbjct:   23 SNIDACQFIADAVRTTLGPRGMDKLIVDGRGKATISNDGATIINLLDIVHPAAKTLVDIAKSQDAEVGDGTTSVTLLTGEFLKQVKQFVEEGVHPQIIVKSYRKAANLAIKRIKELAVHVKKNDAGEMRQLLERCAATALSSKLIATQKEFFAKMVVDAVMML-DELLP----LDMIGMKKVSGGALEDSMLIEGVAFKKTFSYAGFEMQPKTYNHCKIALLNVEL-ELKAEKENAEVRLDNVKDYQS---IVDAEWDILYDKLDKVVKSGAKVVLSKL-----PIGDVATQYFADRDMFCAGRVTEEDLKRTMKACGGAIQTSVNSMTDDVLGRCDLFEEKQVGGERYNFFSGCKQS-TTCTIIMRGGAEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIEMELSKYLRDYSRTIAGKEQLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQKHFQGGQWYGVDINREDIADNFEACVWEPAVVKINAITAATEASCLILSVDETI 519          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 325/508 (63.98%), Postives = 422/508 (83.07%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADA+RTSLGPKGMDKMIQ+ KGDVTITNDGATILK+M+++HP+A+MLVELSKAQD+EAGDGTT+VV++AG+ L+ACSKLL KGIHPT IS+SF  A  K  E++ GMS PV+L+DR +LL  A+TSL SKVVSQYSS+L+P++VDAV+R+ D +    V+L+++ I+ KLGGT++D ELV+GL++ +RV S   V  VE AKIG IQFC++PPK +M+  IVVSDY QMDRVL++ER YIL +VK++K +GCNVLL+QK++LRD++SDLALHF NKM IM+VK I +E++EFICKTIG KPIA++++F  E LG A+  EE+ + G+ ++V +TG     +TVSI++RGSNKLV+DEAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +L+G   YC RA+ DA++VIP TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QP+LVS++A++LA ETV SILKIDDVV
Sbjct:   27 PAQIRFSNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSRPVELSDRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVLTQRVAS-TGVTRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQGDKMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVV 533          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 303/509 (59.53%), Postives = 393/509 (77.21%), Query Frame = 1
Query:  148 PAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLR-DSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPV-GASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            PA IR SNI AAKAVADA+RTSLGPKGMDKM                              LVELSKAQD+EAGDGTT+VV++AG+ L+ACSKLL KGIHPT IS+SF  A  K  E++ GMS PV+L+DR +LL  A+TSL SKVVSQYSS+L+P++VDAV+R+ D +    V+L+++ I+ KLGGT++D ELV+GL++ +RV S   V  VE AKIG IQFC++PPK +M+  IVVSDY QMDRVL++ER YIL +VK++K +GCNVLL+QK++LR D++SDLALHF NKM IM+VK I +E++EFICKTIG KPIA++++F  E LG A+  EE+ + G+ ++V +TG     +TVSI++RGSNKLV+DEAERS+HDALCV+RCLVKK+AL+AGGGAPEIE+  ++  YS +L+G   YC RA+ DA++VIP TLAENAGLNPI TVTELR+ HA G   AGIN++KG + NI++E V+QP+LVS++A++LA ETV SILKIDDVV
Sbjct:   27 PAQIRFSNISAAKAVADAVRTSLGPKGMDKM------------------------------LVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMSRPVELSDRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRVIDPATATGVDLNNIKIIKKLGGTIDDCELVEGLVLTQRVAS-TGVTRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRYDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQGDKMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVV 504          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Medaka
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:101171367])

HSP 1 Score: 283.108 bits (723), Expect = 1.795e-87
Identity = 182/505 (36.04%), Postives = 298/505 (59.01%), Query Frame = 1
Query:  166 SNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGM--SCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEH--HYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHA-NGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
            S+I+AAKAVA  +RTSLGP G+DKM+ +  G+VT+TNDGATIL  M + H  A+++VELSK+QD E GDGTT VVVLAG+ L+    LL +GIHP  ISD ++ AA  A E ++ +  + P D N+   L++ A T+L SKV+++    ++ IAV+A+L + D    + V+ + + +  K+GG +EDT+L+ G+I+D+          +++ KI  +     PPK + +  + V+       + K E++   E+++++K++G N+ + Q         D A H   +  +  V+ +   ++E I    G + +        E LG A  V+E+  G ++  H+  I+   + + V+I +RG NK++++EA+R+LHDALCV+R L++   +V GGGA EI     +   ++      QY  R+FADA++VIP  LAEN+GLNPI+T+ E+R     + +   GI+       ++  + V++ L+     +SLA + V  ILKIDD+
Sbjct:   36 SHIMAAKAVAGTLRTSLGPNGLDKMMVDRDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAELLLDRGIHPIRISDGYDQAARIAIEKLDKIAETFPCDPNNLEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADMQRKD-VDFELIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKELKDVKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQVKSNGANLAICQW-----GFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFSELTPEKLGTAGLVKELSFGTTK-DHMLVIQECKNTRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLIRDNRVVYGGGASEIACALAVNRAADKCPSLEQYAMRSFADALEVIPMALAENSGLNPIQTMAEVRARQVKDNNPFLGIDCLHKNTNDMKQQHVIETLIAKKQQISLATQVVRMILKIDDI 533          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Medaka
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:105355033])

HSP 1 Score: 279.256 bits (713), Expect = 4.863e-86
Identity = 166/510 (32.55%), Postives = 289/510 (56.67%), Query Frame = 1
Query:  157 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ-DDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEV-PVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHAN-GHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAG 1674
            ++  NI AAK +AD IRT LGP+ M KM+ +  G + +TNDG  IL+ +++ HPAA+ ++E+S+ QD E GDGTT+V++LAG  L      L + +HPT I  ++  A     E ++ +S PVD +DR+ +LKI ++++N+K + ++S +   IA+DAV  ++ +++    +++ +   V K+ GG +ED+ ++ G++I++ V        ++N +I  +   +   K E +  I +S      R+L+ E  YI +I + I     +++  +K      +SDLA H+  K NI  ++ + K     I +  G + ++  +    E +G    + EV  +G      +T  +   +  +ILLRG++K +L E ER+L DA+ V R ++    L+ GGGA E+ V +++   S +L+G  Q+ +RA A A++VIP TL +N G + I  +T LR  H   G++  GIN + GC+ ++    + +PL V       A ET   +L+IDD+V+G
Sbjct:   21 VQTGNISAAKMIADVIRTCLGPRAMMKMLLDPTGGIVMTNDGNAILREIQVQHPAAKTMIEISRTQDEEVGDGTTSVIILAGEMLSIAEHFLEQQMHPTVIISAYRQALEDMLEALKEVSTPVDTSDRSMMLKIVNSAINTKALFRWSDLACTIALDAVRTVELEENGRKEIDIKNYAKVEKVPGGFIEDSCVLKGVMINKDVTHPKMRRMIKNPRIVLLDCSLEYKKGESQTDIEISKEEDFSRILQMEEDYIQQICEDIVRLKPDLIFTEK-----GISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGLGAGLFEVKKIGDEYFTFITECKDP-KACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPFLLPGGGAVEMAVSKRLTERSRALTGIEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGNVGWGINGESGCLTDMSTLGIWEPLAVKAQTYKTAVETAILLLRIDDIVSG 524          
BLAST of T-complex protein 1 subunit delta vs. Ensembl Medaka
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:101175451])

HSP 1 Score: 268.085 bits (684), Expect = 1.181e-81
Identity = 172/522 (32.95%), Postives = 289/522 (55.36%), Query Frame = 1
Query:  154 AIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEII-EGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQ--DDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIG---CKPIANV---EYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINA--------GINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            ++R  N++AA ++A+ +++SLGP G+DKM+ +  GDVTITNDGATILK +++ HPAA++L EL+  QD E GDGTT+VV+LA   L +  +L+ + IHPT++ + + LA  +A   I E ++   D   R  L+  A TS++SK++   S   + + VDA L ++  D        ++ +N++   G + E++ LV+G  ++  V S   V  + NAKI  + F +   K +M   +++SD  ++D++ + E     E ++KI A+G NV+L         + D+ L +F     M V+ + K  ++ I K  G   C  ++N+   E F    LG A+ V +  +    ++ V   +    + SI+LRG+N  + DE ERS+HDALCVV+ +++ K++V GGGA E  +   +  Y+ S+    Q     FA ++ VIP TLA NA  +  + V +LR  H    +N         G+++  G   +     V +P +V   ++  A E   +IL+IDD++
Sbjct:   19 SVRTQNVMAAASIANIVKSSLGPYGLDKMLVDDIGDVTITNDGATILKMLEVEHPAAKVLCELADLQDKEVGDGTTSVVILAAELLKSADELVKQKIHPTSVINGYRLACKEAVRYINENLTIGTDDLGRECLINAAKTSMSSKIIKVDSDFFANMVVDAALAVKFVDSKGVAKYPINSVNVLKAHGRSQEESFLVNGYALNCTVGSQGMVKRIVNAKIACLDFSLQKAKMKMGVQVIISDPEKLDQIRQRESDITKERIQKILAAGANVVLTT-----GGIDDMCLKYFVDSGAMAVRRVLKRDLKRIAKATGAIVCPSLSNLEGEETFETTMLGQAEEVVQERICDDELILVKNTKVR-SSASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLLNGKPRDNRQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534          
BLAST of T-complex protein 1 subunit delta vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 543/544 (99.82%), Postives = 544/544 (100.00%), Query Frame = 1
Query:   49 MSETANLVSMANQGQDCXXXXXXXXXXXXXXXXPAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAGLV 1680
            MSETANLVSMANQGQDCFKEKSSSKHEFSDKSKPAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSG+SQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVVAGLV
Sbjct:    1 MSETANLVSMANQGQDCFKEKSSSKHEFSDKSKPAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVVAGLV 544          
BLAST of T-complex protein 1 subunit delta vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 534/535 (99.81%), Postives = 535/535 (100.00%), Query Frame = 1
Query:   76 MANQGQDCXXXXXXXXXXXXXXXXPAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAGLV 1680
            MANQGQDCFKEKSSSKHEFSDKSKPAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSG+SQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVVAGLV
Sbjct:    1 MANQGQDCFKEKSSSKHEFSDKSKPAAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVVAGLV 535          
BLAST of T-complex protein 1 subunit delta vs. Planmine SMEST
Match: SMESG000078668.1 (SMESG000078668.1)

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 331/506 (65.42%), Postives = 418/506 (82.61%), Query Frame = 1
Query:  151 AAIRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVV 1668
            +A+R+SNI AAKAVAD +RTSLGP+GMDKMIQE KGDVT+TNDGATILKRMKL+HPAA+M+V+LS++QDIEAGDGTT+VVV+AGS L ACSKLL KGIHPT IS++F  AA  A E+++  S  +D+++R  LLKIASTSLNSKVV QYSSVL+PIAVDAVLR  D +  + VNL+D+ I  K GGTVEDT LVDGLIIDR VES+CNV  VE AKI  I+FCI+PPK  M+ S+VVS+Y+QMDRV+ +ERKYIL I K IK+SGCNVLL+QK++LRD+++DLALHFF+K+NIM++K I +  VE  CK + CKPIA++++FN +    A  VEE+  G SRIV V+GI +    VSIL+ GSN +VL EAERSLHDALCV+RCLVKK AL+AGGGAPEI + Q +A YS  + G  QYC RA+ADA+++IPYTLAEN+GL+PI+TVTELR+ HA G +NAGIN+K+GCV +I+ +DVMQPLL++ +A++LA ETVC++LKIDD+V
Sbjct:   17 SAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHSQEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKT-SHSVNLNDIKITMKFGGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHFNPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVNAGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIV 521          
BLAST of T-complex protein 1 subunit delta vs. Planmine SMEST
Match: SMESG000012740.1 (SMESG000012740.1)

HSP 1 Score: 290.041 bits (741), Expect = 2.642e-90
Identity = 177/505 (35.05%), Postives = 290/505 (57.43%), Query Frame = 1
Query:  163 NSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSCPVDLNDRNN--LLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQDDSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIE-HHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMH-ANGHINAGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDV 1665
             S+I+AAK V++ +RTSLGPKG+DK++     D+T+TNDG TI++ M + H  A+++VELSK+QD E GDGTT VVVLAGS L+   +LL +GIHP  ISD + +AA    E ++ +S     +  N   L++ A T+L SK+V++     + +AV A+L + D    + V+ + + +  K+GGT+ D+ LV G+I+D+         ++++AKI  +     PPK + + ++ V      + + K E    +E+V ++KASG N+++ Q         D A H   + N+  V+ +   ++E I    G + +   E    E LG A  V E+  G ++   +   E  + + V+  +RG +++++DEA+RSLHDALCVVR LV+   +V GGGA EI     ++  ++ + G  QY  RAFA+A++ IP  L+EN+GL  I TV EL+       +   G++ K+    ++ ++ V++ L      + LA +    ILKIDD+
Sbjct:   37 KSHIMAAKTVSNILRTSLGPKGLDKIMVNPDNDITVTNDGRTIMEMMDVEHEIAKLMVELSKSQDDEIGDGTTGVVVLAGSLLEQAEQLLERGIHPIRISDGYEMAAKLCLEELDKISDQFVFSKENKEPLIQTAMTTLGSKIVNKCHRQFAEMAVGAILSVADIERKD-VDFELIKVDGKVGGTLSDSILVKGVIVDKDFSHPQMPKSIKDAKIAILTCAFEPPKPKTKHNLYVETVKDFENLAKYEHDKFVEMVDQVKASGANLVICQWG-----FDDEANHLLYQKNLPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGNAGIVRELSFGTTKDKMLVIEECKNSKAVTCFIRGGSRMIVDEAKRSLHDALCVVRNLVRDPRVVYGGGASEIACSLAVSNAADQIPGLEQYAMRAFAEALEAIPIALSENSGLPSISTVAELKARQLKEANPRLGVDCKRVGTCDMKEQLVLETLSSKKAQIMLAVQVCKMILKIDDI 535          
BLAST of T-complex protein 1 subunit delta vs. Planmine SMEST
Match: SMESG000066978.1 (SMESG000066978.1)

HSP 1 Score: 256.914 bits (655), Expect = 8.689e-78
Identity = 163/513 (31.77%), Postives = 288/513 (56.14%), Query Frame = 1
Query:  157 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSC-PVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRI-QDDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVP-VGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGESQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHIN---AGINIKKGCVINIMDEDVMQPXXXXXXXXXXXXETVCSILKIDDVVAG 1674
            ++  NI AAK VAD IRT LGP+ M KM+    G + +TNDG  IL+ + +  PAA+ ++E+++ QD E GDGTT+V++LAG  L   + LL + IHPT I  ++  A   + E ++  +C  VD  +R+ +LK+  + L +K ++++S +   IA+DAV ++  D++    +++     + K+ GG +ED+ ++ G++ ++ +        +EN +I  +   I   K E + S+ +++   M R L+ E +Y+ ++   I     ++++ +K      VSDLA H+F K NI +++ + K     + +  G   I+N++    E +G    + E+  +G      +T  +   +  SILLRGS+K VL+E ER+L DA+ V R ++ +  LV GGGA E+ +   +   + ++ G  Q  + A A+A++VIP TLA+N G   +  +TELR  HA    N    G++ ++G ++++    V  PL V    +  A ET   +L+IDD+++G
Sbjct:   21 VQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHVDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEK-----GVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEP-KACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSG 527          
The following BLAST results are available for this feature:
BLAST of T-complex protein 1 subunit delta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT40.000e+065.16chaperonin containing TCP1 subunit 4 [Source:HGNC ... [more]
CCT40.000e+060.24chaperonin containing TCP1 subunit 4 [Source:HGNC ... [more]
CCT59.579e-10138.42chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
CCT52.018e-10038.39chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
CCT51.384e-9938.25chaperonin containing TCP1 subunit 5 [Source:HGNC ... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct-40.000e+060.24T-complex protein 1 subunit delta [Source:UniProt... [more]
cct-40.000e+060.24T-complex protein 1 subunit delta [Source:UniProt... [more]
cct-55.263e-10338.02T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-55.263e-10338.02T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-21.257e-8335.09T-complex protein 1 subunit beta [Source:UniProtK... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT40.000e+062.13gene:FBgn0032444 transcript:FBtr0080411[more]
CCT51.963e-9435.90gene:FBgn0010621 transcript:FBtr0087988[more]
CCT55.053e-9436.04gene:FBgn0010621 transcript:FBtr0087987[more]
CCT13.827e-8031.55gene:FBgn0003676 transcript:FBtr0084290[more]
CCT13.827e-8031.55gene:FBgn0003676 transcript:FBtr0084291[more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+064.37chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct56.582e-9737.10chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct31.888e-8131.62chaperonin containing TCP1, subunit 3 (gamma) [Sou... [more]
tcp13.474e-8133.14t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
tcp14.319e-8133.14t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+064.17chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+064.17chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+064.17chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+064.17chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+064.17chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cct40.000e+064.76chaperonin containing Tcp1, subunit 4 (delta) [Sou... [more]
Cct40.000e+059.84chaperonin containing Tcp1, subunit 4 (delta) [Sou... [more]
Cct59.072e-9737.82chaperonin containing Tcp1, subunit 5 (epsilon) [S... [more]
Cct39.696e-8331.76chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct34.688e-7831.06chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2T9X2|TCPD_BOVIN0.000e+065.16T-complex protein 1 subunit delta OS=Bos taurus OX... [more]
sp|P50991|TCPD_HUMAN0.000e+065.16T-complex protein 1 subunit delta OS=Homo sapiens ... [more]
sp|Q5R637|TCPD_PONAB0.000e+064.96T-complex protein 1 subunit delta OS=Pongo abelii ... [more]
sp|P80315|TCPD_MOUSE0.000e+064.76T-complex protein 1 subunit delta OS=Mus musculus ... [more]
sp|Q7TPB1|TCPD_RAT0.000e+064.76T-complex protein 1 subunit delta OS=Rattus norveg... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183RSL50.000e+068.82T-complex protein 1 subunit delta OS=Schistosoma r... [more]
H2KNK70.000e+070.33T-complex protein 1 subunit delta OS=Clonorchis si... [more]
A0A4S2M9660.000e+070.08T-complex protein 1 subunit delta OS=Opisthorchis ... [more]
A0A4S2M9550.000e+070.02T-complex protein 1 subunit delta OS=Opisthorchis ... [more]
A0A0R3TC910.000e+068.31T-complex protein 1 subunit delta OS=Rodentolepis ... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+064.26chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct59.793e-9536.51chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct52.455e-8335.52chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct35.012e-8332.16chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
tcp12.874e-8133.33t-complex 1 [Source:NCBI gene;Acc:103041096][more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+065.88chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct51.335e-9536.88chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct73.009e-7034.38chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
ENSPMAT00000002042.11.600e-4730.27pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 ge... [more]
ENSPMAT00000002094.19.442e-3537.81pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCT40.000e+054.42Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT53.754e-8835.40Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT33.921e-8132.36Subunit of the cytosolic chaperonin Cct ring compl... [more]
TCP12.905e-7632.07Alpha subunit of chaperonin-containing T-complex; ... [more]
CCT73.226e-6531.90Subunit of the cytosolic chaperonin Cct ring compl... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO299320.000e+065.62T-complex protein 1 subunit delta [Source:UniProt... [more]
EDO495714.713e-10037.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274111.332e-8936.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354152.064e-8232.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486923.505e-7732.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct40.000e+063.98chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct40.000e+059.53chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
cct51.795e-8736.04chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
cct34.863e-8632.55chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
tcp11.181e-8132.95t-complex 1 [Source:NCBI gene;Acc:101175451][more]
back to top
BLAST of T-complex protein 1 subunit delta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060610.10.000e+099.82SMESG000060610.1[more]
SMESG000060610.10.000e+099.81SMESG000060610.1[more]
SMESG000078668.10.000e+065.42SMESG000078668.1[more]
SMESG000012740.12.642e-9035.05SMESG000012740.1[more]
SMESG000066978.18.689e-7831.77SMESG000066978.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015458 ID=SMED30015458|Name=T-complex protein 1 subunit delta|organism=Schmidtea mediterranea sexual|type=transcript|length=1843bp
CAAAGAGTCGATAACTAATAATTAAATATTTATTTGTGTAATTCAAAAAT
GTCAGAAACCGCCAATTTAGTTTCTATGGCCAATCAGGGCCAGGACTGTT
TCAAAGAGAAATCTTCATCGAAACATGAATTTTCTGATAAAAGTAAGCCG
GCAGCTATAAGAAATAGCAACATTCTGGCGGCCAAAGCGGTCGCCGATGC
CATCCGTACAAGTTTGGGACCTAAAGGAATGGACAAAATGATTCAAGAAG
GAAAAGGTGATGTGACTATTACAAACGACGGAGCAACTATTCTAAAAAGA
ATGAAGTTAGTTCATCCGGCAGCTAGAATGTTAGTCGAACTTTCTAAGGC
CCAAGATATTGAAGCCGGAGATGGGACAACTACTGTTGTAGTGCTAGCTG
GATCATTTCTTGATGCATGCTCCAAGCTGCTATCCAAAGGCATTCACCCA
ACTACAATATCGGATTCATTTAATCTCGCAGCATCGAAAGCGGCAGAGAT
CATTGAAGGAATGTCCTGTCCAGTAGATTTAAACGACAGAAATAATTTAT
TGAAGATCGCTTCAACTTCATTGAACTCAAAAGTTGTCTCGCAGTATTCA
TCAGTTTTATCGCCGATAGCAGTCGATGCAGTTTTACGGATTCAAGACGA
TTCTTTGCCCAACTGCGTGAACCTGGACGATTTAAACATTGTTAATAAAT
TAGGCGGCACAGTTGAAGACACAGAGCTTGTTGATGGGCTCATTATTGAT
AGACGCGTTGAATCGCTGTGCAACGTATTTACGGTGGAGAACGCAAAAAT
AGGATTTATTCAATTCTGCATTGCGCCACCTAAAGCTGAGATGGAGCAAA
GCATAGTCGTGTCAGATTATACACAAATGGACCGGGTTTTAAAGGATGAA
CGGAAATATATATTAGAAATAGTGAAGAAAATCAAAGCCTCCGGCTGCAA
TGTTCTTTTGGTACAAAAGAACGTCTTGCGTGATTCCGTCAGTGATTTAG
CCCTTCATTTTTTCAATAAAATGAATATTATGATTGTCAAAGCCATAGCC
AAGGAGAAGGTGGAGTTTATTTGCAAAACAATCGGATGCAAGCCAATAGC
AAATGTTGAATACTTTAACGCAGAATGCCTAGGGTTTGCTAAAAGAGTTG
AAGAAGTCCCAGTCGGAGCTTCAAGGATAGTGCACGTTACCGGAATAGAA
CATCACTACCAAACCGTGTCGATATTATTAAGAGGTTCTAATAAGCTTGT
TCTTGATGAAGCTGAAAGGTCTCTCCATGATGCACTTTGTGTAGTCAGAT
GCTTAGTTAAAAAAAAAGCCCTGGTGGCAGGTGGAGGTGCCCCCGAGATT
GAGGTCGGGCAGAAAATGGCAGCTTATTCTAATTCACTGAGCGGTGAAAG
TCAGTATTGTTTCAGAGCTTTTGCTGATGCAATGGATGTTATTCCATATA
CATTAGCAGAAAATGCGGGCTTAAATCCAATTGAAACAGTAACAGAACTT
AGGCACATGCACGCAAACGGACACATCAACGCAGGAATTAATATTAAAAA
AGGTTGCGTGATCAACATCATGGACGAGGATGTAATGCAGCCGCTACTTG
TCAGTTTGAATGCAGTTTCCCTGGCTGCTGAGACGGTCTGTTCTATATTG
AAAATAGACGATGTGGTCGCCGGGTTGGTTTAATGCGATTTGTGATATCA
TTGAGCGTTATGTTATTCAACATTTCAAGATTAATTAAAATCTACGATAA
ATGGACATTTTTCGTTAAGTTCGTTTTGAATTTTTAAGTTAATATTTCAC
TTGATTAATTGTTTTATTAAATAAATAATATGAGATATTGTTA
back to top

protein sequence of SMED30015458-orf-1

>SMED30015458-orf-1 ID=SMED30015458-orf-1|Name=SMED30015458-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=545bp
MSETANLVSMANQGQDCFKEKSSSKHEFSDKSKPAAIRNSNILAAKAVAD
AIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSK
AQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAE
IIEGMSCPVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRIQD
DSLPNCVNLDDLNIVNKLGGTVEDTELVDGLIIDRRVESLCNVFTVENAK
IGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGC
NVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPI
ANVEYFNAECLGFAKRVEEVPVGASRIVHVTGIEHHYQTVSILLRGSNKL
VLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGE
SQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHINAGINIK
KGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVVAGLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0002030early male germ cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR012717Chap_CCT_delta
IPR017998Chaperone_TCP-1
IPR002423Cpn60/TCP-1
IPR027409GroEL-like_apical_dom_sf
IPR027413GROEL-like_equatorial_sf
IPR027410TCP-1-like_intermed_sf
IPR002194Chaperonin_TCP-1_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017998Chaperone tailless complex polypeptide 1 (TCP-1)PRINTSPR00304TCOMPLEXTCP1coord: 391..413
score: 34.62
coord: 425..437
score: 43.01
coord: 72..90
score: 44.59
coord: 102..121
score: 55.07
coord: 50..66
score: 46.11
IPR012717T-complex protein 1, delta subunitTIGRFAMTIGR02342TIGR02342coord: 29..541
e-value: 1.1E-249
score: 827.2
IPR012717T-complex protein 1, delta subunitCDDcd03338TCP1_deltacoord: 30..540
e-value: 0.0
score: 846.57
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 48..541
e-value: 3.1E-154
score: 514.2
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 230..386
e-value: 6.8E-170
score: 568.0
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 224..396
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 41..540
e-value: 6.8E-170
score: 568.0
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 33..541
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 160..423
e-value: 6.8E-170
score: 568.0
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 163..422
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..18
NoneNo IPR availablePANTHERPTHR11353CHAPERONINcoord: 24..541
NoneNo IPR availablePANTHERPTHR11353:SF26T-COMPLEX PROTEIN 1 SUBUNIT DELTAcoord: 24..541
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00750TCP1_1coord: 53..65
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00995TCP1_3coord: 102..110
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00751TCP1_2coord: 74..90