SMED30015457

Overview
NameSMED30015457
Smed IDSMED30015457
Length (bp)1601
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015457 (SMED30015457) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015457 (SMED30015457) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015457 (SMED30015457) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015457 (SMED30015457) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015457

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015457SMESG000022017.1 SmedASXL_018124SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015457SMESG000022017.1 SmedASXL_018124SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30015457SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015457SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015457SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015457SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015457SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015457SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015457SMESG000022017.1 Contig21719newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015457SMESG000022017.1 Contig21719uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30015457SMESG000022017.1 dd_Smed_v6_9360_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30015457 vs. Ensembl Human
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 342.813 bits (878), Expect = 4.465e-105
Identity = 192/455 (42.20%), Postives = 315/455 (69.23%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K E +EA +Y++LK E+   +++L L KL++NEVE  ++ KE   K +E+   + + +++++++K  +K++ K  REQ  IE+EIK+                P++IK  +   H + K + +KK+ ++A++ +   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK+ E  +  EVE A +RI+EINKEL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  175 KEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKE-------KDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 619          

HSP 2 Score: 94.3597 bits (233), Expect = 1.809e-19
Identity = 51/95 (53.68%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI AERKEAK     +   Q +K+
Sbjct:   98 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKD 192          
BLAST of SMED30015457 vs. Ensembl Human
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 342.428 bits (877), Expect = 7.007e-105
Identity = 192/455 (42.20%), Postives = 315/455 (69.23%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K E +EA +Y++LK E+   +++L L KL++NEVE  ++ KE   K +E+   + + +++++++K  +K++ K  REQ  IE+EIK+                P++IK  +   H + K + +KK+ ++A++ +   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK+ E  +  EVE A +RI+EINKEL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  197 KEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKE-------KDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 94.3597 bits (233), Expect = 1.790e-19
Identity = 51/95 (53.68%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI AERKEAK     +   Q +K+
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKD 214          
BLAST of SMED30015457 vs. Ensembl Human
Match: SMC1B (structural maintenance of chromosomes 1B [Source:HGNC Symbol;Acc:HGNC:11112])

HSP 1 Score: 266.544 bits (680), Expect = 2.040e-90
Identity = 160/464 (34.48%), Postives = 280/464 (60.34%), Query Frame = -2
Query:    2 EKRQ-KIEIDEAAKYKKLKTELNTKRIELHLLKLFYNE--VETNEIQKEHVK-----KKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFP-GVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1366
            E+RQ K+E +EA +Y+ L  EL   +I+L L +L++NE  +     + EHV      K+E L  HEN        +K+ +K+     R+    E+E+K  E              P++IK  +   H + K   +KK+ + + +Q    ++++  L++++  ++     +E +  +  + K R++ELE +QL  Y +LK++V +K + ++  L+ L  E    ++     +RR  E+  + K+ + ++ + +KR++KL EY  +    + E+K+ EET+  E+E    R+ E+N+EL L+ + L  A ++ HE  R  K+ E++E+LKRL+P  V GRL ++C P H+KYQ+A+TKV G+++ AIV  ++K AKDCI+++K++R EPETFL LD+LD++PI+E+LR+++      +V+DVI+ +   +KK +QF CGN LVC+T+E AR +A +  ER+KTV+L
Sbjct:  195 ERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENI-------VKARKKEHGMLTRQLQQTEKELKSVE-------TLLNQKRPQYIKAKENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEVNEELNLIRSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGRLFDLCHPIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELK---GCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVAL 641          

HSP 2 Score: 87.4261 bits (215), Expect = 2.040e-90
Identity = 47/81 (58.02%), Postives = 60/81 (74.07%), Query Frame = -1
Query: 1353 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1595
            +LE+  I++KA+N LVFQGTVESI++K  KER Q  EEIS S E   EYE  K +++K EE+A  N NKKKNI AER++AK
Sbjct:  120 ELEKIGIIVKAQNCLVFQGTVESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAK 200          
BLAST of SMED30015457 vs. Ensembl Human
Match: SMC1B (structural maintenance of chromosomes 1B [Source:HGNC Symbol;Acc:HGNC:11112])

HSP 1 Score: 266.159 bits (679), Expect = 2.390e-90
Identity = 160/464 (34.48%), Postives = 280/464 (60.34%), Query Frame = -2
Query:    2 EKRQ-KIEIDEAAKYKKLKTELNTKRIELHLLKLFYNE--VETNEIQKEHVK-----KKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFP-GVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1366
            E+RQ K+E +EA +Y+ L  EL   +I+L L +L++NE  +     + EHV      K+E L  HEN        +K+ +K+     R+    E+E+K  E              P++IK  +   H + K   +KK+ + + +Q    ++++  L++++  ++     +E +  +  + K R++ELE +QL  Y +LK++V +K + ++  L+ L  E    ++     +RR  E+  + K+ + ++ + +KR++KL EY  +    + E+K+ EET+  E+E    R+ E+N+EL L+ + L  A ++ HE  R  K+ E++E+LKRL+P  V GRL ++C P H+KYQ+A+TKV G+++ AIV  ++K AKDCI+++K++R EPETFL LD+LD++PI+E+LR+++      +V+DVI+ +   +KK +QF CGN LVC+T+E AR +A +  ER+KTV+L
Sbjct:  195 ERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKKIHLLNTKLEHVNRDLSVKRESLSHHENI-------VKARKKEHGMLTRQLQQTEKELKSVE-------TLLNQKRPQYIKAKENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILHKKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGNLKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEVNEELNLIRSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGRLFDLCHPIHKKYQLAVTKVFGRFITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELK---GCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVAL 641          

HSP 2 Score: 87.4261 bits (215), Expect = 2.390e-90
Identity = 47/81 (58.02%), Postives = 60/81 (74.07%), Query Frame = -1
Query: 1353 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1595
            +LE+  I++KA+N LVFQGTVESI++K  KER Q  EEIS S E   EYE  K +++K EE+A  N NKKKNI AER++AK
Sbjct:  120 ELEKIGIIVKAQNCLVFQGTVESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEEDAQFNFNKKKNIAAERRQAK 200          
BLAST of SMED30015457 vs. Ensembl Human
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 94.3597 bits (233), Expect = 4.385e-21
Identity = 51/95 (53.68%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI AERKEAK     +   Q +K+
Sbjct:   98 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKD 192          
BLAST of SMED30015457 vs. Ensembl Celegans
Match: him-1 (Structural maintenance of chromosomes protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O01789])

HSP 1 Score: 194.897 bits (494), Expect = 4.422e-53
Identity = 155/477 (32.49%), Postives = 252/477 (52.83%), Query Frame = -2
Query:    2 SQNEKRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKS----HRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIE-----------EINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFP-GVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGE---RKKTVSL 1375
            +Q ++  K+E DEA KY+ +K EL  K   L L +LF+ E   +E ++E   +K+ + S E  R++ + +I +    HRK +           +E++K  +                + +   + H   K + +KK   +A  +   N  +LA L+     +E+ K+ YE  + Q  +++G  L L   Q++EY +LK +   +++ +   L    + +   K   +   RR+ E     K KE ++     ++  L + I          KE EE  ++ +++  K+IE           E NKEL  VV  L EA  +  E  R  ++ E +E LK+ FP  V+GRL+++CQP+H+++ +A TK+L K+M++IVCDT++TA   I Y+KD R  PETFLP D L V P++EKLR+I++P  V LV DVI  +    +KALQF CGNALVC++ E A+ +A+  GE   R K VS+
Sbjct:  205 AQEKREAKMEKDEAEKYQTMKNELAAKSTMLFLHQLFHCERTIDESKEEINAQKKTIASLEATRSKEEAKIAAVHQEHRKAL-----------REVQKMTRKLDQKETDLAEKQQNMLTLKVSVAHEHKKLEIAKKMLAAAESKAENNSTQLADLKKSKKELEKKKAAYE-AEIQDMMQRGE-LNLSDEQVREYGQLKDQAQRESAMVQRELLMAEQVFEGDKSSLNHELRRQKEHQERVKAKEGDVRRIETQIATLAQRI----------KETEEETKI-LKADLKKIENDVVIDKSAAAEYNKELVAVVRQLSEASGDSAEGERNQRRTEALEGLKKNFPESVYGRLVDLCQPSHKRFNIATTKILQKHMNSIVCDTEETAAKAIVYLKDHRYPPETFLPNDALVVNPLNEKLREIKKPAGVKLVFDVINPQHQAARKALQFVCGNALVCESQEDAKQLAYGGGELKDRFKAVSM 657          

HSP 2 Score: 89.3521 bits (220), Expect = 2.188e-18
Identity = 46/95 (48.42%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            ++E  NI +KA+NFLV+QG +E+IAMK  KER Q  EE+S+S EF+AEYER K E+ K E++   N+NK++ I  E++EAK     +   Q +KN
Sbjct:  132 EMESINIFIKARNFLVYQGAIENIAMKTPKERTQLFEELSRSHEFQAEYERLKVEMTKAEDDTQHNMNKRRGIAQEKREAKMEKDEAEKYQTMKN 226          
BLAST of SMED30015457 vs. Ensembl Fly
Match: SMC1 (gene:FBgn0040283 transcript:FBtr0084541)

HSP 1 Score: 293.123 bits (749), Expect = 7.162e-96
Identity = 164/435 (37.70%), Postives = 269/435 (61.84%), Query Frame = -2
Query:   35 EAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAF 1339
            EA +Y +L+ E N K++E  L +LF+ E +  +   +   +++E+ + E ++   DE ++  +K   K  R+ + I+QEI++ E              P +IK  +K+ H   K    +K  E+AR+   A+Q ++ +L+ Q+  +E LK  +E +    S  +G+++ +E   +QEY +LKQ+     +   + LD+++RE   ++D  D    RR  +  S K+   +  E+ KR  KL ++I SS  A+ EQ   ++ +R +V ++ ++I E  +ELE V   LG+A+ +KHE +R  KKQE++E  K+  PGV+ R++ MCQP H++Y VA+TKVLGK+M+AI+ DT+KTA+ CIQ +K+Q +E ETFLPLD+L V+P+ E+LR+I +P NV LV DV++FEP  I++A+ FA GNALVC+T E A  VA+
Sbjct:  228 EADRYTRLQNEYNEKQVEYQLFRLFHVERDIRKFTSDLEVRQQEVKAVEQRKEAADEILREKKKDAGKITRDLAKIDQEIREFE-------TQMNKRRPLYIKAKEKVTHCKKKLISLQKTLETAREADNAHQSDIRKLEKQLADVEALKKRFEDEIENESQRRGKSVNMEEGLVQEYDRLKQEAEATATQYRSELDSVNREQKSEQDTLDGETNRRASVEESFKKLTLQREEAVKRRDKLMDHIKSSQAALEEQNRIKDELRRDVGTSKEKIAEKQRELEDVRDQLGDAKSDKHEDARRKKKQEVVELFKKQVPGVYDRMINMCQPTHKRYNVAVTKVLGKFMEAIIVDTEKTARHCIQILKEQMLEVETFLPLDYLQVKPLKERLRNISDPRNVRLVFDVLKFEPQEIERAVLFATGNALVCETPEDAMKVAY 655          

HSP 2 Score: 78.5666 bits (192), Expect = 7.162e-96
Identity = 46/81 (56.79%), Postives = 53/81 (65.43%), Query Frame = -1
Query: 1350 LEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKN 1592
            LE+  I +KAKNFLVFQG VE+IAMK  KER    EEIS S   K +Y R K+E+   EEE      KKK I AERKEAK+
Sbjct:  144 LEKIGINVKAKNFLVFQGAVENIAMKTPKERTALFEEISGSGLLKDDYNRLKQEMIVAEEETQFTYQKKKGIAAERKEAKH 224          
BLAST of SMED30015457 vs. Ensembl Fly
Match: glu (gene:FBgn0015391 transcript:FBtr0080935)

HSP 1 Score: 73.9442 bits (180), Expect = 1.918e-13
Identity = 65/236 (27.54%), Postives = 118/236 (50.00%), Query Frame = -2
Query:    2 KESELNESRKRLQKLREYIDSSNRA-------INEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQ----ELIENLKRL-----FPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 661
            K++E  ESRK  + L+   + S ++       ++E KE+   ++ E+ S +  ++++ KE   +     + R E +E S   + Q    ++++ L R+      PG+ GRL ++      KY +AI+   G+ +D IV D  +TA   I  +K+  +   TF+ LD ++    +   R I  P NV  + D+++ E   ++ A  FA  N LVCD +E    +A+   ER + V+L
Sbjct:  515 KQAETTESRK-YETLKSSYEQSQKSLEEKVTRVDELKESIPRMKTEIASKSAEVDKMVKEERNLSMQCNKLRTEINERSSVMQAQRSNNKVLDFLMRMKMEGKIPGILGRLGDLGG-IDAKYDIAISTACGR-LDNIVTDNYETASAAIGALKEYNVGRATFITLDKIEHHRREANSR-INTPENVPRLYDLVKVEDDRVRTAFYFALRNTLVCDDLEQGTRIAYGR-ERYRVVTL 745          
BLAST of SMED30015457 vs. Ensembl Zebrafish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 314.694 bits (805), Expect = 1.538e-104
Identity = 178/444 (40.09%), Postives = 301/444 (67.79%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+    ++L L KL++NE E  ++ +E   + +E+     + + ++E++K  +K++ +  R+Q  IE+EIK+ +              P +IK  +   H + K + ++K+ ++A++ +   + ++ +L  +   +E  + E+E +  + +  +G++L+LE NQ++ YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL +YI +S ++++EQK  EE +  EVE A +RI+EIN EL  V+  LG+AR+++ E+SR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR++R      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF    R KTV+L
Sbjct:  208 RYQRLKDEVVRAHVQLQLFKLYHNESEIEKLNRELAHRNKEIDKDRKRMDRVEEELKDKKKELGRMMRDQQMIEKEIKEKD-------AELNQKRPLYIKAKENTAHKIKKLEAARKSLQNAQKCYKKRKGDMDELDREQGAVEMARQEFEERMEEEAQSQGQDLQLEENQVKAYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKIETEAKIKQKIREIEENQKRIEKLEDYITTSRQSLDEQKRMEEELTEEVEQAKRRIDEINMELNQVMEQLGDARIDRQENSRQQRKAEILESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELR---GAKLVIDVIRYEPPQIKKALQYACGNALVCDNVEDARRIAFGGPYRHKTVAL 641          

HSP 2 Score: 85.8853 bits (211), Expect = 1.538e-104
Identity = 44/75 (58.67%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY+R K+E+ K EE+   N ++KKNI A
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRCKKEMVKAEEDTQFNYHRKKNIAA 194          
BLAST of SMED30015457 vs. Ensembl Zebrafish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 314.309 bits (804), Expect = 2.144e-104
Identity = 178/444 (40.09%), Postives = 300/444 (67.57%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+    ++L L KL++NE E  ++ +E   + +E+     + + ++E++K  +K++ +  R+Q  IE+EIK+                P +IK  +   H + K + ++K+ ++A++ +   + ++ +L  +   +E  + E+E +  + +  +G++L+LE NQ++ YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL +YI +S ++++EQK  EE +  EVE A +RI+EIN EL  V+  LG+AR+++ E+SR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR++R      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF    R KTV+L
Sbjct:  226 RYQRLKDEVVRAHVQLQLFKLYHNESEIEKLNRELAHRNKEIDKDRKRMDRVEEELKDKKKELGRMMRDQQMIEKEIKE-------KDAELNQKRPLYIKAKENTAHKIKKLEAARKSLQNAQKCYKKRKGDMDELDREQGAVEMARQEFEERMEEEAQSQGQDLQLEENQVKAYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKIETEAKIKQKIREIEENQKRIEKLEDYITTSRQSLDEQKRMEEELTEEVEQAKRRIDEINMELNQVMEQLGDARIDRQENSRQQRKAEILESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELR---GAKLVIDVIRYEPPQIKKALQYACGNALVCDNVEDARRIAFGGPYRHKTVAL 659          

HSP 2 Score: 85.8853 bits (211), Expect = 2.144e-104
Identity = 44/75 (58.67%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY+R K+E+ K EE+   N ++KKNI A
Sbjct:  138 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRCKKEMVKAEEDTQFNYHRKKNIAA 212          
BLAST of SMED30015457 vs. Ensembl Zebrafish
Match: smc1a (structural maintenance of chromosomes 1A [Source:ZFIN;Acc:ZDB-GENE-090506-9])

HSP 1 Score: 312.383 bits (799), Expect = 3.679e-103
Identity = 176/444 (39.64%), Postives = 302/444 (68.02%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+    ++L L KL++NE E  ++ +E  ++  E+     K + ++E++K  +K++ +  R+Q  +E+EIK+ +              P++IK  +   H + K + ++K+ ++A++ +   + ++ +L  +   +E  + E+E +  + +  +G++L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL +YI +S ++++EQ+  EE +  EVE A +RI+EIN EL  V+  LG+AR+++ E+SR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR++R      LV+DVI++EP  IKKALQ+ACGNALVC+ VE AR +AF    R KTV+L
Sbjct:  208 RYQRLKDEVVRAHVQLQLFKLYHNEEEIEKLNRELSQRNREIDKDRKKMDHVEEELKDKKKELGRMMRDQQNVEKEIKEKD-------AELNQKRPQYIKAKENTAHKIKKLEVARKSLQNAQKMYKKRKADIEELDREQGAVEMSRQEFEERMEEEAQSQGQDLTLEENQVKQYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKIETEAKIKQKIREIEENQKRIEKLEDYIATSRQSLDEQRRMEEELTEEVELAKRRIDEINMELNQVMEQLGDARIDRQENSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELR---GAKLVIDVIRYEPPHIKKALQYACGNALVCENVEDARRIAFGGPYRHKTVAL 641          

HSP 2 Score: 83.5741 bits (205), Expect = 3.679e-103
Identity = 43/75 (57.33%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY+R K+E+ K EE+   + ++KKNI A
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKEMVKAEEDTQFSYHRKKNIAA 194          
BLAST of SMED30015457 vs. Ensembl Zebrafish
Match: smc1b (structural maintenance of chromosomes 1B [Source:ZFIN;Acc:ZDB-GENE-091217-1])

HSP 1 Score: 223.402 bits (568), Expect = 3.278e-70
Identity = 146/456 (32.02%), Postives = 264/456 (57.89%), Query Frame = -2
Query:    2 EAAKYKKLKTELNTKRIELHLLKLFYNE-------VETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFP-GVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFE--PAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1339
            EA +Y+ L  +L   +++L L +LF+NE           ++Q    ++K  L + E       + +K+ +K+  + NRE   +E+EI+  EQ             P++IK      H   K +E+ ++ +  +       +EL +L+ ++  +E+     E +  +    +G  ++L+ +QL+ Y +LK+      + L+   + L  E    ++      RR++EI  + K  ++ L +  +R +KL EY++++ + + EQ++ EE +  E+     R+EE+N EL  V+T L  AR++  E+ R  K+ E++E+L+RL+P  V+GRL+E+CQP H+KYQ+A+TKV GK M+AIV  +   A DCI+Y+K++R EPETFLP+D++DV  ++E+LR+++      +V+DV+Q       +K+ +Q+ CGN+LVC+T++ AR +AF+  ER +TV+L
Sbjct:  205 EAQRYQSLVDDLRECKLQLTLFQLFHNEKSIDAQSASLGDMQAAAAQQKISLDAWE-------QTVKTQKKEHGRLNRELQQLEKEIRSQEQILNQQR-------PQYIKAKVNTSHHEQKVQEAHRSLQKNQNLQAKKGQELEELKRELTELERAWKTSERQMEEEEARRGAGVQLQESQLERYKELKELARRNGAILNQSAEKLHWEVKADREKLQFDLRRKSEIQGNIKHSQTHLEDISRRAEKLEEYVNTTTQTLEEQRQQEEQLSEELAKGLVRMEEVNVELAQVLTKLQNARLDSQENRRQQKRDEVLESLRRLYPDTVYGRLVELCQPIHKKYQLAVTKVFGKNMNAIVVTSAYVAHDCIRYLKEERAEPETFLPIDYIDVPILNERLREVQ---GAKMVVDVVQCSQNAPQLKRVIQYVCGNSLVCETLKDARRIAFDGPERLQTVAL 643          

HSP 2 Score: 62.7734 bits (151), Expect = 3.278e-70
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = -1
Query: 1359 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKE 1595
            +L++  I++KAKN LV+QG VESIAM NAKER +  E IS S +   EY      ++K +E+   + N+KK   AE+K+
Sbjct:  120 ELQKIGIVVKAKNCLVYQGAVESIAMMNAKERTKMFERISGSGDLNIEYFTKLAVLQKAKEDTQFHFNRKKAATAEKKQ 198          
BLAST of SMED30015457 vs. Ensembl Zebrafish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 85.8853 bits (211), Expect = 1.425e-19
Identity = 44/75 (58.67%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY+R K+E+ K EE+   N ++KKNI A
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRCKKEMVKAEEDTQFNYHRKKNIAA 194          

HSP 2 Score: 30.4166 bits (67), Expect = 1.425e-19
Identity = 23/78 (29.49%), Postives = 49/78 (62.82%), Query Frame = -2
Query: 1097 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIK 1330
            +Y++LK E+    ++L L KL++NE E  ++ +E   + +E+     + + ++E++K  +K++ +  R+Q  IE+EIK
Sbjct:  208 RYQRLKDEVVRAHVQLQLFKLYHNESEIEKLNRELAHRNKEIDKDRKRMDRVEEELKDKKKELGRMMRDQQMIEKEIK 285          
BLAST of SMED30015457 vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 330.872 bits (847), Expect = 1.319e-108
Identity = 187/444 (42.12%), Postives = 307/444 (69.14%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+   +++L L KL++NE E  ++ K+   K + +   +   ++++E++K  +K + K  REQ  IE+EIK+ +              P++IK  +   H + K + +KK+ ++A++Q+   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK  EET+  EVE A +RI+EIN EL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  176 RYQRLKDEVARAQVQLQLFKLYHNESEIEKLNKDLSVKNKGIEKDKKHMDKVEEELKDKKKDLGKMMREQQAIEKEIKEKD-------AELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKQYKKRKADMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYIATSKQSLEEQKNLEETLTEEVELAKRRIDEINSELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 609          

HSP 2 Score: 83.9593 bits (206), Expect = 1.319e-108
Identity = 43/75 (57.33%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI A
Sbjct:   88 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAA 162          
BLAST of SMED30015457 vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 330.487 bits (846), Expect = 1.583e-108
Identity = 187/444 (42.12%), Postives = 307/444 (69.14%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+   +++L L KL++NE E  ++ K+   K + +   +   ++++E++K  +K + K  REQ  IE+EIK+ +              P++IK  +   H + K + +KK+ ++A++Q+   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK  EET+  EVE A +RI+EIN EL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  208 RYQRLKDEVARAQVQLQLFKLYHNESEIEKLNKDLSVKNKGIEKDKKHMDKVEEELKDKKKDLGKMMREQQAIEKEIKEKD-------AELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKQYKKRKADMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYIATSKQSLEEQKNLEETLTEEVELAKRRIDEINSELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 83.9593 bits (206), Expect = 1.583e-108
Identity = 43/75 (57.33%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI A
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAA 194          
BLAST of SMED30015457 vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 330.487 bits (846), Expect = 1.623e-108
Identity = 187/444 (42.12%), Postives = 306/444 (68.92%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+   +++L L KL++NE E  ++ K+   K + +   +   ++++E++K  +K + K  REQ  IE+EIK+                P++IK  +   H + K + +KK+ ++A++Q+   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK  EET+  EVE A +RI+EIN EL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  191 RYQRLKDEVARAQVQLQLFKLYHNESEIEKLNKDLSVKNKGIEKDKKHMDKVEEELKDKKKDLGKMMREQQAIEKEIKE-------KDAELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKQYKKRKADMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYIATSKQSLEEQKNLEETLTEEVELAKRRIDEINSELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 624          

HSP 2 Score: 83.9593 bits (206), Expect = 1.623e-108
Identity = 43/75 (57.33%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI A
Sbjct:  103 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAA 177          
BLAST of SMED30015457 vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 330.487 bits (846), Expect = 1.808e-108
Identity = 187/444 (42.12%), Postives = 307/444 (69.14%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+   +++L L KL++NE E  ++ K+   K + +   +   ++++E++K  +K + K  REQ  IE+EIK+ +              P++IK  +   H + K + +KK+ ++A++Q+   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK  EET+  EVE A +RI+EIN EL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  208 RYQRLKDEVARAQVQLQLFKLYHNESEIEKLNKDLSVKNKGIEKDKKHMDKVEEELKDKKKDLGKMMREQQAIEKEIKEKD-------AELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKQYKKRKADMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYIATSKQSLEEQKNLEETLTEEVELAKRRIDEINSELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 83.9593 bits (206), Expect = 1.808e-108
Identity = 43/75 (57.33%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI A
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAA 194          
BLAST of SMED30015457 vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 330.487 bits (846), Expect = 2.015e-108
Identity = 187/444 (42.12%), Postives = 307/444 (69.14%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+   +++L L KL++NE E  ++ K+   K + +   +   ++++E++K  +K + K  REQ  IE+EIK+ +              P++IK  +   H + K + +KK+ ++A++Q+   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK  EET+  EVE A +RI+EIN EL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  208 RYQRLKDEVARAQVQLQLFKLYHNESEIEKLNKDLSVKNKGIEKDKKHMDKVEEELKDKKKDLGKMMREQQAIEKEIKEKD-------AELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKQYKKRKADMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYIATSKQSLEEQKNLEETLTEEVELAKRRIDEINSELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 83.9593 bits (206), Expect = 2.015e-108
Identity = 43/75 (57.33%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI A
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAA 194          
BLAST of SMED30015457 vs. Ensembl Mouse
Match: Smc1a (structural maintenance of chromosomes 1A [Source:MGI Symbol;Acc:MGI:1344345])

HSP 1 Score: 342.813 bits (878), Expect = 4.044e-105
Identity = 192/455 (42.20%), Postives = 315/455 (69.23%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K E +EA +Y++LK E+   +++L L KL++NEVE  ++ KE   K +E+   + + +++++++K  +K++ K  REQ  IE+EIK+                P++IK  +   H + K + +KK+ ++A++ +   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK+ E  +  EVE A +RI+EINKEL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  197 KEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKE-------KDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 94.3597 bits (233), Expect = 1.218e-19
Identity = 51/95 (53.68%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI AERKEAK     +   Q +K+
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKD 214          
BLAST of SMED30015457 vs. Ensembl Mouse
Match: Smc1b (structural maintenance of chromosomes 1B [Source:MGI Symbol;Acc:MGI:2154049])

HSP 1 Score: 258.84 bits (660), Expect = 1.344e-88
Identity = 155/456 (33.99%), Postives = 267/456 (58.55%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSG-IEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFP-GVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  KIE +EA  Y+ L  EL   +I+L L +L+YNE + N +  E        L   +    + +   SH + + K  ++  G + +++++  +             P++IK  +   H + K   SKK      +Q    ++ +  L +++  +++    +E +  +  ++KGR++ELE +QL  Y  LK++V  K   ++  L+ L  E   +K+     +RR  +   + K+ + ++ E +KR++KL EY  +    + ++K+ EE ++ E+E+   R+ E+N+EL L+   L  A ++ HE  R  K+ E++E+LKRL+P  V GRLL++C P H+KYQ+A+TK+ G+YM AIV  ++K AKDCI+++K +R EPETFL LD+LD++PI+E+LR+I+      +++DVI+ +   +KK +QF CGN LVC+TVE AR +AF   ER+K V+L
Sbjct:  197 KHAKIEKEEAEHYQNLLEELKINKIQLMLFQLYYNEEKINVLNTE--------LEQMDGNLSVVKDTLSHHENIFKAKKKDYGMLTRQLQQTAKELKSVEAILNQKRPQYIKAKENTSHHLKKLDLSKKLITDNEKQCSKQEDGIRALVAELADLDRAWKSFEKQMEEKILQKGRDIELENSQLDRYKLLKEQVRRKVGIMTQQLEKLQWEQKAEKERLAFEKRRHGDTQGNLKQIKEQIEEHKKRIEKLEEYTKTCMDCLEDKKQQEEALKKEIENTKSRMSEVNEELSLIRNELQNAGIDNHEGKRQQKRAEVLEHLKRLYPDSVFGRLLDLCHPIHKKYQLAVTKLFGRYMVAIVVASEKIAKDCIRFLKAERAEPETFLALDYLDIKPINERLREIK---GCKMMIDVIKTQFPQLKKVIQFVCGNGLVCETVEEARHIAFGGPERRKAVAL 641          

HSP 2 Score: 88.5817 bits (218), Expect = 1.344e-88
Identity = 48/81 (59.26%), Postives = 59/81 (72.84%), Query Frame = -1
Query: 1353 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1595
            QLE   I++KA+N LVFQGTVESI+MK  KER Q  EEIS S EF  EYE  K++++K EE+A  + N KKN+ AERK AK
Sbjct:  120 QLENIGIIVKAQNCLVFQGTVESISMKKPKERTQFFEEISTSGEFIGEYEAKKKKLQKAEEDAQFHFNVKKNVAAERKHAK 200          
BLAST of SMED30015457 vs. Ensembl Mouse
Match: Smc4 (structural maintenance of chromosomes 4 [Source:MGI Symbol;Acc:MGI:1917349])

HSP 1 Score: 75.0998 bits (183), Expect = 1.188e-13
Identity = 109/439 (24.83%), Postives = 200/439 (45.56%), Query Frame = -2
Query:    2 VKKKEELLSHENK-RNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSRE---YNEQKDIYD----ALERRRNEIASSQKRKESEL-------NESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVV---TNLGEA------RVEKHESSRAAKKQE-------LIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1225
            + +K  +LS+E K +N   + ++    KVTKF      IEQ  +K  Q              E ++V +KLKH   K K+ +K                 QLQ   +++E+LKS     ++ I+    RN           + L+++  ++   L  V+D+L +E     ++K+I +       +  NE  S  +  +SEL       N +  +L K +E + +++  + E+K A + I  ++    + ++E  KEL+ +     NL         +VE+ +SS A  +         + E      PG++GRL ++      KY +AI+      +D IV D+  TA++C+ ++K   I   TF+ LD + V    +K+  I+ P N   + D+++ +   I++A  FA  + LV + ++ A  VA+    R + V+L
Sbjct:  349 ITEKSNVLSNEMKAKNSAVKDVEKKLNKVTKF------IEQNKEKFTQLDL-----------EDVQVREKLKHATSKAKKLEK-----------------QLQKDKEKVEELKSVPAKSKTVINETTTRN-----------NSLEKEREKEEKKLKEVMDSLKQETQGLQKEKEIQEKELMGFNKSVNEARSKMEVAQSELDIYLSRHNTAVSQLSKAKEALITASETLKERKAAIKDINTKLPQTQQELKEKEKELQKLTQEEINLKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLG-AIDEKYDIAISSCC-HALDYIVVDSIDTAQECVNFLKKHNIGIATFIGLDKMTVWA--KKMSKIQTPENTPRLFDLVKVKNEEIRQAFYFALRDTLVANNLDQATRVAYQRDRRWRVVTL 738          
BLAST of SMED30015457 vs. Ensembl Mouse
Match: Smc4 (structural maintenance of chromosomes 4 [Source:MGI Symbol;Acc:MGI:1917349])

HSP 1 Score: 75.0998 bits (183), Expect = 1.429e-13
Identity = 109/439 (24.83%), Postives = 200/439 (45.56%), Query Frame = -2
Query:    2 VKKKEELLSHENK-RNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSRE---YNEQKDIYD----ALERRRNEIASSQKRKESEL-------NESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVV---TNLGEA------RVEKHESSRAAKKQE-------LIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1225
            + +K  +LS+E K +N   + ++    KVTKF      IEQ  +K  Q              E ++V +KLKH   K K+ +K                 QLQ   +++E+LKS     ++ I+    RN           + L+++  ++   L  V+D+L +E     ++K+I +       +  NE  S  +  +SEL       N +  +L K +E + +++  + E+K A + I  ++    + ++E  KEL+ +     NL         +VE+ +SS A  +         + E      PG++GRL ++      KY +AI+      +D IV D+  TA++C+ ++K   I   TF+ LD + V    +K+  I+ P N   + D+++ +   I++A  FA  + LV + ++ A  VA+    R + V+L
Sbjct:  324 ITEKSNVLSNEMKAKNSAVKDVEKKLNKVTKF------IEQNKEKFTQLDL-----------EDVQVREKLKHATSKAKKLEK-----------------QLQKDKEKVEELKSVPAKSKTVINETTTRN-----------NSLEKEREKEEKKLKEVMDSLKQETQGLQKEKEIQEKELMGFNKSVNEARSKMEVAQSELDIYLSRHNTAVSQLSKAKEALITASETLKERKAAIKDINTKLPQTQQELKEKEKELQKLTQEEINLKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLG-AIDEKYDIAISSCC-HALDYIVVDSIDTAQECVNFLKKHNIGIATFIGLDKMTVWA--KKMSKIQTPENTPRLFDLVKVKNEEIRQAFYFALRDTLVANNLDQATRVAYQRDRRWRVVTL 713          
BLAST of SMED30015457 vs. Ensembl Mouse
Match: Smc2 (structural maintenance of chromosomes 2 [Source:MGI Symbol;Acc:MGI:106067])

HSP 1 Score: 60.8474 bits (146), Expect = 3.806e-9
Identity = 38/134 (28.36%), Postives = 70/134 (52.24%), Query Frame = -2
Query:    2 VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPI-DEKLR---DIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 391
            V G +  +          A+  V G+ +  +V DT+ TAK  ++  K +     T +PL+ +  R I  E LR   ++  P NVH+ L ++ ++P + +K ++F  G   VC+ +++A+ VAF+     +TV+L
Sbjct:  522 VKGLVASLINVKDNSTATALEVVAGERLYNVVVDTEVTAKKLLE--KGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVDYKPEL-QKGMEFVFGTTFVCNNMDNAKKVAFDKRIMTRTVTL 652          
BLAST of SMED30015457 vs. UniProt/SwissProt
Match: sp|O93308|SMC1A_XENLA (Structural maintenance of chromosomes protein 1A OS=Xenopus laevis OX=8355 GN=smc1a PE=1 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 4.810e-108
Identity = 195/455 (42.86%), Postives = 303/455 (66.59%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKV-----------TKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+   +I+L L KL++NE E  ++ KE        LS +NK  E D   K H  KV            K  REQ  IE+EIK+ +              P++IK  +   H + K + +KK+ ++A++Q+   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  EL E++KR++KL EYI +S +++ EQK  EET+  EVE A +RI+EIN EL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DE+LR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  208 RYQRLKDEVARAQIQLQLFKLYHNESEIEKLNKE--------LSVKNKGIEKD---KKHMDKVEEELKDKKKELGKMMREQQAIEKEIKEKD-------AELNQKLPQYIKAKENPSHKIKKFRAAKKSLQNAQKQYKKRKADMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLRELEENQKRIEKLEEYIATSKQSLEEQKNLEETLTEEVEMAKRRIDEINSELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDERLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 83.9593 bits (206), Expect = 4.810e-108
Identity = 43/74 (58.11%), Postives = 54/74 (72.97%), Query Frame = -1
Query: 1371 LEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1592
            LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI A
Sbjct:  121 LEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAA 194          
BLAST of SMED30015457 vs. UniProt/SwissProt
Match: sp|O97593|SMC1A_BOVIN (Structural maintenance of chromosomes protein 1A OS=Bos taurus OX=9913 GN=SMC1A PE=1 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 2.743e-104
Identity = 192/455 (42.20%), Postives = 315/455 (69.23%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K E +EA +Y++LK E+   +++L L KL++NEVE  ++ KE   K +E+   + + +++++++K  +K++ K  REQ  IE+EIK+                P++IK  +   H + K + +KK+ ++A++ +   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK+ E  +  EVE A +RI+EINKEL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  197 KEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKE-------KDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 94.3597 bits (233), Expect = 8.827e-19
Identity = 51/95 (53.68%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI AERKEAK     +   Q +K+
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKD 214          
BLAST of SMED30015457 vs. UniProt/SwissProt
Match: sp|Q9CU62|SMC1A_MOUSE (Structural maintenance of chromosomes protein 1A OS=Mus musculus OX=10090 GN=Smc1a PE=1 SV=4)

HSP 1 Score: 342.813 bits (878), Expect = 2.828e-104
Identity = 192/455 (42.20%), Postives = 315/455 (69.23%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K E +EA +Y++LK E+   +++L L KL++NEVE  ++ KE   K +E+   + + +++++++K  +K++ K  REQ  IE+EIK+                P++IK  +   H + K + +KK+ ++A++ +   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK+ E  +  EVE A +RI+EINKEL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  197 KEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKE-------KDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 94.3597 bits (233), Expect = 8.521e-19
Identity = 51/95 (53.68%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI AERKEAK     +   Q +K+
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKD 214          
BLAST of SMED30015457 vs. UniProt/SwissProt
Match: sp|Q14683|SMC1A_HUMAN (Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2)

HSP 1 Score: 342.428 bits (877), Expect = 3.365e-104
Identity = 192/455 (42.20%), Postives = 315/455 (69.23%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K E +EA +Y++LK E+   +++L L KL++NEVE  ++ KE   K +E+   + + +++++++K  +K++ K  REQ  IE+EIK+                P++IK  +   H + K + +KK+ ++A++ +   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK+ E  +  EVE A +RI+EINKEL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  197 KEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKE-------KDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 94.3597 bits (233), Expect = 8.597e-19
Identity = 51/95 (53.68%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI AERKEAK     +   Q +K+
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKD 214          
BLAST of SMED30015457 vs. UniProt/SwissProt
Match: sp|Q9Z1M9|SMC1A_RAT (Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus OX=10116 GN=Smc1a PE=1 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 5.134e-103
Identity = 191/455 (41.98%), Postives = 313/455 (68.79%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K E +EA +Y+ LK E+   +++L L KL++NEVE  ++ KE   K +E+   + + +++++++K  +K++ K  REQ  IE+EIK+                P++IK  +   H + K + +KK+ ++ ++ +   + ++ +L+ +M  +E+ + E+E +  + S  +GR+L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL EYI +S +++ EQK+ E  +  EVE A +RI+EINKEL  V+  LG+AR+++ ESSR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR+++      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF   +R KTV+L
Sbjct:  197 KEAKQEKEEADRYQALKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKE-------KDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNRQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELK---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVAL 641          

HSP 2 Score: 93.9745 bits (232), Expect = 9.063e-19
Identity = 51/95 (53.68%), Postives = 66/95 (69.47%), Query Frame = -1
Query: 1311 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAKNRNRRSS*IQEIKN 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY++ K+E+ K EE+   N ++KKNI AERKEAK     +   Q +K+
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQALKD 214          
BLAST of SMED30015457 vs. TrEMBL
Match: H2KS10 (Structural maintenance of chromosome 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_107785 PE=4 SV=1)

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 307/455 (67.47%), Postives = 380/455 (83.52%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHEN-KRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K EIDEA +Y+KL+ +L  KR ELHL KL+YN++E   + +E +K++EELL+ E+ +R  I+E++K  R+++ K NR+QS +EQEIKKCEQ             PE IKV Q L+H+ +K KESKK+ E+A+Q H ++ +E+ QL+++ ++I  LK EYE +Q++ S+E+G NLELE  QL EYH+LKQKVAE+TSHLSAVLD L+REYNEQKD+YDAL+RR+NEI SS KRKE+ELNE++KRLQKL EYI+SSNRAI EQ+E E+ IR EVE AT+RI+EIN ELE VV  LGEA+VE+HESSRAAKKQELIENLKRLFPGVHGRLLEMCQP+HR+YQVAITKVLGKYMDAIVCD++KTAK+CIQYMKDQRIEPETFLPLDFLDV+PIDE+LR+I +PPNVHLV+DVIQ +P I+KKAL FACGNALVC+TVEHAR VA+ TGERKKTVSL
Sbjct:  160 KEAKFEIDEAERYRKLQQDLALKRTELHLFKLYYNDLEIRRV-REELKQREELLASEHEQRQSIEEEMKDKRRELGKVNRDQSSVEQEIKKCEQKIGKRR-------PEFIKVSQLLRHVTEKHKESKKSLENAKQLHSSHLQEIDQLEAESEKISSLKREYEQQQTKKSLEQGINLELEETQLNEYHRLKQKVAERTSHLSAVLDGLNREYNEQKDLYDALDRRKNEIESSLKRKETELNENKKRLQKLMEYIESSNRAITEQRETEKAIREEVEQATRRIDEINTELEAVVCQLGEAKVERHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPSHRRYQVAITKVLGKYMDAIVCDSEKTAKECIQYMKDQRIEPETFLPLDFLDVKPIDERLREISDPPNVHLVIDVIQCDPIIVKKALTFACGNALVCETVEHARYVAYQTGERKKTVSL 606          

HSP 2 Score: 111.694 bits (278), Expect = 6.377e-22
Identity = 59/83 (71.08%), Postives = 65/83 (78.31%), Query Frame = -1
Query: 1353 AYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1601
            A  LE+ +I MK KNFLVFQG VESIAMKNA+ERCQ  EEISKS E K EY+ +K E+  LEE  TLNLNKKK IVAERKEAK
Sbjct:   81 AAALEKIHIFMKVKNFLVFQGAVESIAMKNARERCQMFEEISKSAELKEEYDNAKLEMHMLEENTTLNLNKKKGIVAERKEAK 163          
BLAST of SMED30015457 vs. TrEMBL
Match: A0A419PXH1 (Structural maintenance of chromosomes protein OS=Clonorchis sinensis OX=79923 GN=Smc1a PE=3 SV=1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 307/455 (67.47%), Postives = 380/455 (83.52%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHEN-KRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K EIDEA +Y+KL+ +L  KR ELHL KL+YN++E   + +E +K++EELL+ E+ +R  I+E++K  R+++ K NR+QS +EQEIKKCEQ             PE IKV Q L+H+ +K KESKK+ E+A+Q H ++ +E+ QL+++ ++I  LK EYE +Q++ S+E+G NLELE  QL EYH+LKQKVAE+TSHLSAVLD L+REYNEQKD+YDAL+RR+NEI SS KRKE+ELNE++KRLQKL EYI+SSNRAI EQ+E E+ IR EVE AT+RI+EIN ELE VV  LGEA+VE+HESSRAAKKQELIENLKRLFPGVHGRLLEMCQP+HR+YQVAITKVLGKYMDAIVCD++KTAK+CIQYMKDQRIEPETFLPLDFLDV+PIDE+LR+I +PPNVHLV+DVIQ +P I+KKAL FACGNALVC+TVEHAR VA+ TGERKKTVSL
Sbjct:  201 KEAKFEIDEAERYRKLQQDLALKRTELHLFKLYYNDLEIRRV-REELKQREELLASEHEQRQSIEEEMKDKRRELGKVNRDQSSVEQEIKKCEQKIGKRR-------PEFIKVSQLLRHVTEKHKESKKSLENAKQLHSSHLQEIDQLEAESEKISSLKREYEQQQTKKSLEQGINLELEETQLNEYHRLKQKVAERTSHLSAVLDGLNREYNEQKDLYDALDRRKNEIESSLKRKETELNENKKRLQKLMEYIESSNRAITEQRETEKAIREEVEQATRRIDEINTELEAVVCQLGEAKVERHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPSHRRYQVAITKVLGKYMDAIVCDSEKTAKECIQYMKDQRIEPETFLPLDFLDVKPIDERLREISDPPNVHLVIDVIQCDPIIVKKALTFACGNALVCETVEHARYVAYQTGERKKTVSL 647          

HSP 2 Score: 111.694 bits (278), Expect = 6.654e-22
Identity = 59/83 (71.08%), Postives = 65/83 (78.31%), Query Frame = -1
Query: 1353 AYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1601
            A  LE+ +I MK KNFLVFQG VESIAMKNA+ERCQ  EEISKS E K EY+ +K E+  LEE  TLNLNKKK IVAERKEAK
Sbjct:  122 AAALEKIHIFMKVKNFLVFQGAVESIAMKNARERCQMFEEISKSAELKEEYDNAKLEMHMLEENTTLNLNKKKGIVAERKEAK 204          
BLAST of SMED30015457 vs. TrEMBL
Match: A0A4S2M8U9 (Structural maintenance of chromosomes protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001815 PE=3 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 307/455 (67.47%), Postives = 379/455 (83.30%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHEN-KRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  K EIDEA +Y+KL+ +L  KR ELHL KL+YN++E   + +E +K++EELL+ E+ +R  I+E++K  R+++ K NR+QS +EQEIKKCEQ             PE IKV Q L+H+ +K KESKK+ E+A+Q H ++ +E+ QL+++ ++I  LK EYE +Q++ S+E+G NLELE  QL EYH+LKQKVAE+TSHLSAVLD L+REYNEQKD+YDAL+RR+NEI SS KRKE+ELNE++KRLQKL EYI+SSNRAI EQ+E E+ IR EVE AT RI+EIN ELE VV  LGEA+VE+HESSRAAKKQELIENLKRLFPGVHGRLLEMCQP+HR+YQVAITKVLGKYMDAIVCD++KTAK+CIQYMKDQRIEPETFLPLDFLDV+PIDE+LR+I +PPNVHLV+DVIQ +P I+KKAL FACGNALVC+TVEHAR VA+ TGERKKTVSL
Sbjct:  201 KEAKFEIDEAERYRKLQQDLALKRTELHLFKLYYNDLEIRRV-REELKQREELLASEHEQRQSIEEEMKDKRRELGKVNRDQSSVEQEIKKCEQKIGKRR-------PEFIKVSQLLRHVTEKHKESKKSLENAKQLHSSHLQEIDQLEAESEKISSLKREYEQQQTKKSLEQGINLELEETQLNEYHRLKQKVAERTSHLSAVLDGLNREYNEQKDLYDALDRRKNEIESSLKRKETELNENKKRLQKLMEYIESSNRAITEQRETEKAIREEVEQATSRIDEINTELEAVVCQLGEAKVERHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPSHRRYQVAITKVLGKYMDAIVCDSEKTAKECIQYMKDQRIEPETFLPLDFLDVKPIDERLREISDPPNVHLVIDVIQCDPIIVKKALTFACGNALVCETVEHARYVAYQTGERKKTVSL 647          

HSP 2 Score: 112.079 bits (279), Expect = 5.514e-22
Identity = 59/83 (71.08%), Postives = 65/83 (78.31%), Query Frame = -1
Query: 1353 AYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1601
            A  LE+ +I MK KNFLVFQG VESIAMKNA+ERCQ  EEISKS E K EY+ +K E+  LEE  TLNLNKKK IVAERKEAK
Sbjct:  122 ATALEKIHIFMKVKNFLVFQGAVESIAMKNARERCQMFEEISKSAELKEEYDNAKLEMHMLEENTTLNLNKKKGIVAERKEAK 204          
BLAST of SMED30015457 vs. TrEMBL
Match: A0A4E0RDR3 (Putative structural maintenance OS=Fasciola hepatica OX=6192 GN=D915_004696 PE=4 SV=1)

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 307/455 (67.47%), Postives = 384/455 (84.40%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHEN-KRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  KIEIDEA +Y++L+ +L +KR+ELHL +L+YN++E   + +E +K++EE L+ E+ +R  I+E++K  R+++ K NR+QS +EQ+IKKCEQ             PE IKV Q L+H+ +K KESKK+ E+A+Q H ++ +E+ QL+S+ ++I  LK +YE +Q++ S+E+G NLELE  QL EYH+LKQKVAE+TSHLSAVLD L+REYNEQKD+YDAL+RR+NEI SS KRKE+ELNE++KRLQKL+EYI+SSNRAI EQ+E E+ IR EVE ATKRI+EIN ELE VV  LGEA+VE+HESSRAAKKQELIENLKRLFPGVHGRLLEMCQP+HR+YQVAITKVLGKYMDAIVCD++KTAK+CIQYMKDQRIEPETFLPLDFLDV+PIDEKLR+I +PPNVHLVLDVIQ +PAI+KKAL FACGNALVC+TVEHAR VA+N G+RKKTVSL
Sbjct:  201 KEAKIEIDEAERYRRLQQDLTSKRVELHLFRLYYNDLEIKRV-REDLKQREEALAAEHEQRQAIEEEMKEKRRELGKINRDQSSVEQDIKKCEQKIGKRR-------PEFIKVSQLLRHITEKHKESKKSLENAKQLHSSHLQEIDQLESEYEKISSLKRDYEQQQTKKSLEQGINLELEETQLSEYHRLKQKVAERTSHLSAVLDGLNREYNEQKDLYDALDRRKNEIESSMKRKETELNENKKRLQKLQEYIESSNRAITEQRETEKAIREEVEQATKRIDEINTELEAVVCQLGEAKVERHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPSHRRYQVAITKVLGKYMDAIVCDSEKTAKECIQYMKDQRIEPETFLPLDFLDVKPIDEKLREISDPPNVHLVLDVIQCDPAIVKKALTFACGNALVCETVEHARYVAYNMGDRKKTVSL 647          

HSP 2 Score: 114.39 bits (285), Expect = 6.323e-23
Identity = 60/83 (72.29%), Postives = 66/83 (79.52%), Query Frame = -1
Query: 1353 AYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1601
            A  LE+ +I MK KNFLVFQG VESIAMKNA+ERCQ  EEISKS E K EY+ +K E+ KLEE AT NLNKKK IVAERKEAK
Sbjct:  122 AVALEKIHIFMKVKNFLVFQGAVESIAMKNARERCQMFEEISKSAELKEEYDMAKMEMHKLEENATFNLNKKKGIVAERKEAK 204          
BLAST of SMED30015457 vs. TrEMBL
Match: A0A504Y8H3 (Structural maintenance of chromosomes protein OS=Fasciola gigantica OX=46835 GN=FGIG_02989 PE=3 SV=1)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 307/455 (67.47%), Postives = 384/455 (84.40%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHEN-KRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  KIEIDEA +Y++L+ +L +KR+ELHL +L+YN++E   + +E +K++EE L+ E+ +R  I+E++K  R+++ K NR+QS +EQ+IKKCEQ             PE IKV Q L+H+ +K KESKK+ E+A+Q H ++ +E+ QL+S+ ++I  LK +YE +Q++ S+E+G NLELE  QL EYH+LKQKVAE+TSHLSAVLD L+REYNEQKD+YDAL+RR+NEI SS KRKE+ELNE++KRLQKL+EYI+SSNRAI EQ+E E+ IR EVE ATKRI+EIN ELE VV  LGEA+VE+HESSRAAKKQELIENLKRLFPGVHGRLLEMCQP+HR+YQVAITKVLGKYMDAIVCD++KTAK+CIQYMKDQRIEPETFLPLDFLDV+PIDEKLR+I +PPNVHLVLDVIQ +PAI+KKAL FACGNALVC+TVEHAR VA+N G+RKKTVSL
Sbjct:  201 KEAKIEIDEAERYRRLQQDLTSKRVELHLFRLYYNDLEIKRV-REDLKQREEALAAEHEQRQAIEEEMKEKRRELGKINRDQSSVEQDIKKCEQKIGKRR-------PEFIKVSQLLRHITEKHKESKKSLENAKQLHSSHLQEIDQLESEYEKISSLKRDYEQQQTKKSLEQGINLELEETQLSEYHRLKQKVAERTSHLSAVLDGLNREYNEQKDLYDALDRRKNEIESSMKRKETELNENKKRLQKLQEYIESSNRAITEQRETEKAIREEVEQATKRIDEINTELEAVVCQLGEAKVERHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPSHRRYQVAITKVLGKYMDAIVCDSEKTAKECIQYMKDQRIEPETFLPLDFLDVKPIDEKLREISDPPNVHLVLDVIQCDPAIVKKALTFACGNALVCETVEHARYVAYNMGDRKKTVSL 647          

HSP 2 Score: 114.775 bits (286), Expect = 7.519e-23
Identity = 60/83 (72.29%), Postives = 66/83 (79.52%), Query Frame = -1
Query: 1353 AYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1601
            A  LE+ +I MK KNFLVFQG VESIAMKNA+ERCQ  EEISKS E K EY+ +K E+ KLEE AT NLNKKK IVAERKEAK
Sbjct:  122 AVALEKIHIFMKVKNFLVFQGAVESIAMKNARERCQMFEEISKSAELKEEYDMAKMEMHKLEENATFNLNKKKGIVAERKEAK 204          
BLAST of SMED30015457 vs. Ensembl Cavefish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 327.405 bits (838), Expect = 3.783e-108
Identity = 178/444 (40.09%), Postives = 302/444 (68.02%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+    ++L L KL++NE E  ++ KE  ++ +E+     + + +++++K  +K++ +  REQ  +E+EIK+                P++IK  +   H + K + ++K+ ++A++ +   + ++ +L  +   +E  + E+E +  + +  +G++L+LE NQ++ YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL +YI +S ++++EQK  EE +  EVE A +RI+EIN EL  V+  LG+AR+++ E+SR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR++R      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF    R KTV+L
Sbjct:  208 RYQRLKDEVVRANVQLQLFKLYHNECEIEKLNKELSQRNKEIDKDRKRMDRVEDELKDKKKELGRMMREQQTVEKEIKE-------KDAELNQKRPQYIKAKENTAHKIKKLEAARKSLQNAQKCYKKRKADMDELDKEQKAVEMARQEFEERMEEEAQSQGQDLQLEENQVKAYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKIREIEENQKRIEKLEDYITTSRQSLDEQKRMEEELTEEVEQAKRRIDEINMELNQVMEQLGDARIDRQENSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELR---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGPYRHKTVAL 641          

HSP 2 Score: 85.1149 bits (209), Expect = 3.783e-108
Identity = 44/74 (59.46%), Postives = 54/74 (72.97%), Query Frame = -1
Query: 1371 LEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1592
            LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY+R K+E+ K EE+   N ++KKNI A
Sbjct:  121 LEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKEMVKAEEDTQFNYHRKKNIAA 194          
BLAST of SMED30015457 vs. Ensembl Cavefish
Match: smc1a (structural maintenance of chromosomes 1A [Source:NCBI gene;Acc:103021942])

HSP 1 Score: 315.464 bits (807), Expect = 1.095e-104
Identity = 178/444 (40.09%), Postives = 300/444 (67.57%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+    ++L L KL++NE E  ++ KE  ++  E+     K + I+E++K  +K++ +  R+Q  +E+EIK+                P +IK  +   H + K + ++K+ ++A++ +   + ++ +L  +   +E  + E+E +  + +  +G++L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL +YI +S ++++EQ+  EE +  EVE A +RI+EIN EL  V+  LG+AR+++ E+SR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR++R      LV+DVI++EP  IKKALQ+ACGNALVC+ VE AR +AF    R KTV+L
Sbjct:  208 RYQRLKDEVVRAHVQLQLFKLYHNEAEIEKLNKELSQRNREIEKDRKKMDHIEEELKEKKKELGRMMRDQQNVEKEIKE-------KDAELNQKRPLYIKAKENTSHKIKKLEAARKSLQNAQKMYKKRKADMDELDREQGAVETARQEFEERMEEEAQSQGQDLTLEENQVKQYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKIREIEENQKRIEKLEDYIATSRQSLDEQRRMEEELTEEVELAKRRIDEINMELNQVMEQLGDARIDRQENSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELR---GAKLVIDVIRYEPPHIKKALQYACGNALVCENVEDARRIAFGGPYRHKTVAL 641          

HSP 2 Score: 85.5001 bits (210), Expect = 1.095e-104
Identity = 44/75 (58.67%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY+R K+E+ K EE+   N ++KKNI A
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKEMVKAEEDTQFNYHRKKNIAA 194          
BLAST of SMED30015457 vs. Ensembl Cavefish
Match: smc1b (structural maintenance of chromosomes 1B [Source:ZFIN;Acc:ZDB-GENE-091217-1])

HSP 1 Score: 224.557 bits (571), Expect = 4.679e-63
Identity = 108/235 (45.96%), Postives = 174/235 (74.04%), Query Frame = -2
Query:    2 RRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGV-HGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFE--PAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 697
            RR+NE+A++ K  +++L++  +R  KL +Y+ +SN+A+ EQ+E EE +  E+E    R++E+N+EL  V++ L  A ++  E+ R  K+ E+ ++L RL+P V +GRL+++CQP H+KYQ+A+TKV G+YM+AIV  + K A+DCIQ++K++R EPETFLP+++LDV P++E+LR++R      LV+DV+Q       +K+ +QF CGNALVC+T++ ART+AF   ER+KTV+L
Sbjct:  343 RRKNEVAANIKHSQTQLDDLTRRAGKLEDYVITSNKALAEQREQEECLAEELECGRVRMQEVNEELAGVLSELQNAGIDSQENRRQQKRNEVFDSLHRLYPDVVYGRLVDLCQPIHKKYQLAVTKVFGRYMNAIVVSSAKVARDCIQFIKEERAEPETFLPIEYLDVNPLNERLREVR---GAKLVVDVVQCSQNAPQLKRVVQFVCGNALVCETLKDARTIAFGGPERRKTVAL 574          

HSP 2 Score: 66.6254 bits (161), Expect = 4.755e-11
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = -1
Query: 1359 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKE 1595
            QLE+  I++KA+N LVFQG VES+AM NAKER +  E IS S E   +Y      ++K +E    + N+K+  +AE+K+
Sbjct:  120 QLEKIGIVVKARNCLVFQGAVESLAMMNAKERTKLFEHISNSAELAKDYNTKLTALKKAKENTQFHFNRKRAAIAEKKQ 198          
BLAST of SMED30015457 vs. Ensembl Cavefish
Match: smc1b (structural maintenance of chromosomes 1B [Source:ZFIN;Acc:ZDB-GENE-091217-1])

HSP 1 Score: 224.172 bits (570), Expect = 4.713e-63
Identity = 108/235 (45.96%), Postives = 174/235 (74.04%), Query Frame = -2
Query:    2 RRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGV-HGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFE--PAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 697
            RR+NE+A++ K  +++L++  +R  KL +Y+ +SN+A+ EQ+E EE +  E+E    R++E+N+EL  V++ L  A ++  E+ R  K+ E+ ++L RL+P V +GRL+++CQP H+KYQ+A+TKV G+YM+AIV  + K A+DCIQ++K++R EPETFLP+++LDV P++E+LR++R      LV+DV+Q       +K+ +QF CGNALVC+T++ ART+AF   ER+KTV+L
Sbjct:  343 RRKNEVAANIKHSQTQLDDLTRRAGKLEDYVITSNKALAEQREQEECLAEELECGRVRMQEVNEELAGVLSELQNAGIDSQENRRQQKRNEVFDSLHRLYPDVVYGRLVDLCQPIHKKYQLAVTKVFGRYMNAIVVSSAKVARDCIQFIKEERAEPETFLPIEYLDVNPLNERLREVR---GAKLVVDVVQCSQNAPQLKRVVQFVCGNALVCETLKDARTIAFGGPERRKTVAL 574          

HSP 2 Score: 66.2402 bits (160), Expect = 5.175e-11
Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = -1
Query: 1359 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKE 1595
            QLE+  I++KA+N LVFQG VES+AM NAKER +  E IS S E   +Y      ++K +E    + N+K+  +AE+K+
Sbjct:  120 QLEKIGIVVKARNCLVFQGAVESLAMMNAKERTKLFEHISNSAELAKDYNTKLTALKKAKENTQFHFNRKRAAIAEKKQ 198          
BLAST of SMED30015457 vs. Ensembl Cavefish
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:103045898])

HSP 1 Score: 81.2629 bits (199), Expect = 1.086e-15
Identity = 85/335 (25.37%), Postives = 162/335 (48.36%), Query Frame = -2
Query:    2 QLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQ---KVAEKTSHLS-------AVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEAR---------VEKHESSRAAKKQ--ELIENLKRL-----FPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 928
            QLQ   +++E++++     +  I+    +  ELE  +++E   L Q    + E+TS L          L  LS+  NE +   D  +   +   S      S+LN++++ LQ        +   + E++ A + ++V++    + +++  +ELE +    GEAR         VE+ +SS ++ +   ++++ L +       PG+ GRL ++     R Y VAI+   G  +D I+ DT  TA+ C+ ++K Q I   TF+ LD + V   ++ +  I  P N+  + D+++ +   ++ A  FA  + LV   +E A  VAF   +R + V+L
Sbjct:  424 QLQKDKEKLEEVRNVPASSEKIITEASAQKEELEKQKVKEEESLAQVMESLKEETSGLQNEKEQKEKELLELSKAVNETRSQMDVAQSELDIYLSQHNTAVSQLNQAKETLQ-------GTADTLRERRAAIKDLQVKIPKCEQELKKDEQELEQISGQDGEARGVVSDLRQKVEEAKSSLSSNRSRGKVLDALMQQKQSGKIPGIFGRLGDLGAIDER-YDVAISSSCGS-LDNILVDTIDTAQKCVVFLKSQNIGVATFIGLDKMKV--WEKNMVAISTPENIPRLFDMVKVKDESVRPAFYFALRDTLVAKDLEQATRVAFQKDKRWRVVTL 747          
BLAST of SMED30015457 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000346.1 (pep scaffold:Pmarinus_7.0:GL477118:44770:74561:-1 gene:ENSPMAG00000000296.1 transcript:ENSPMAT00000000346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 284.648 bits (727), Expect = 4.224e-95
Identity = 156/456 (34.21%), Postives = 281/456 (61.62%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYE-LKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  ++E +EA  Y+ L+ EL +   +L+L  L++NE +   ++ E     ++L       +  D++++  ++++ +  RE   +E+ IK  E              P++IKV + + H + + + +++  ++AR + +  ++++ +L+ ++  +E+ + E+E L  +Q   E   + E++ +Q+ EY++LK++V  +   ++  L+   R     ++  +   R+  E  S  K+K+ E  + + R++K+++YI+ +  AI E    + ++  +VE A +R  EIN E+  +   LG+AR E+HE+ R  ++ E +++L RLFPG + GRL+ +CQP HRKYQ+A+TKVLG+ M+AI+ DT  TA+DCI+Y+K+QR E E FLPLD+L VRPI+E+LR++R      L++DVI+F+P  + +ALQFAC NALVC+T+E AR +AF +  R+K VSL
Sbjct:  197 KEARLEKEEAENYRHLRDELASAHTQLNLFLLYHNEQQMKVLENELAGVGDQLDQQRALMSTTDDELRVRKQEIGRLGRELQQVEKAIKAKEMDLGQSK-------PQYIKVKENISHRLRRMESTRQLLQNARAEWIRRKKDIDELERELVAVERARQEFEQLVGTQSQSE---DFEIDESQVLEYYRLKEEVGRRAGGMTQELETFKRAQKADQEHLELETRKMKETQSKVKQKQQEYEDQQNRIEKIKQYIEKTRSAIEELDVEQVSLTEQVEGARRRALEINDEVVALTAQLGDARTEQHENKRFKRRAEALDSLLRLFPGAIFGRLVNLCQPTHRKYQLAVTKVLGRNMEAIIVDTDSTARDCIRYLKEQRCEAEMFLPLDYLQVRPINERLRELR---GAKLLMDVIKFDPPQVSRALQFACSNALVCETLEDARHIAFGSHVRQKCVSL 639          

HSP 2 Score: 82.0333 bits (201), Expect = 4.224e-95
Identity = 45/81 (55.56%), Postives = 55/81 (67.90%), Query Frame = -1
Query: 1353 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1595
            QL +  IL KA+NFLVFQG VESIAMK  KER    E+IS+S E  AEYE+ K  + K  E+   N + K+NI AERKEA+
Sbjct:  120 QLAKRGILTKARNFLVFQGAVESIAMKTPKERTWLFEQISQSGELAAEYEQCKTAMLKANEDTQFNYHCKRNITAERKEAR 200          
BLAST of SMED30015457 vs. Ensembl Sea Lamprey
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 249.98 bits (637), Expect = 2.514e-74
Identity = 127/274 (46.35%), Postives = 193/274 (70.44%), Query Frame = -2
Query:    2 QLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLF-PGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 820
            Q++ Y+ LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E+ KR++KL EYI +S  ++ EQK+ E  +  EVE+A +RIEEIN EL  V+  LG+AR+++ E+SR  ++ E++E+LKRL+   V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR  PE   P     V+P DEKLR++R      LV+DVI++EP  IKKALQ+ACGN+LVC+ VE AR +AF   +R K V+L
Sbjct:    1 QVKVYNSLKEEASKRAAVLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENHKRVEKLEEYIVTSRSSLEEQKKLESQLTEEVETAKRRIEEINNELNQVMGQLGDARIDRQENSRQQRRVEIMESLKRLYSSSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYVKEQRDFPEPLPPFCGRQVKPTDEKLRELR---GAKLVIDVIRYEPPQIKKALQYACGNSLVCENVEDARRIAFGGPQRHKAVAL 271          
BLAST of SMED30015457 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002584.1 (pep scaffold:Pmarinus_7.0:GL477247:652:6382:-1 gene:ENSPMAG00000002354.1 transcript:ENSPMAT00000002584.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 2.123e-24
Identity = 52/81 (64.20%), Postives = 61/81 (75.31%), Query Frame = -1
Query: 1353 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER Q  EEIS+S E   EYER K E+ K EE+   N ++KKNI AERKEAK
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTQLFEEISRSGELATEYERRKREMMKAEEDTQFNYHRKKNIAAERKEAK 200          
BLAST of SMED30015457 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008608.1 (pep scaffold:Pmarinus_7.0:GL477381:37203:71735:-1 gene:ENSPMAG00000007778.1 transcript:ENSPMAT00000008608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 5.645e-15
Identity = 78/296 (26.35%), Postives = 133/296 (44.93%), Query Frame = -2
Query:    2 NLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVE------KHESSRAA-----KKQELIENL-----KRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 841
            N E ET  LQE  ++KQ+           L ALS+E NE+    +  +   +   S      + LNE+++ L        S+   +  ++E    +   + S  K + +   ELE +      AR E      K E ++++      + ++++ L     K   PG++GRL ++      KY VAI+   G  +D IV DT  TA+ C+ Y+K   I   TF+ LD + V     K + ++ P  V  + D+++     ++ A  F   + LV + +E A  VAF    R + V+L
Sbjct:  474 NFEKETKGLQEEKEVKQQE----------LLALSKEVNERCSRMEVAQSELDLYMSRHTSALAALNEAKQALT-------STTEGLCGRRENIRKLETTIPSTEKELAQAQLELEKLAPLENAARAEVRALRQKTEEAKSSLCASRSRNKVLQLLMDQKNKGSLPGIYGRLGDLG-AIEEKYDVAISSCCGA-LDNIVVDTMDTAQACVTYLKKHNIGSATFIGLDKMRVWEGTMK-KSVQGPEGVLRLFDLVRVGDEAVRTAFYFTLRDTLVANNLEQASRVAFQHQRRWRVVTL 749          
BLAST of SMED30015457 vs. Ensembl Yeast
Match: SMC1 (Subunit of the multiprotein cohesin complex; essential protein involved in chromosome segregation and in double-strand DNA break repair; SMC chromosomal ATPase family member, binds DNA with a preference for DNA with secondary structure [Source:SGD;Acc:S000001886])

HSP 1 Score: 120.553 bits (301), Expect = 4.074e-29
Identity = 85/302 (28.15%), Postives = 163/302 (53.97%), Query Frame = -2
Query:    2 EYELKQSQISVEKGRNLELETNQLQEYHKLKQK-VAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRL----QKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDV--IQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 886
            E E+KQS  + +K    +L  N L+ Y+ L +K + E  S L   +  L+   N++++I + LER       S++R   EL+ + ++L      LR  ++  N    E+    + ++ ++ESA  +  ++N +L   +  + +    + E+ +  K +E I  LKR FPGV G + ++C P   KY +A++ +LGK  D+++ +    A++CI ++K QR    +F+PLD      I+ +L  +  P +   +L +  I +EP   +KA+Q+ CG++++C+T+  A+ + +  G R K V++
Sbjct:  365 EEEIKQSARNYDK---FKLNENDLKTYNCLHEKYLTEGGSILEEKIAVLN---NDKREIQEELERFNKRADISKRRITEELSITGEKLDTQLNDLRVSLNEKNALHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLD-----TIETELPTLSLPDSQDYILSINAIDYEPE-YEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTI 654          

HSP 2 Score: 47.7506 bits (112), Expect = 3.796e-6
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = -1
Query: 1464 LEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIE 1592
            LE  NIL+KAKNFLVFQG VE IA ++  E  +  EE+S SI+
Sbjct:  135 LENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQ 177          
BLAST of SMED30015457 vs. Ensembl Yeast
Match: SMC2 (Subunit of the condensin complex; condensin reorganizes chromosomes during both mitosis and meiosis; essential SMC chromosomal ATPase family member that forms a subcomplex with Smc2p that has ATP-hydrolyzing and DNA-binding activity, but other condensin subunits are required for chromatin binding; required for clustering of tRNA genes at the nucleolus [Source:SGD;Acc:S000001927])

HSP 1 Score: 63.1586 bits (152), Expect = 6.762e-11
Identity = 40/136 (29.41%), Postives = 75/136 (55.15%), Query Frame = -2
Query:    2 GVHGRLLEMCQPAHRKYQVAI-TKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPE-TFLPLDFLDVRPIDEKLRDIRE---PPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 394
            GV G+L ++     R Y  A+ T   G+  + +V D+Q       Q ++  R+    T +PLD +  RPI  ++ D+ +   P  V L +++I+F+ +I K A++F  GN+L+C+  E A+ + F+   R ++++L
Sbjct:  525 GVVGQLFQIDNDNIR-YATALQTCAGGRLFNVVVQDSQTAT----QLLERGRLRKRVTIIPLDKIYTRPISSQVLDLAKKIAPGKVELAINLIRFDESITK-AMEFIFGNSLICEDPETAKKITFHPKIRARSITL 654          
BLAST of SMED30015457 vs. Ensembl Nematostella
Match: EDO49596 (Structural maintenance of chromosomes protein [Source:UniProtKB/TrEMBL;Acc:A7RFF3])

HSP 1 Score: 309.301 bits (791), Expect = 2.906e-98
Identity = 180/451 (39.91%), Postives = 291/451 (64.52%), Query Frame = -2
Query:    2 KIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1354
            K E +EA KY K   +L     EL L KL++NE + + +  E   K  E    ++K+  +++Q+K  +++  K  RE   IE+ I++ E              P  IK  +K  H+M + + SKKA E A+     +Q E+ +L++ ++ ++QL ++YE  Q   +  +G +LEL  +QL+EY++LK++   +T+ +   LD ++RE    +++ D +++ + ++ + QK+ + +  + R+R+ KL EY+ ++   + + K   E++  EV  A  R  +I+ +LE V   L EA+  KHES+R  KK+E+++++KRLFPGVHGRL+E+C+P H+KY +A+TKVLG  MDA++ D++KTAKDCIQY+K+QR + ETFLPLD + V+P++E+LR I    N  L++DVI++ PA++KKALQ+ACGNALVCDT+E AR +AF   ERKKTVSL
Sbjct:  185 KQEKEEADKYNKWNQDLVDSLQELQLFKLYHNEQDISHMTSEMKTKSRETEKLDSKKQAVEKQLKGKKQENAKLTREMGIIEKTIREKEDELNKKR-------PAFIKAKEKTSHVMKRHETSKKALEKAKAARKRHQAEIEELKNSLEEVKQLAAQYE--QEVAAESQGEDLELMDSQLEEYNRLKEEARRETAAVRQQLDRINREQQSDQELLDGVKQTKTDLKTRQKQLQEQSVQLRERIDKLEEYLTTNVEHVEKLKAESESLSSEVSDANTRHHDISGKLESVQLELNEAKSNKHESARHQKKKEVLDSMKRLFPGVHGRLIELCEPTHKKYNLAVTKVLGMNMDAVIVDSEKTAKDCIQYLKEQRADRETFLPLDAIKVKPVNEQLRQI--GGNTKLLIDVIRYSPAVVKKALQYACGNALVCDTMEEARKIAFGGSERKKTVSL 624          

HSP 2 Score: 68.5514 bits (166), Expect = 2.906e-98
Identity = 37/65 (56.92%), Postives = 45/65 (69.23%), Query Frame = -1
Query: 1353 FQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1547
            F GTVESIAMK  KER    E+IS+S E    YE+ K E++K EEE + N +KKK I AER+EAK
Sbjct:  121 FGGTVESIAMKTPKERTAMFEKISRSGELADSYEKKKAEMQKAEEETSFNYHKKKGIAAERREAK 185          
BLAST of SMED30015457 vs. Ensembl Nematostella
Match: EDO40646 (Structural maintenance of chromosomes protein [Source:UniProtKB/TrEMBL;Acc:A7S6N1])

HSP 1 Score: 94.7449 bits (234), Expect = 2.144e-20
Identity = 49/133 (36.84%), Postives = 76/133 (57.14%), Query Frame = -2
Query:    2 FPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 400
             PG++GRL ++      KY +AI+   G  +D IVCDT +TA+ C+QY+K   I   TF+ LD ++V   D   + I+ P NV  + D+++ + A +  A  FA  N LV D +E A  +AF   +R + V+L
Sbjct:  544 IPGLYGRLGDLG-AIDDKYDIAISTACGA-LDHIVCDTMETAQTCVQYLKKNNIGAATFIGLDKVEVWRKDASSK-IQTPSNVPRLYDLVRVKDAKVSTAFYFALRNTLVADELEQATRIAFQGNKRWRVVTL 673          
BLAST of SMED30015457 vs. Ensembl Nematostella
Match: EDO27517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T917])

HSP 1 Score: 60.8474 bits (146), Expect = 9.130e-11
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = -2
Query:  212 FPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLD 400
             PG++GRL ++      KY +AI+   G  +D IVCDT +TA+ C+QY+K   I   TF+ LD
Sbjct:  139 IPGLYGRLGDL-GAIDDKYDIAISTACGA-LDHIVCDTMETAQTCVQYLKKNNIGAATFIGLD 199          
BLAST of SMED30015457 vs. Ensembl Medaka
Match: smc1al (structural maintenance of chromosomes 1A [Source:NCBI gene;Acc:100049244])

HSP 1 Score: 328.176 bits (840), Expect = 1.496e-108
Identity = 182/444 (40.99%), Postives = 304/444 (68.47%), Query Frame = -2
Query:    2 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPG-VHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1330
            +Y++LK E+    ++L L KL++NE E  ++ KE  ++ +E+     K + ++E++K  +K++ +  REQ  IE+EIK+ +              P++IK  +   H + K + ++K+ ++A++ +   + ++ +L  +M  +E  K ++E +  + +  +G++L LE NQ+++YH+LK++ +++ + L+  L+  +R+    +D  D  ER++ E  +  K+K  E+ E++KR++KL +YI +S ++++EQK  EE +  EVE A +RI+EIN EL  V+  LG+AR+++ E+SR  +K E++E++KRL+PG V+GRL+++CQP  +KYQ+A+TKVLGK MDAI+ D++KT +DCIQY+K+QR EPETFLPLD+L+V+P DEKLR++R      LV+DVI++EP  IKKALQ+ACGNALVCD VE AR +AF    R KTV+L
Sbjct:  208 RYQRLKDEVARASVQLQLFKLYHNETEIEKLNKELGQRNKEIDKDRKKMDHVEEELKDKKKELGRMMREQQTIEKEIKEKD-------SELNQKRPQYIKAKENTAHKIKKLEAARKSLQNAQKMYKKRKADMDELDKEMRAVEIAKQDFEERMEEEAQSQGQDLTLEENQVKQYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKIREIEENQKRIEKLEDYIATSRQSLDEQKRMEEELTEEVEMAKRRIDEINMELNQVMEQLGDARIDRQENSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELR---GAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGPYRHKTVAL 641          

HSP 2 Score: 85.5001 bits (210), Expect = 1.496e-108
Identity = 44/75 (58.67%), Postives = 55/75 (73.33%), Query Frame = -1
Query: 1371 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVA 1595
            +LE+  IL+KA+NFLVFQG VESIAMKN KER    EEIS+S E   EY+R K+E+ K EE+   N ++KKNI A
Sbjct:  120 ELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKEMVKAEEDTQFNYHRKKNIAA 194          
BLAST of SMED30015457 vs. Ensembl Medaka
Match: smc1b (meiosis-specific cohesin subunit SMC1 beta [Source:NCBI gene;Acc:100049500])

HSP 1 Score: 264.618 bits (675), Expect = 3.649e-83
Identity = 162/453 (35.76%), Postives = 269/453 (59.38%), Query Frame = -2
Query:    2 EAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREY--NEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFP-GVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQF----EPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1339
            EA KY++L  EL+  R++L L +L+YNE   N I     +++  +   +++   +++ +K H+K+     REQ   E+EI+  E               +++K      H M K +E + A +  R+     Q++L + Q ++  +E+    YE +  Q    K R++EL  +Q++ Y +LK+ V ++ +  S   + L  E   N +K  +D  +RR+ E+  + +   + L +   R +KL+EYI S   ++ +  + EE +  E++ A +R  E+N EL  V+  LG AR++ HES R  +++EL+E L RLFP  V+GRL ++C P H+KYQ+A+TKV G  M+AIV  ++KTA+DCI +MK +R EPETFLP+D+L V P++E+LR+I   P   +V+DV+QF      A +KK +Q+ CGNALVC++++ AR++AF+  +R KTVSL
Sbjct:  205 EAQKYQELLDELHENRLQLSLAELYYNEKAINTISDTLSERQNAVAVKKSELANLEQMVKLHKKEHGHLTREQQHTEKEIRDQEHALSQSR-------SQYVKAKVNTSHHMKKIEEGRCAVKKKRKCLTHKQQQLKEDQLEITELEKAWKSYEKQVQQEGASKRRDIELNEDQVERYDELKKLVRKQGAVFSQQAEKLQWELKANSEKIAFD--QRRKKEMEIAIRNSLTHLEDMTSRSEKLKEYIKSCTSSLEDCCQKEEKLSAELQWAAQRSVEVNHELTQVMEELGNARLDSHESRRQLQRRELLEKLCRLFPENVYGRLSDLCSPIHKKYQLAVTKVFGSNMNAIVVSSEKTARDCISFMKAERAEPETFLPIDYLVVSPLNERLREI---PGAKMVVDVVQFNMSTNAAQLKKVVQYVCGNALVCESIKDARSLAFDQEQRVKTVSL 645          

HSP 2 Score: 64.3142 bits (155), Expect = 3.649e-83
Identity = 35/79 (44.30%), Postives = 54/79 (68.35%), Query Frame = -1
Query: 1359 QLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKE 1595
            +LE+ +I+ K +N +VFQGTVE IA+K+ KER + +E IS+S E+ AEY   K  + K +E+   + NKKK+   E+K+
Sbjct:  120 ELEKLSIMTKVQNCMVFQGTVELIALKDPKERTKMLESISQSREYAAEYNAKKAALLKAKEDTQFHFNKKKSATVEKKQ 198          
BLAST of SMED30015457 vs. Ensembl Medaka
Match: smc1b (meiosis-specific cohesin subunit SMC1 beta [Source:NCBI gene;Acc:100049500])

HSP 1 Score: 264.233 bits (674), Expect = 1.627e-77
Identity = 162/453 (35.76%), Postives = 269/453 (59.38%), Query Frame = -2
Query:    2 EAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREY--NEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFP-GVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQF----EPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1339
            EA KY++L  EL+  R++L L +L+YNE   N I     +++  +   +++   +++ +K H+K+     REQ   E+EI+  E               +++K      H M K +E + A +  R+     Q++L + Q ++  +E+    YE +  Q    K R++EL  +Q++ Y +LK+ V ++ +  S   + L  E   N +K  +D  +RR+ E+  + +   + L +   R +KL+EYI S   ++ +  + EE +  E++ A +R  E+N EL  V+  LG AR++ HES R  +++EL+E L RLFP  V+GRL ++C P H+KYQ+A+TKV G  M+AIV  ++KTA+DCI +MK +R EPETFLP+D+L V P++E+LR+I   P   +V+DV+QF      A +KK +Q+ CGNALVC++++ AR++AF+  +R KTVSL
Sbjct:  192 EAQKYQELLDELHENRLQLSLAELYYNEKAINTISDTLSERQNAVAVKKSELANLEQMVKLHKKEHGHLTREQQHTEKEIRDQEHALSQSR-------SQYVKAKVNTSHHMKKIEEGRCAVKKKRKCLTHKQQQLKEDQLEITELEKAWKSYEKQVQQEGASKRRDIELNEDQVERYDELKKLVRKQGAVFSQQAEKLQWELKANSEKIAFD--QRRKKEMEIAIRNSLTHLEDMTSRSEKLKEYIKSCTSSLEDCCQKEEKLSAELQWAAQRSVEVNHELTQVMEELGNARLDSHESRRQLQRRELLEKLCRLFPENVYGRLSDLCSPIHKKYQLAVTKVFGSNMNAIVVSSEKTARDCISFMKAERAEPETFLPIDYLVVSPLNERLREI---PGAKMVVDVVQFNMSTNAAQLKKVVQYVCGNALVCESIKDARSLAFDQEQRVKTVSL 632          
BLAST of SMED30015457 vs. Ensembl Medaka
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:101157474])

HSP 1 Score: 80.8777 bits (198), Expect = 1.634e-15
Identity = 89/332 (26.81%), Postives = 164/332 (49.40%), Query Frame = -2
Query:    2 QLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQ---KVAEKTSHL-------SAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELEL------VVTNLGEARVEKHESSRAAKKQ--ELIENLKRL-----FPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 928
            QL+ +  ++E+++S     +  IS    R  +LE  +++E  KLK+    + E+TS L          L  LS+  NE +   D  +   +   S  K   ++LN +++ LQ   + +     AI   K+ E  I  +V+   K  EE+ K  ++      VV  L E +V++ ++S ++ +   ++++ L +L      PG++GRL ++      KY VAI+   G  +D IV DT  TA+ C+ ++K+Q I   TF+ LD   ++  ++ +  IR P +   + D+++     ++ A  FA  + LV   +E A  +AF   +R + V+L
Sbjct:  400 QLEKEQKKLEEVQSIPSSSEKAISEATARKEDLEKQKVKEEDKLKEVMESLKEETSGLQQDKEKKEKELMELSKAVNETRSRMDLAQSELDIYLSRHKTALAQLNTAKQTLQTTSDTLKERRAAI---KDLEVQIPEKVQELKKDQEELEKLTKMDNETREVVKELRE-KVDEAKTSLSSNRSRGKVLDALMQLKKTGRIPGIYGRLGDLG-AIDEKYDVAISSCCGA-LDNIVVDTIDTAQKCVTFLKEQNIGVATFIGLD--KMKTWEKNMAPIRTPEDSPRLFDMVRVNDDSVRPAFYFALRDTLVAQDMEQATRMAFQKEKRWRVVTL 723          
BLAST of SMED30015457 vs. Ensembl Medaka
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:101157474])

HSP 1 Score: 80.8777 bits (198), Expect = 1.697e-15
Identity = 89/332 (26.81%), Postives = 164/332 (49.40%), Query Frame = -2
Query:    2 QLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQ---KVAEKTSHL-------SAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELEL------VVTNLGEARVEKHESSRAAKKQ--ELIENLKRL-----FPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 928
            QL+ +  ++E+++S     +  IS    R  +LE  +++E  KLK+    + E+TS L          L  LS+  NE +   D  +   +   S  K   ++LN +++ LQ   + +     AI   K+ E  I  +V+   K  EE+ K  ++      VV  L E +V++ ++S ++ +   ++++ L +L      PG++GRL ++      KY VAI+   G  +D IV DT  TA+ C+ ++K+Q I   TF+ LD   ++  ++ +  IR P +   + D+++     ++ A  FA  + LV   +E A  +AF   +R + V+L
Sbjct:  422 QLEKEQKKLEEVQSIPSSSEKAISEATARKEDLEKQKVKEEDKLKEVMESLKEETSGLQQDKEKKEKELMELSKAVNETRSRMDLAQSELDIYLSRHKTALAQLNTAKQTLQTTSDTLKERRAAI---KDLEVQIPEKVQELKKDQEELEKLTKMDNETREVVKELRE-KVDEAKTSLSSNRSRGKVLDALMQLKKTGRIPGIYGRLGDLG-AIDEKYDVAISSCCGA-LDNIVVDTIDTAQKCVTFLKEQNIGVATFIGLD--KMKTWEKNMAPIRTPEDSPRLFDMVRVNDDSVRPAFYFALRDTLVAQDMEQATRMAFQKEKRWRVVTL 745          
BLAST of SMED30015457 vs. Planmine SMEST
Match: SMESG000022017.1 (SMESG000022017.1)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 438/454 (96.48%), Postives = 439/454 (96.70%), Query Frame = -2
Query:    2 KRQKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 1363
            K  KIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQ             PEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVV+NLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL
Sbjct:  203 KEAKIEIDEAAKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQDISKKR-------PEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVSNLGEARVEKHESSRAAKKQELIENLKRLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSL 649          

HSP 2 Score: 158.688 bits (400), Expect = 7.302e-41
Identity = 81/83 (97.59%), Postives = 81/83 (97.59%), Query Frame = -1
Query: 1353 AYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQNVEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 1601
            AYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQ  EEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK
Sbjct:  124 AYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQMFEEISKSIEFKAEYERSKEEVRKLEEEATLNLNKKKNIVAERKEAK 206          
BLAST of SMED30015457 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 50.447 bits (119), Expect = 4.174e-6
Identity = 73/334 (21.86%), Postives = 137/334 (41.02%), Query Frame = -2
Query:  401 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLM---DKQKESKKAYESARQQHLANQEELAQLQSQM-DRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAV---LDALSREYNEQKDIYDALERR---------RNEIASS--------QKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRL 1330
            K+ KLK E+    I+   +K    E +  EI+K   +  + L    +   +I+E I  H         EQ GI  E+ K                P        LK ++   D+  +  K  +S  Q    N  ++ + ++ M D I     EY    S    E    + L   ++++  K+ +K+ ++  +L      LDA+S+ + ++KD+     R           N + S         +K  E +LN+S   ++KL +  +  + A  + KEA   I  ++ +    I +  KEL+   +N+    ++K  +   + K E++EN+K +
Sbjct: 1367 KFYKLKNEIKNFSIQFQKMKDDAKE-KYGEIEKLKTRYNKILEDLRSTFTDINETISGH---------EQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNA-EQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNI 1689          
BLAST of SMED30015457 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 50.0618 bits (118), Expect = 4.863e-6
Identity = 71/334 (21.26%), Postives = 137/334 (41.02%), Query Frame = -2
Query:  401 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLM---DKQKESKKAYESARQQHLANQEELAQLQSQM-DRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAV---LDALSREYNEQKDIYDALERRRNEIASS-----------------QKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRL 1330
            K+ KLK E+    I+   +K    E +  EI+K   +  + L    +   +I+E I  H         EQ GI  E+ K                P        LK ++   D+  +  K  +S  Q    N  ++ + ++ M D I     EY    S    E    + L   ++++  K+ +K+ ++  +L      LDA+S+ + ++KD+     R   ++  +                 +K  E +LN+S   ++KL +  +  + A  + KEA   I  ++ +    I +  KEL+   +N+    ++K  +   + K E++EN+K +
Sbjct: 1334 KFYKLKNEIKNFSIQFQKMKDDAKE-KYGEIEKLKTRYNKILEDLRSTFTDINETISGH---------EQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNA-EQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNI 1656          
BLAST of SMED30015457 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 50.0618 bits (118), Expect = 4.904e-6
Identity = 71/334 (21.26%), Postives = 137/334 (41.02%), Query Frame = -2
Query:  401 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLM---DKQKESKKAYESARQQHLANQEELAQLQSQM-DRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAV---LDALSREYNEQKDIYDALERRRNEIASS-----------------QKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRL 1330
            K+ KLK E+    I+   +K    E +  EI+K   +  + L    +   +I+E I  H         EQ GI  E+ K                P        LK ++   D+  +  K  +S  Q    N  ++ + ++ M D I     EY    S    E    + L   ++++  K+ +K+ ++  +L      LDA+S+ + ++KD+     R   ++  +                 +K  E +LN+S   ++KL +  +  + A  + KEA   I  ++ +    I +  KEL+   +N+    ++K  +   + K E++EN+K +
Sbjct: 1328 KFYKLKNEIKNFSIQFQKMKDDAKE-KYGEIEKLKTRYNKILEDLRSTFTDINETISGH---------EQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNA-EQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNI 1650          
BLAST of SMED30015457 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 50.0618 bits (118), Expect = 5.069e-6
Identity = 71/334 (21.26%), Postives = 137/334 (41.02%), Query Frame = -2
Query:  401 KYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQXXXXXXXXXXXXXPEHIKVHQKLKHLM---DKQKESKKAYESARQQHLANQEELAQLQSQM-DRIEQLKSEYELKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAV---LDALSREYNEQKDIYDALERRRNEIASS-----------------QKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEETIRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLKRL 1330
            K+ KLK E+    I+   +K    E +  EI+K   +  + L    +   +I+E I  H         EQ GI  E+ K                P        LK ++   D+  +  K  +S  Q    N  ++ + ++ M D I     EY    S    E    + L   ++++  K+ +K+ ++  +L      LDA+S+ + ++KD+     R   ++  +                 +K  E +LN+S   ++KL +  +  + A  + KEA   I  ++ +    I +  KEL+   +N+    ++K  +   + K E++EN+K +
Sbjct: 1328 KFYKLKNEIKNFSIQFQKMKDDAKE-KYGEIEKLKTRYNKILEDLRSTFTDINETISGH---------EQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNA-EQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNI 1650          
The following BLAST results are available for this feature:
BLAST of SMED30015457 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMC1A4.465e-10542.20structural maintenance of chromosomes 1A [Source:H... [more]
SMC1A7.007e-10542.20structural maintenance of chromosomes 1A [Source:H... [more]
SMC1B2.040e-9034.48structural maintenance of chromosomes 1B [Source:H... [more]
SMC1B2.390e-9034.48structural maintenance of chromosomes 1B [Source:H... [more]
SMC1A4.385e-2153.68structural maintenance of chromosomes 1A [Source:H... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
him-14.422e-5332.49Structural maintenance of chromosomes protein 1 [... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SMC17.162e-9637.70gene:FBgn0040283 transcript:FBtr0084541[more]
glu1.918e-1327.54gene:FBgn0015391 transcript:FBtr0080935[more]
back to top
BLAST of SMED30015457 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc1al1.538e-10440.09structural maintenance of chromosomes 1A, like [So... [more]
smc1al2.144e-10440.09structural maintenance of chromosomes 1A, like [So... [more]
smc1a3.679e-10339.64structural maintenance of chromosomes 1A [Source:Z... [more]
smc1b3.278e-7032.02structural maintenance of chromosomes 1B [Source:Z... [more]
smc1al1.425e-1958.67structural maintenance of chromosomes 1A, like [So... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sia11.319e-10842.12siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
sia11.583e-10842.12siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
sia11.623e-10842.12siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
sia11.808e-10842.12siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
sia12.015e-10842.12siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smc1a4.044e-10542.20structural maintenance of chromosomes 1A [Source:M... [more]
Smc1b1.344e-8833.99structural maintenance of chromosomes 1B [Source:M... [more]
Smc41.188e-1324.83structural maintenance of chromosomes 4 [Source:MG... [more]
Smc41.429e-1324.83structural maintenance of chromosomes 4 [Source:MG... [more]
Smc23.806e-928.36structural maintenance of chromosomes 2 [Source:MG... [more]
back to top
BLAST of SMED30015457 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O93308|SMC1A_XENLA4.810e-10842.86Structural maintenance of chromosomes protein 1A O... [more]
sp|O97593|SMC1A_BOVIN2.743e-10442.20Structural maintenance of chromosomes protein 1A O... [more]
sp|Q9CU62|SMC1A_MOUSE2.828e-10442.20Structural maintenance of chromosomes protein 1A O... [more]
sp|Q14683|SMC1A_HUMAN3.365e-10442.20Structural maintenance of chromosomes protein 1A O... [more]
sp|Q9Z1M9|SMC1A_RAT5.134e-10341.98Structural maintenance of chromosomes protein 1A O... [more]
back to top
BLAST of SMED30015457 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KS106.377e-2267.47Structural maintenance of chromosome 1 (Fragment) ... [more]
A0A419PXH16.654e-2267.47Structural maintenance of chromosomes protein OS=C... [more]
A0A4S2M8U95.514e-2267.47Structural maintenance of chromosomes protein OS=O... [more]
A0A4E0RDR36.323e-2367.47Putative structural maintenance OS=Fasciola hepati... [more]
A0A504Y8H37.519e-2367.47Structural maintenance of chromosomes protein OS=F... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc1al3.783e-10840.09structural maintenance of chromosomes 1A, like [So... [more]
smc1a1.095e-10440.09structural maintenance of chromosomes 1A [Source:N... [more]
smc1b4.679e-6345.96structural maintenance of chromosomes 1B [Source:Z... [more]
smc1b4.713e-6345.96structural maintenance of chromosomes 1B [Source:Z... [more]
smc41.086e-1525.37structural maintenance of chromosomes 4 [Source:NC... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000346.14.224e-9534.21pep scaffold:Pmarinus_7.0:GL477118:44770:74561:-1 ... [more]
SMC1A2.514e-7446.35structural maintenance of chromosomes 1A [Source:H... [more]
ENSPMAT00000002584.12.123e-2464.20pep scaffold:Pmarinus_7.0:GL477247:652:6382:-1 gen... [more]
ENSPMAT00000008608.15.645e-1526.35pep scaffold:Pmarinus_7.0:GL477381:37203:71735:-1 ... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SMC14.074e-2928.15Subunit of the multiprotein cohesin complex; essen... [more]
SMC26.762e-1129.41Subunit of the condensin complex; condensin reorga... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO495962.906e-9839.91Structural maintenance of chromosomes protein [So... [more]
EDO406462.144e-2036.84Structural maintenance of chromosomes protein [So... [more]
EDO275179.130e-1142.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30015457 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc1al1.496e-10840.99structural maintenance of chromosomes 1A [Source:N... [more]
smc1b3.649e-8335.76meiosis-specific cohesin subunit SMC1 beta [Source... [more]
smc1b1.627e-7735.76meiosis-specific cohesin subunit SMC1 beta [Source... [more]
smc41.634e-1526.81structural maintenance of chromosomes 4 [Source:NC... [more]
smc41.697e-1526.81structural maintenance of chromosomes 4 [Source:NC... [more]
back to top
BLAST of SMED30015457 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022017.17.302e-4196.48SMESG000022017.1[more]
SMESG000056013.14.174e-621.86SMESG000056013.1[more]
SMESG000056013.14.863e-621.26SMESG000056013.1[more]
SMESG000056013.14.904e-621.26SMESG000056013.1[more]
SMESG000056013.15.069e-621.26SMESG000056013.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015457 ID=SMED30015457|Name=SMED30015457|organism=Schmidtea mediterranea sexual|type=transcript|length=1601bp
CCAATGAGACAGTTTTTTTCCTTTCTCCGGTATTAAATGCCACAGTTCTT
GCATGTTCGACAGTATCACACACTAAGGCGTTTCCGCAAGCAAATTGTAA
GGCTTTTTTGATAATTGCGGGTTCGAATTGGATCACATCGAGAACTAGAT
GGACATTTGGTGGTTCTCGTATATCTCTCAATTTTTCATCAATGGGGCGA
ACATCTAAAAAGTCCAACGGCAAGAATGTTTCAGGTTCTATTCTTTGATC
CTTCATGTATTGAATGCAATCTTTAGCTGTTTTTTGGGTATCGCACACAA
TTGCGTCCATGTATTTACCTAAGACTTTAGTTATAGCAACTTGGTATTTC
CTATGAGCCGGTTGGCACATTTCTAGTAATCTACCATGAACTCCGGGAAA
TAATCTTTTCAAATTCTCTATCAATTCTTGTTTCTTAGCTGCGCGTGATG
ATTCATGTTTCTCTACTCGAGCCTCTCCTAAATTTGTAACAACAAGTTCC
AGTTCCTTATTTATTTCTTCGATTCGTTTCGTTGCTGATTCTACTTCAAC
ACGGATTGTTTCTTCCGCTTCTTTTTGCTCGTTGATAGCTCTATTGCTCG
AATCGATATATTCTCGTAATTTCTGTAATCGTTTCCTGCTTTCGTTTAAT
TCACTCTCCTTTCGTTTTTGTGAACTGGCAATTTCATTTCTTCTCCTTTC
AAGTGCATCGTAAATATCTTTCTGTTCGTTATATTCTCGACTTAAAGCAT
CGAGAACAGCCGATAAATGCGAAGTTTTTTCTGCGACTTTTTGTTTCAGT
TTATGATATTCTTGTAATTGATTTGTTTCAAGTTCAAGATTACGGCCTTT
CTCAACAGATATTTGACTTTGTTTCAACTCGTATTCAGATTTTAATTGCT
CAATTCTATCCATTTGACTTTGTAGTTGAGCCAATTCTTCTTGGTTTGCA
AGATGTTGTTGTCTAGCGGATTCGTAAGCTTTTTTTGATTCCTTTTGTTT
ATCCATCAAATGCTTTAATTTTTGATGAACTTTAATATGCTCTGGACNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTTCACATTTTTTT
ATTTCCTGTTCAATACCACTTTGCTCACGATTGAATTTAGTTACTTTCTT
TCGATGGCTTTTAATTTGTTCATCAATTTCATTTCTTTTGTTTTCGTGAC
TCAACAATTCTTCTTTCTTTTTAACATGTTCTTTCTGAATCTCATTCGTT
TCTACTTCGTTGTAAAATAATTTTAACAAATGCAATTCGATTCTTTTAGT
ATTCAATTCAGTTTTTAATTTCTTGTATTTAGCTGCTTCGTCTATTTCGA
TTTTTTGCCTCTTTTCGTTCTGCGACGATATTTTTCTTTTTATTTAAATT
TAAAGTCGCTTCCTCTTCTAATTTCCTGACTTCTTCTTTCGATCTCTCAT
ATTCGGCTTTAAATTCTATTGATTTGCTTATCTCTTCAACATTTTGACAT
CTTTCTTTTGCATTTTTCATGGCAATACTTTCAACAGTTCCTTGAAAAAC
CAAAAAGTTTTTAGCTTTCATCAAAATATTAAATTGCTCCAATTGATATG
C
back to top

protein sequence of SMED30015457-orf-1

>SMED30015457-orf-1 ID=SMED30015457-orf-1|Name=SMED30015457-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=335bp
MDKQKESKKAYESARQQHLANQEELAQLQSQMDRIEQLKSEYELKQSQIS
VEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYD
ALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAINEQKEAEET
IRVEVESATKRIEEINKELELVVTNLGEARVEKHESSRAAKKQELIENLK
RLFPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQY
MKDQRIEPETFLPLDFLDVRPIDEKLRDIREPPNVHLVLDVIQFEPAIIK
KALQFACGNALVCDTVEHARTVAFNTGERKKTVSL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR029683SMC1A_metazoan
IPR036277SMC_hinge_sf
IPR010935SMC_hinge
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0008278cohesin complex
GO:0005694chromosome
Vocabulary: biological process
TermDefinition
GO:0007064mitotic sister chromatid cohesion
GO:0006281DNA repair
GO:0051276chromosome organization
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
GO:0005515protein binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 85..182
NoneNo IPR availableCOILSCoilCoilcoord: 11..48
NoneNo IPR availableGENE3DG3DSA:1.20.1060.20coord: 156..286
e-value: 2.5E-18
score: 67.7
NoneNo IPR availablePANTHERPTHR18937STRUCTURAL MAINTENANCE OF CHROMOSOMES SMC FAMILY MEMBERcoord: 3..327
IPR010935SMCs flexible hingeSMARTSM00968SMC_hinge_2coord: 204..323
e-value: 5.7E-34
score: 128.9
IPR010935SMCs flexible hingePFAMPF06470SMC_hingecoord: 204..322
e-value: 1.3E-25
score: 89.9
IPR029683Structural maintenance of chromosomes protein 1A, metazoanPANTHERPTHR18937:SF170STRUCTURAL MAINTENANCE OF CHROMOSOMES PROTEIN 1Acoord: 3..327
IPR036277SMCs flexible hinge superfamilySUPERFAMILYSSF75553Smc hinge domaincoord: 166..328