Poly [ADP-ribose] polymerase

Overview
NamePoly [ADP-ribose] polymerase
Smed IDSMED30015453
Length (bp)1796
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Poly [ADP-ribose] polymerase (SMED30015453) t-SNE clustered cells

Violin plots show distribution of expression levels for Poly [ADP-ribose] polymerase (SMED30015453) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Poly [ADP-ribose] polymerase (SMED30015453) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Poly [ADP-ribose] polymerase (SMED30015453) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015453

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015453SMESG000011115.1 Contig21414uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015453SMESG000011115.1 Contig21414newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015453SMESG000011115.1 Contig34360uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015453SMESG000011115.1 Contig34360newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015453SMESG000011115.1 Contig49033uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015453SMESG000011115.1 Contig49033newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015453SMESG000011115.1 dd_Smed_v4_2611_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP3 (poly(ADP-ribose) polymerase family member 3 [Source:HGNC Symbol;Acc:HGNC:273])

HSP 1 Score: 400.979 bits (1029), Expect = 4.898e-133
Identity = 241/506 (47.63%), Postives = 326/506 (64.43%), Query Frame = 2
Query:  137 NEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYF-VWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDA---SEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC--RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYV---ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPV--HRNITSSFGQSEYLIYQESQCRIRY 1621
            + F S   AL   P+ ++          +   G  V +DY+C LNQTNI+ NNNK+Y+IQ++Q + ++F  W RWGRVGE G + K+  +   EDA K F+KKF++KTKN+W  RD+F S  GKYTL+E+  +DE + + V V        +++  P  L   TQ L+  IF  +MF + +A + LD KK+PLGKLSK QI +GFE LE L+  +    +    L ELSS FYT+IPH+FG  +P  I + + ++ K DMLLVL DIE  QAL    + E + ++     P+PLD  +++L   L +LD  + EYK+I+ Y+E T    R   + ++WKV++  EE  F+ H  + NRKLLWHGTN+AVVAAIL SGLRIMPHSGGRVG+GIYFASEN KSAGYV    C     G MFL EVALG+E  +  D+ S+  PP GF+SV+A+G TEPD   + E++LDG +VVVP G+PV      +S+F QSEYLIYQESQCR+RY
Sbjct:   27 DPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQS-KINHFTRLEDAKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV----PHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRY 527          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP3 (poly(ADP-ribose) polymerase family member 3 [Source:HGNC Symbol;Acc:HGNC:273])

HSP 1 Score: 400.979 bits (1029), Expect = 4.898e-133
Identity = 241/506 (47.63%), Postives = 326/506 (64.43%), Query Frame = 2
Query:  137 NEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYF-VWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDA---SEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC--RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYV---ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPV--HRNITSSFGQSEYLIYQESQCRIRY 1621
            + F S   AL   P+ ++          +   G  V +DY+C LNQTNI+ NNNK+Y+IQ++Q + ++F  W RWGRVGE G + K+  +   EDA K F+KKF++KTKN+W  RD+F S  GKYTL+E+  +DE + + V V        +++  P  L   TQ L+  IF  +MF + +A + LD KK+PLGKLSK QI +GFE LE L+  +    +    L ELSS FYT+IPH+FG  +P  I + + ++ K DMLLVL DIE  QAL    + E + ++     P+PLD  +++L   L +LD  + EYK+I+ Y+E T    R   + ++WKV++  EE  F+ H  + NRKLLWHGTN+AVVAAIL SGLRIMPHSGGRVG+GIYFASEN KSAGYV    C     G MFL EVALG+E  +  D+ S+  PP GF+SV+A+G TEPD   + E++LDG +VVVP G+PV      +S+F QSEYLIYQESQCR+RY
Sbjct:   27 DPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQS-KINHFTRLEDAKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV----PHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRY 527          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP3 (poly(ADP-ribose) polymerase family member 3 [Source:HGNC Symbol;Acc:HGNC:273])

HSP 1 Score: 400.979 bits (1029), Expect = 5.074e-133
Identity = 241/506 (47.63%), Postives = 326/506 (64.43%), Query Frame = 2
Query:  137 NEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYF-VWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDA---SEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC--RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYV---ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPV--HRNITSSFGQSEYLIYQESQCRIRY 1621
            + F S   AL   P+ ++          +   G  V +DY+C LNQTNI+ NNNK+Y+IQ++Q + ++F  W RWGRVGE G + K+  +   EDA K F+KKF++KTKN+W  RD+F S  GKYTL+E+  +DE + + V V        +++  P  L   TQ L+  IF  +MF + +A + LD KK+PLGKLSK QI +GFE LE L+  +    +    L ELSS FYT+IPH+FG  +P  I + + ++ K DMLLVL DIE  QAL    + E + ++     P+PLD  +++L   L +LD  + EYK+I+ Y+E T    R   + ++WKV++  EE  F+ H  + NRKLLWHGTN+AVVAAIL SGLRIMPHSGGRVG+GIYFASEN KSAGYV    C     G MFL EVALG+E  +  D+ S+  PP GF+SV+A+G TEPD   + E++LDG +VVVP G+PV      +S+F QSEYLIYQESQCR+RY
Sbjct:   34 DPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQS-KINHFTRLEDAKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV----PHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRY 534          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP2 (poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;Acc:HGNC:272])

HSP 1 Score: 244.973 bits (624), Expect = 1.261e-72
Identity = 183/516 (35.47%), Postives = 275/516 (53.29%), Query Frame = 2
Query:  146 DSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEM----GVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKT--KKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSRF---GVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            +S+K  L KG +      T     A ++  G   D YD MLNQTN+  NNNKYY+IQ+++ + +  + VW RWGRVG+ G    +        A + F KKF DKTKN+W++R+ F+ V GKY +L+M      +DE+ET +     S  S     S+L    Q L+ LI         + ++K +TKK PLGKL+  QI  G++ L+++++ I       A L+E  ++FYT IPHDFG R P  I T   + EK+ +L  L DIE    L+KT  + PE           +PLD+ ++ L   L  LDH+S E+K+I QY+++T         + ++++++V++  E++ FR  + + NR LLWHG+ ++    IL  GLRI P     +G   G+GIYFA  + KSA Y  C  SR    G++ L+EVALG+   L   +        G  S    GK  P S +   + L+G+   VPLG      I +  G +    EY++Y  +Q R+RY
Sbjct:   68 ESVKALLLKGKAPVDPECTAKVGKAHVYCEG--NDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKK---EESLKSPLKPESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRA-LMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPE-----------HPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFR--EDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANY--CFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHF--VTLNGS--TVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRY 558          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Match: PARP1 (poly(ADP-ribose) polymerase 1 [Source:HGNC Symbol;Acc:HGNC:270])

HSP 1 Score: 252.677 bits (644), Expect = 1.830e-72
Identity = 169/482 (35.06%), Postives = 265/482 (54.98%), Query Frame = 2
Query:  215 AATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYN--GKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQS-RFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNIT-SSFGQSEYLIYQESQCRIRY 1621
            A  L  GG V   +   L   +I    N YY +Q+++ +   +Y+++  WGRVG    + KL    +KEDA + F K +++KT N W ++ NF     K+  LE+    ++E  + L  N       + SKL K  Q L+ +IF  +    A+ + ++D +K+PLGKLSK QI   + +L E+Q  +S+ +  + ++L+LS++FYT+IPHDFG ++P  +   D+V+ K++ML  L DIE   +LL+    +SS         +P+D  ++ L  D+ ++D  SEE +II +YV+NT        ++++I+++K++R  E + ++  K + NR+LLWHG+     A IL  GLRI P     +G   G+GIYFA    KSA Y   +Q    G++ L EVALG    L H    I K P G  SV   GKT PD   N  I LDG  V VPLG  +   +  +S   +EY++Y  +Q  ++Y
Sbjct:  543 AHVLEKGGKV---FSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSK-NFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG-----TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDS-QILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSK--------DPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHAS-HISKLPKGKHSVKGLGKTTPDPSAN--ISLDG--VDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKY 1001          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-1 (Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4H4])

HSP 1 Score: 199.519 bits (506), Expect = 1.928e-54
Identity = 148/475 (31.16%), Postives = 239/475 (50.32%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIE-STQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRN----VKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDG-SIVKPPAGFESVVAQGKTEPD--SKYNKEIDLDGNKVVVPLGKPV-----HRNITSSFGQSEYLIYQESQCRIRY 1621
            Y   L+ T++  N N YY IQ+++ + +  Y+V+  WGRVG      K   Y+   +A  +F   F +KTKN W  R +F+ + G ++ +E    +  + ++  +T        S + L K  + +V  IF  +    AL   ++D  K+PLG+LS  QI   FEVL ++ + + K     +++L+ S+KFYTIIPH+FG R P  I +   ++EK +ML  L DI+ +   +     P S+S     L  +P+D  ++ L   ++ L    +++ +I QY++NT        V++I++ K++R +E   F+ H  I NR+LLWHG+     A IL  GLRI P     SG   G+G+YFA    KS  Y   N      + L +VALG  + L      S    PAGF+SV   G+  P     YN     DG    +PLG         +++      +E+++Y   Q +++Y
Sbjct:  477 YQATLSFTDLTQNKNSYYKIQLLKDDQRENYYVFRSWGRVGTEVGGNKHESYSNSNEAILKFQDVFHEKTKNDWIYRKHFRKMPGMFSYVETDYSEFAQITDTEITPG------SKTLLPKSVKEVVMSIFDVENMKSALKSFEMDVNKMPLGRLSHNQINLAFEVLNDISDLLVKLPIDASRILDFSNKFYTIIPHNFGMRVPEPIDSFHKIKEKNNMLNALLDIKFAYDQISGGDVPASTS-----LGIDPVDINYQKLKCIMEPLQQGCDDWNMIHQYLKNTHGATHDLKVELIDILKLNRDNESSKFKRH--IGNRRLLWHGSGKMNFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCRANAKEEAYLLLCDVALGNVQQLMASKNVSRQTLPAGFQSVQGLGRQCPREIGSYNHP---DG--YTIPLGLTYMQLQGKQDVDYHLLYNEFIVYDVDQIQLKY 933          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-1 (Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4H4])

HSP 1 Score: 161.77 bits (408), Expect = 2.224e-44
Identity = 113/346 (32.66%), Postives = 177/346 (51.16%), Query Frame = 2
Query:  635 IFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIE-STQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRN----VKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHD-DGSIVKPPAGFESVVAQGKTEPD--SKYNKEIDLDGNKVVVPLGKPVH-----RNITSSFGQSEYLIYQESQCRIRY 1621
            IF  +    AL   ++D  K+PLG+LS  QI   FEVL ++ + + K     +++L+ S+KFYTIIPH+FG R P  I +   ++EK +ML  L DI+ +   +     P S+S     L  +P+D  ++ L   ++ L    +++ +I QY++NT        V++I++ K++R +E   F+ H  I NR+LLWHG+     A IL  GLRI P     SG   G+G+YFA    KS  Y   N      + L +VALG  + L    + S    PAGF+SV   G+  P     YN     DG    +PLG         +++      +E+++Y   Q +++Y
Sbjct:    3 IFDVENMKSALKSFEMDVNKMPLGRLSHNQINLAFEVLNDISDLLVKLPIDASRILDFSNKFYTIIPHNFGMRVPEPIDSFHKIKEKNNMLNALLDIKFAYDQISGGDVPASTS-----LGIDPVDINYQKLKCIMEPLQQGCDDWNMIHQYLKNTHGATHDLKVELIDILKLNRDNESSKFKRH--IGNRRLLWHGSGKMNFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCRANAKEEAYLLLCDVALGNVQQLMASKNVSRQTLPAGFQSVQGLGRQCPREIGSYNHP---DG--YTIPLGLTYMQLQGKQDVDYHLLYNEFIVYDVDQIQLKY 336          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: parp-1 (Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4H4])

HSP 1 Score: 94.7449 bits (234), Expect = 1.590e-21
Identity = 78/257 (30.35%), Postives = 123/257 (47.86%), Query Frame = 2
Query:  902 MLLVLTDIE-STQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRN----VKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHD-DGSIVKPPAGFESVVAQGKTEPD--SKYNKEIDLDGNKVVVPLGKPVH-----RNITSSFGQSEYLIYQESQCRIRY 1621
            ML  L DI+ +   +     P S+S     L  +P+D  ++ L   ++ L    +++ +I QY++NT        V++I++ K++R +E   F+ H  I NR+LLWHG+     A IL  GLRI P     SG   G+G+YFA    KS  Y   N      + L +VALG  + L    + S    PAGF+SV   G+  P     YN     DG    +PLG         +++      +E+++Y   Q +++Y
Sbjct:    1 MLNALLDIKFAYDQISGGDVPASTS-----LGIDPVDINYQKLKCIMEPLQQGCDDWNMIHQYLKNTHGATHDLKVELIDILKLNRDNESSKFKRH--IGNRRLLWHGSGKMNFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCRANAKEEAYLLLCDVALGNVQQLMASKNVSRQTLPAGFQSVQGLGRQCPREIGSYNHP---DG--YTIPLGLTYMQLQGKQDVDYHLLYNEFIVYDVDQIQLKY 245          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: tank-1 (Poly [ADP-ribose] polymerase tankyrase [Source:UniProtKB/Swiss-Prot;Acc:Q9TXQ1])

HSP 1 Score: 83.9593 bits (206), Expect = 1.671e-16
Identity = 107/415 (25.78%), Postives = 183/415 (44.10%), Query Frame = 2
Query:  254 YDCMLNQTNI----DGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETS--EVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQ---NEISKNNEKTAKLL------------ELSSKFYTIIPHDFGRRRPLTITTLDTVRE---KMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHS----GGRVGRGIYFASENGKSAGYVACNQSRFGV--MFLNEVALGKEKPL 1402
            +D ++N+T++     G +N +Y +Q+I+      + ++T WGR+G      +  P+N+ E A K+F   F+ K+ N W    NF+ +  KY L+E    D   TS  E+ +T    +EK  P +     + + D+     +  +A           P G+ +K  I K   VL++L+   N I +  E    ++            ELS  +Y++IP   G      +T LD V E       L    +IE+   LL       +++ + DL  + +D     +  +  +    S+  + + Q++ N+  +  K+  + ++      + F       N+K LWHGT    + +ILK+G  I P S    G   G GIY A    KS  Y  C  S  G+  M + + ALGK + L
Sbjct: 1762 FDVLMNKTDLMYGRCGFHN-FYRMQIIKRRDAELFILFTNWGRIGSGMGEFQTTPFNSLELAAKEFKSIFKSKSGNEWAPLANFRDMPKKYRLVET---DSTPTSLAEIELTWKKNTEK-DPIR-----RMIADISDAKTLKTYASQVQMYGGSSQPFGRFTKENIEKAKLVLDKLEKNANRIKQMVEAQTGVVESNLLDAYITTSELSGDYYSLIPS--GEYEFSNLTRLDNVEEIARHRARLNRCQEIETATRLL------CAAEFRQDL--DRVDYIRSAIQCEYRLETPDSDISQRLLQWIHNSGGKQAKVKMILEISPMLSTEKFEPFVNDDNQKFLWHGTKATNLMSILKNGFLIDPPSACKNGNLFGSGIYLADSFEKSTHY--CQPSAGGINYMLVCQTALGKVRTL 2154          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Match: tank-1 (Poly [ADP-ribose] polymerase tankyrase [Source:UniProtKB/Swiss-Prot;Acc:Q9TXQ1])

HSP 1 Score: 83.9593 bits (206), Expect = 1.796e-16
Identity = 107/415 (25.78%), Postives = 183/415 (44.10%), Query Frame = 2
Query:  254 YDCMLNQTNI----DGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETS--EVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQ---NEISKNNEKTAKLL------------ELSSKFYTIIPHDFGRRRPLTITTLDTVRE---KMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHS----GGRVGRGIYFASENGKSAGYVACNQSRFGV--MFLNEVALGKEKPL 1402
            +D ++N+T++     G +N +Y +Q+I+      + ++T WGR+G      +  P+N+ E A K+F   F+ K+ N W    NF+ +  KY L+E    D   TS  E+ +T    +EK  P +     + + D+     +  +A           P G+ +K  I K   VL++L+   N I +  E    ++            ELS  +Y++IP   G      +T LD V E       L    +IE+   LL       +++ + DL  + +D     +  +  +    S+  + + Q++ N+  +  K+  + ++      + F       N+K LWHGT    + +ILK+G  I P S    G   G GIY A    KS  Y  C  S  G+  M + + ALGK + L
Sbjct: 1800 FDVLMNKTDLMYGRCGFHN-FYRMQIIKRRDAELFILFTNWGRIGSGMGEFQTTPFNSLELAAKEFKSIFKSKSGNEWAPLANFRDMPKKYRLVET---DSTPTSLAEIELTWKKNTEK-DPIR-----RMIADISDAKTLKTYASQVQMYGGSSQPFGRFTKENIEKAKLVLDKLEKNANRIKQMVEAQTGVVESNLLDAYITTSELSGDYYSLIPS--GEYEFSNLTRLDNVEEIARHRARLNRCQEIETATRLL------CAAEFRQDL--DRVDYIRSAIQCEYRLETPDSDISQRLLQWIHNSGGKQAKVKMILEISPMLSTEKFEPFVNDDNQKFLWHGTKATNLMSILKNGFLIDPPSACKNGNLFGSGIYLADSFEKSTHY--CQPSAGGINYMLVCQTALGKVRTL 2192          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Fly
Match: Parp (gene:FBgn0010247 transcript:FBtr0113885)

HSP 1 Score: 240.35 bits (612), Expect = 1.920e-68
Identity = 163/469 (34.75%), Postives = 248/469 (52.88%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT-----KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRI----MPHSGGRVGRGIYFASENGKSAGYVACN-QSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPV-HRNITSSFGQSEYLIYQESQCRIRY 1621
            Y  +L  T+I  N N YY +Q+++ + K  Y+++  WGR+G N    KL  ++T E A + F + + DKT N ++ RDNF    G+   +E+   D+ +    LV +      F  SKL    Q L+ LIF  D  N  L +  +D  K+PLGKLS  QI   + V++E+ N + +    TAKL++ +++FYT+IPH+FG + P  I T   + +   ML  L +IE   +++K++    +         NPLD  +  +   L  LD  SEE+ I+ QYV+NT     K  ++KI++V+KV R+ E + F+  K + NRKLLWHG+ +     IL  GLRI     P +G   G+GIYFA    KSA Y   + Q+  G+M L+EVALG           I K      S   +G+T PD      I  DG  V +P G+ +   ++ SS   +EY++Y  +Q  I+Y
Sbjct:  536 YSVVLGLTDIQRNKNSYYKVQLLKADKKEKYWIFRSWGRIGTNIGNSKLEEFDTSESAKRNFKEIYADKTGNEYEQRDNFVKRTGRMYPIEIQYDDDQK----LVKHE---SHFFTSKLEISVQNLIKLIFDIDSMNKTLMEFHIDMDKMPLGKLSAHQIQSAYRVVKEIYN-VLECGSNTAKLIDATNRFYTLIPHNFGVQLPTLIETHQQIEDLRQMLDSLAEIEVAYSIIKSEDVSDAC--------NPLDNHYAQIKTQLVALDKNSEEFSILSQYVKNTHASTHKSYDLKIVDVFKVSRQGEARRFKPFKKLHNRKLLWHGSRLTNFVGILSHGLRIAPPEAPPTGYMFGKGIYFADMVSKSANYCCTSQQNSTGLMLLSEVALGDMMEC-TSAKYINKLSNNKHSCFGRGRTMPDPT-KSYIRSDG--VEIPYGETITDEHLKSSLLYNEYIVYDVAQVNIQY 984          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-7435])

HSP 1 Score: 444.121 bits (1141), Expect = 4.114e-150
Identity = 259/504 (51.39%), Postives = 341/504 (67.66%), Query Frame = 2
Query:  137 NEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDAS-------EKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNI--TSSFGQSEYLIYQESQCRIRY 1621
            ++F S K AL    S  K T   D  +        V +DYDCMLNQTNI  NNNK+YVIQ++   GKY+ WTRWGRVGE+G     GP +  + A K F+KKF++KTKN+W +R+NF S  GKYTL+E+   D D+ +EV V + D         +   P  L  ETQ L+  IF  DMF  A+  + LD KK+PLGKLSK QI KGFE LEE++  I K+  + +K  EL++KF+TIIPH+FGR RP  I+    ++ K +MLLVL DIE  Q+L    + E + ++  D  P+P+D+ ++ L   L+++D KS+EYKIIE+Y++ T    + +++VW+VDR +E + FR + A+ NRKLLWHGTN+AVVAAILKSGLRIMPHSGGRVGRGIYFASEN KSAGYV  + ++ G+MFLNEVALGKE  +  DD S+ K PAG++SV+A+G  EPD   +  I+LDG KVVVP GK + +     S F  SEYLIY+ESQCRIRY
Sbjct:   30 DKFTSAKEALKATGSQVKGTRNPD--SVCHLSNAEVHEDYDCMLNQTNIGNNNNKFYVIQVLVSGGKYYCWTRWGRVGESGQNALAGP-SAADAAIKSFEKKFKEKTKNNWSDRENFVSHSGKYTLIEV---DGDQDAEVKVDSVDGGAVKVKREQNVLPCTLDAETQRLMRFIFDNDMFKEAMTSMDLDIKKMPLGKLSKQQIAKGFEALEEIEAAIKKS--ERSKFEELTNKFFTIIPHNFGRNRPPVISDDSVLQSKKEMLLVLADIEVAQSL--KAESEKAKEEMEDTVPHPVDQNYQSLKCSLNLVDKKSKEYKIIEKYLKATGQEGLTLVDVWEVDRETEAERFRENDALENRKLLWHGTNVAVVAAILKSGLRIMPHSGGRVGRGIYFASENSKSAGYVRPS-NKIGIMFLNEVALGKEYTITRDDPSLRKAPAGYDSVIARGNQEPDPSKDVFIELDGKKVVVPQGKAIKQQQYEGSHFYNSEYLIYKESQCRIRY 522          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 262.692 bits (670), Expect = 9.174e-79
Identity = 182/510 (35.69%), Postives = 276/510 (54.12%), Query Frame = 2
Query:  140 EFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYV-ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            E + +KT + KG +            A +++ G   D YD MLNQTN+  NNNKYY+IQ+++ +    Y VW RWGRVG+ G    +        A   F KKF DKTKN W++R +F+ V GKY ++ M    ED+  E  V  S   +K  P +L  + Q L++LI         + ++K DTKK PLGKL+  QI  G+  L+ ++ E  K      +LL+  ++FYT IPHDFG R P  I + + ++EK+ +L  L+DI+    +++       S  K+D   +PLD ++  L+  L  LD  S EYK+IE+Y+++T         + +++V+ V+R  E+ NF  +  + NR LLWHG+ ++    IL  GLR+ P     +G   G+GIYFA  + KSA Y  A  ++  G++ L+EVALG    L   D +  + P+G  S    G+T PD K  K + L+G  V VPLG  V   +    G S    EY++Y  +Q +++Y
Sbjct:  147 ECEVVKTLVMKGKAPVDPECKAKLGKAHVYNEG--ADVYDVMLNQTNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQAKDTFKKKFFDKTKNEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKK--PCQLNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIE-ECLKKKGSNKELLDACNQFYTRIPHDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQ-------SNVKSD--EHPLDRQYHSLNCQLQPLDTDSNEYKVIEKYLKSTHAPTHTDYTMTLLDVFAVEREVEKDNF--NSELQNRMLLWHGSRLSNWVGILSQGLRVAPAEAPVTGYMFGKGIYFADMSSKSANYCFASQKNNQGLLLLSEVALGDSNELLDADYNADQLPSGKHSTKGLGQTAPDPK--KSVSLNG--VTVPLGPSVKTGVGQKGGYSLLYNEYIVYNPAQIQMKY 636          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 262.692 bits (670), Expect = 9.375e-79
Identity = 182/510 (35.69%), Postives = 276/510 (54.12%), Query Frame = 2
Query:  140 EFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYV-ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            E + +KT + KG +            A +++ G   D YD MLNQTN+  NNNKYY+IQ+++ +    Y VW RWGRVG+ G    +        A   F KKF DKTKN W++R +F+ V GKY ++ M    ED+  E  V  S   +K  P +L  + Q L++LI         + ++K DTKK PLGKL+  QI  G+  L+ ++ E  K      +LL+  ++FYT IPHDFG R P  I + + ++EK+ +L  L+DI+    +++       S  K+D   +PLD ++  L+  L  LD  S EYK+IE+Y+++T         + +++V+ V+R  E+ NF  +  + NR LLWHG+ ++    IL  GLR+ P     +G   G+GIYFA  + KSA Y  A  ++  G++ L+EVALG    L   D +  + P+G  S    G+T PD K  K + L+G  V VPLG  V   +    G S    EY++Y  +Q +++Y
Sbjct:  148 ECEVVKTLVMKGKAPVDPECKAKLGKAHVYNEG--ADVYDVMLNQTNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQAKDTFKKKFFDKTKNEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKK--PCQLNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIE-ECLKKKGSNKELLDACNQFYTRIPHDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQ-------SNVKSD--EHPLDRQYHSLNCQLQPLDTDSNEYKVIEKYLKSTHAPTHTDYTMTLLDVFAVEREVEKDNF--NSELQNRMLLWHGSRLSNWVGILSQGLRVAPAEAPVTGYMFGKGIYFADMSSKSANYCFASQKNNQGLLLLSEVALGDSNELLDADYNADQLPSGKHSTKGLGQTAPDPK--KSVSLNG--VTVPLGPSVKTGVGQKGGYSLLYNEYIVYNPAQIQMKY 637          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp2 (poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZDB-GENE-031113-6])

HSP 1 Score: 247.669 bits (631), Expect = 3.489e-73
Identity = 176/515 (34.17%), Postives = 270/515 (52.43%), Query Frame = 2
Query:  140 EFDSIKTALTKG-----PSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYV-ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            E + +KT + KG     P  + K   +        H  ++          TN+  NNNKYY+IQ+++ +    Y VW RWGRVG+ G    +        A   F KKF DKTKN W++R +F+ V GKY ++ M    ED+  E  V  S   +K  P +L  + Q L++LI         + ++K DTKK PLGKL+  QI  G+  L+ ++ E  K      +LL+  ++FYT IPHDFG R P  I + + ++EK+ +L  L+DI+    +++       S  K+D   +PLD ++  L+  L  LD  S EYK+IE+Y+++T         + +++V+ V+R  E+ NF  +  + NR LLWHG+ ++    IL  GLR+ P     +G   G+GIYFA  + KSA Y  A  ++  G++ L+EVALG    L   D +  + P+G  S    G+T PD K  K + L+G  V VPLG  V   +    G S    EY++Y  +Q +++Y
Sbjct:  148 ECEVVKTLVMKGKAPVDPECKAKLGKVIALNVLFGHKVLIA---------TNLQFNNNKYYLIQLLEDDSAKAYSVWLRWGRVGKVGQNNLVSCGANLAQAKDTFKKKFFDKTKNEWEHRASFEKVAGKYDMVFMDYSTEDKGEEKAVVPSATQKK--PCQLNSKVQSLLELICDLKAMEECVLEMKFDTKKAPLGKLTAEQIRAGYASLKRIE-ECLKKKGSNKELLDACNQFYTRIPHDFGLRTPPIIRSEEELKEKITLLETLSDIQIAVKMVQ-------SNVKSD--EHPLDRQYHSLNCQLQPLDTDSNEYKVIEKYLKSTHAPTHTDYTMTLLDVFAVEREVEKDNF--NSELQNRMLLWHGSRLSNWVGILSQGLRVAPAEAPVTGYMFGKGIYFADMSSKSANYCFASQKNNQGLLLLSEVALGDSNELLDADYNADQLPSGKHSTKGLGQTAPDPK--KSVSLNG--VTVPLGPSVKTGVGQKGGYSLLYNEYIVYNPAQIQMKY 635          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Match: parp1 (poly (ADP-ribose) polymerase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3955])

HSP 1 Score: 231.106 bits (588), Expect = 4.825e-65
Identity = 154/469 (32.84%), Postives = 254/469 (54.16%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQ--YNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSR-FGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNI-TSSFGQSEYLIYQESQCRIRY 1621
            Y   L   +I    N YY +Q+++     +Y+V+  WGRVG      KL  +  K  A   F   +++KT N W +  NF     K+  LE+    ++E  + L  ++ A      S+L K  Q L+ +IF  +    A+ + ++D +K+PLGKLSK QI   + +L E+Q  ++ ++ ++  +L+LS++FYT+IPHDFG ++P  ++ +D +++K+ ML  L DIE   +LL+    E++ K       +P+D  ++ L   ++++D  S E ++I QYV+NT         + +  ++K++R  E + +R  K + NR+LLWHG+     A IL  GLRI P     +G   G+G+YFA    KSA Y   +Q+   G++ L EVALG    L      I K P G  SV   G++ PD +    + L+G  V +PLGK ++ NI  +S   +EY++Y  SQ  ++Y
Sbjct:  550 YSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIGGNKLDKFYDKNSAMDNFCGVYEEKTGNAWAS-SNFTKYPNKFYPLEIDYGQDEEAVKKLTQSAGAK-----SQLEKPVQDLIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQQAVADSSSESL-ILDLSNRFYTLIPHDFGMKKPPLLSNVDYIQQKVQMLDNLLDIEVAYSLLRG-GVENNEK-------DPIDINYEKLKTKIEVVDKSSHEAQLILQYVKNTHAATHNTYTLDVEEIFKIEREGEYQRYRPFKELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEVALGNMHEL-KKASHITKLPKGKHSVKGLGRSAPDPRAT--VSLNG--VDIPLGKGMNTNIDDTSLLYNEYIVYDVSQVNLKY 998          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:100145803])

HSP 1 Score: 491.5 bits (1264), Expect = 2.226e-168
Identity = 268/503 (53.28%), Postives = 337/503 (67.00%), Query Frame = 2
Query:  137 NEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGI-VVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLV---TNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT--KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPV--HRNITSSFGQSEYLIYQESQCRIRY 1621
            + F S   AL K  S +K    ID       +G   V +DYDCMLNQTNI  NNNK+YVIQ+I    +Y+ W RWGRVGE G + KL P+   E+A K F+KKF+DKTKN W  R+NF    GKYT++E+   D++ + E  V   T     +K  P  L K TQ L+ LIF TDMF  A+  + LD KK+PLGKLSK QI KGFE L+ELQ  + +   K   L +LSS+FYTIIPH+FGRR P  I T + ++ K DMLLVL DIE  Q L   K  +   ++K    P+PLD  +++L  DL +LD  +EEYK+I+ YVENT    R +KI NVW V+R +EE+ F  HK I NR+LLWHGTNIAVV AILKSGLRIMPHSGGRVG+GIYFASEN KSAGYV C     G+MFLNEVALG+E  +  DD S+  PP G++SVVA+G TEP+   ++++DLDG K+ VP G+PV   +   SSFGQSEYL+Y+ESQ R+RY
Sbjct:   39 DRFQSAVQAL-KAASGKKGKAKIDSSCHLSSYGDYEVYEDYDCMLNQTNIGSNNNKFYVIQLITKKNEYYCWNRWGRVGEVGQS-KLSPFPKLENAQKDFEKKFKDKTKNSWSERENFTPHPGKYTIIEVEHDDDNGSGEATVKADTVDGTVQKVRPCSLDKPTQDLISLIFSTDMFKEAMQTMNLDIKKMPLGKLSKAQIAKGFEALDELQAALDRKANKGV-LSDLSSRFYTIIPHNFGRRTPPVIDTSEVLQAKKDMLLVLADIELAQTLQADKVKKEEEEEKVQEVPHPLDVDYELLKCDLSLLDTSTEEYKVIKTYVENTGPTYRTLKIQNVWCVNRETEEERFSAHKDIENRRLLWHGTNIAVVVAILKSGLRIMPHSGGRVGKGIYFASENSKSAGYVGCTSKNLGIMFLNEVALGREHHIKMDDCSLQSPPKGYDSVVARGLTEPEPAKDRKLDLDGRKITVPQGRPVKMEKYSDSSFGQSEYLVYKESQARMRY 538          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: ENSXETT00000011320.1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:100490557])

HSP 1 Score: 251.906 bits (642), Expect = 3.034e-72
Identity = 165/471 (35.03%), Postives = 262/471 (55.63%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQY--NGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQ---SRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNIT-SSFGQSEYLIYQESQCRIRY 1621
            +   L   +I    N YY +Q+I++  N +Y+V+  WGRVG    + KL   ++KEDA   F   +Q+KT N W +  NF     K+  LE+    E++  + L   +      + SKLA+  Q L+ LIF  +    A+ + ++D +K+PLGKLSK QI   + +L ++Q  +S+++ + A+LL+LS++FYT+IPHDFG ++P  +  L+ ++ K+ ML  L DIE   +LL+            D + +P+D +++ +  D+ ++D +SEE +II  YV+NT        +++++ ++K++R  E + ++  K + NR+LLWHG+     A IL  GLRI P     +G   G+GIYFA    KSA Y  CN    +  G++ L EVALG    L      I K P G  SV   G+T PD   +  + LDG  V VPLGK    NIT +S   +EY++Y  +Q  ++Y
Sbjct:  536 FSATLGLVDITRGTNSYYKLQLIEHDRNSRYWVFRSWGRVGTVIGSNKLEEMSSKEDAIDHFLNLYQEKTGNAW-HSPNFTKYPNKFYPLEIDYGQEEDVVKKLSVGAG-----TKSKLAQPVQELIKLIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSILNQVQQAVSESSSE-ARLLDLSNQFYTLIPHDFGMKKPPLLNNLEYIQAKVQMLDNLLDIEVAYSLLRGGAD--------DGEKDPIDVKYEKIKTDIKVVDKESEESRIIRDYVKNTHAETHNAYDLEVLEIFKIEREGEYQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANY--CNAMPGNPIGLILLGEVALGNMHEL-RAASHITKLPKGKHSVKGLGRTAPDP--SATVKLDG--VDVPLGKGSATNITDASLLYNEYIVYDVAQVNLKY 984          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: ENSXETT00000011326.1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:100490557])

HSP 1 Score: 251.906 bits (642), Expect = 3.226e-72
Identity = 165/471 (35.03%), Postives = 262/471 (55.63%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQY--NGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQ---SRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNIT-SSFGQSEYLIYQESQCRIRY 1621
            +   L   +I    N YY +Q+I++  N +Y+V+  WGRVG    + KL   ++KEDA   F   +Q+KT N W +  NF     K+  LE+    E++  + L   +      + SKLA+  Q L+ LIF  +    A+ + ++D +K+PLGKLSK QI   + +L ++Q  +S+++ + A+LL+LS++FYT+IPHDFG ++P  +  L+ ++ K+ ML  L DIE   +LL+            D + +P+D +++ +  D+ ++D +SEE +II  YV+NT        +++++ ++K++R  E + ++  K + NR+LLWHG+     A IL  GLRI P     +G   G+GIYFA    KSA Y  CN    +  G++ L EVALG    L      I K P G  SV   G+T PD   +  + LDG  V VPLGK    NIT +S   +EY++Y  +Q  ++Y
Sbjct:  550 FSATLGLVDITRGTNSYYKLQLIEHDRNSRYWVFRSWGRVGTVIGSNKLEEMSSKEDAIDHFLNLYQEKTGNAW-HSPNFTKYPNKFYPLEIDYGQEEDVVKKLSVGAG-----TKSKLAQPVQELIKLIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSILNQVQQAVSESSSE-ARLLDLSNQFYTLIPHDFGMKKPPLLNNLEYIQAKVQMLDNLLDIEVAYSLLRG--------GADDGEKDPIDVKYEKIKTDIKVVDKESEESRIIRDYVKNTHAETHNAYDLEVLEIFKIEREGEYQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANY--CNAMPGNPIGLILLGEVALGNMHEL-RAASHITKLPKGKHSVKGLGRTAPDP--SATVKLDG--VDVPLGKGSATNITDASLLYNEYIVYDVAQVNLKY 998          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: ENSXETT00000011323.1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:100490557])

HSP 1 Score: 251.136 bits (640), Expect = 5.416e-72
Identity = 165/471 (35.03%), Postives = 262/471 (55.63%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQY--NGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQ---SRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNIT-SSFGQSEYLIYQESQCRIRY 1621
            +   L   +I    N YY +Q+I++  N +Y+V+  WGRVG    + KL   ++KEDA   F   +Q+KT N W +  NF     K+  LE+    E++  + L   +      + SKLA+  Q L+ LIF  +    A+ + ++D +K+PLGKLSK QI   + +L ++Q  +S+++ + A+LL+LS++FYT+IPHDFG ++P  +  L+ ++ K+ ML  L DIE   +LL+            D + +P+D +++ +  D+ ++D +SEE +II  YV+NT        +++++ ++K++R  E + ++  K + NR+LLWHG+     A IL  GLRI P     +G   G+GIYFA    KSA Y  CN    +  G++ L EVALG    L      I K P G  SV   G+T PD   +  + LDG  V VPLGK    NIT +S   +EY++Y  +Q  ++Y
Sbjct:  547 FSATLGLVDITRGTNSYYKLQLIEHDRNSRYWVFRSWGRVGTVIGSNKLEEMSSKEDAIDHFLNLYQEKTGNAW-HSPNFTKYPNKFYPLEIDYGQEEDVVKKLSVGAG-----TKSKLAQPVQELIKLIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSILNQVQQAVSESSSE-ARLLDLSNQFYTLIPHDFGMKKPPLLNNLEYIQAKVQMLDNLLDIEVAYSLLRG--------GADDGEKDPIDVKYEKIKTDIKVVDKESEESRIIRDYVKNTHAETHNAYDLEVLEIFKIEREGEYQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANY--CNAMPGNPIGLILLGEVALGNMHEL-RAASHITKLPKGKHSVKGLGRTAPDP--SATVKLDG--VDVPLGKGSATNITDASLLYNEYIVYDVAQVNLKY 995          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Match: ENSXETT00000004148.1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:100490557])

HSP 1 Score: 247.284 bits (630), Expect = 1.226e-70
Identity = 162/471 (34.39%), Postives = 257/471 (54.56%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQY--NGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQ---SRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNIT-SSFGQSEYLIYQESQCRIRY 1621
            +   L   +I    N YY +Q+I++  N +Y+V+  WGRVG    + KL   ++KED           KT N W +  NF     K+  LE+    E++  + L   +      + SKLA+  Q L+ LIF  +    A+ + ++D +K+PLGKLSK QI   + +L ++Q  +S+++ + A+LL+LS++FYT+IPHDFG ++P  +  L+ ++ K+ ML  L DIE   +LL+            D + +P+D +++ +  D+ ++D +SEE +II  YV+NT        +++++ ++K++R  E + ++  K + NR+LLWHG+     A IL  GLRI P     +G   G+GIYFA    KSA Y  CN    +  G++ L EVALG    L      I K P G  SV   G+T PD   +  + LDG  V VPLGK    NIT +S   +EY++Y  +Q  ++Y
Sbjct:  549 FSATLGLVDITRGTNSYYKLQLIEHDRNSRYWVFRSWGRVGTVIGSNKLEEMSSKED-----------KTGNAW-HSPNFTKYPNKFYPLEIDYGQEEDVVKKLSVGAG-----TKSKLAQPVQELIKLIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSILNQVQQAVSESSSE-ARLLDLSNQFYTLIPHDFGMKKPPLLNNLEYIQAKVQMLDNLLDIEVAYSLLRGGAD--------DGEKDPIDVKYEKIKTDIKVVDKESEESRIIRDYVKNTHAETHNAYDLEVLEIFKIEREGEYQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANY--CNAMPGNPIGLILLGEVALGNMHEL-RAASHITKLPKGKHSVKGLGRTAPDP--SATVKLDG--VDVPLGKGSATNITDASLLYNEYIVYDVAQVNLKY 986          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 373.629 bits (958), Expect = 1.148e-122
Identity = 243/529 (45.94%), Postives = 327/529 (61.81%), Query Frame = 2
Query:   74 MPPKRXXXXXXXXXXXXXXXXNEFDSIKT---ALTKGPSFRKKTHTIDKFAATLFHGGIVV-DDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT----KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVA---CNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLD--GNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            M PKRKAS + + +  +++   E DS ++   AL   P+   +   +D       + GI V +DYDC LNQTNI  NNNK+Y+IQ+++   ++F W RWGRVGE G + K+  +   EDA K F KKF +KTKN W+ RD F +   KYTL+E+  + E + + V V +        P  L   TQ L+  IF  +MF +A+  + LD KK+PLGKL+K QI +GFE LE L+  +         L ELSS FYT+IPH+FGR RP  I + D ++ K DMLLVL DIE  Q L   +      ++K +  P+PLD  +++L   L +LD    EYK I+ Y++ T    +C +++  +VWKV+R  E   F+ H  + NR+LLWHGTN+AVVAAIL SGLRIMPHSGGRVG+GIYFASEN KSAGYV    C   + G MFL EVALGKE  +  DD S+  PP+GF+SV+A+G+TEPD   + E++LD     V            +SSF QSEYLIY+ESQCR+RY
Sbjct:    1 MAPKRKASVQTEGSKKRRQGTEEEDSFRSTAEALRAAPA-DNRVIRVDPSCPFSRNPGIQVHEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEVGQS-KMNHFTCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVVKVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTL---QAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQTGNSYRCPDLR--HVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQCRLRY 522          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 373.629 bits (958), Expect = 1.148e-122
Identity = 243/529 (45.94%), Postives = 327/529 (61.81%), Query Frame = 2
Query:   74 MPPKRXXXXXXXXXXXXXXXXNEFDSIKT---ALTKGPSFRKKTHTIDKFAATLFHGGIVV-DDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT----KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVA---CNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLD--GNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            M PKRKAS + + +  +++   E DS ++   AL   P+   +   +D       + GI V +DYDC LNQTNI  NNNK+Y+IQ+++   ++F W RWGRVGE G + K+  +   EDA K F KKF +KTKN W+ RD F +   KYTL+E+  + E + + V V +        P  L   TQ L+  IF  +MF +A+  + LD KK+PLGKL+K QI +GFE LE L+  +         L ELSS FYT+IPH+FGR RP  I + D ++ K DMLLVL DIE  Q L   +      ++K +  P+PLD  +++L   L +LD    EYK I+ Y++ T    +C +++  +VWKV+R  E   F+ H  + NR+LLWHGTN+AVVAAIL SGLRIMPHSGGRVG+GIYFASEN KSAGYV    C   + G MFL EVALGKE  +  DD S+  PP+GF+SV+A+G+TEPD   + E++LD     V            +SSF QSEYLIY+ESQCR+RY
Sbjct:    1 MAPKRKASVQTEGSKKRRQGTEEEDSFRSTAEALRAAPA-DNRVIRVDPSCPFSRNPGIQVHEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEVGQS-KMNHFTCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIEVQGEAESQEAVVKVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTL---QAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQTGNSYRCPDLR--HVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQCRLRY 522          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp3 (poly (ADP-ribose) polymerase family, member 3 [Source:MGI Symbol;Acc:MGI:1891258])

HSP 1 Score: 369.777 bits (948), Expect = 4.098e-121
Identity = 245/536 (45.71%), Postives = 328/536 (61.19%), Query Frame = 2
Query:   74 MPPKRXXXXXXXXXXXXXXXXNEFDSIKT---ALTKGPSFRKKTHTIDKFAATLFHGGIVV-DDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVT-------NSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT----KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVA---CNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLD--GNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            M PKRKAS + + +  +++   E DS ++   AL   P+   +   +D       + GI V +DYDC LNQTNI  NNNK+Y+IQ+++   ++F W RWGRVGE G + K+  +   EDA K F KKF +KTKN W+ RD F +   KYTL+E  V+ E E+ E +V        +        P  L   TQ L+  IF  +MF +A+  + LD KK+PLGKL+K QI +GFE LE L+  +         L ELSS FYT+IPH+FGR RP  I + D ++ K DMLLVL DIE  Q L   +      ++K +  P+PLD  +++L   L +LD    EYK I+ Y++ T    +C +++  +VWKV+R  E   F+ H  + NR+LLWHGTN+AVVAAIL SGLRIMPHSGGRVG+GIYFASEN KSAGYV    C   + G MFL EVALGKE  +  DD S+  PP+GF+SV+A+G+TEPD   + E++LD     V            +SSF QSEYLIY+ESQCR+RY
Sbjct:    1 MAPKRKASVQTEGSKKRRQGTEEEDSFRSTAEALRAAPA-DNRVIRVDPSCPFSRNPGIQVHEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEVGQS-KMNHFTCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIE--VQGEAESQEAVVKALSPQVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTL---QAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQTGNSYRCPDLR--HVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQCRLRY 527          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp2 (poly (ADP-ribose) polymerase family, member 2 [Source:MGI Symbol;Acc:MGI:1341112])

HSP 1 Score: 248.44 bits (633), Expect = 2.639e-74
Identity = 184/518 (35.52%), Postives = 275/518 (53.09%), Query Frame = 2
Query:  146 DSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVV---DDYDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEM----GVKDEDETSEVLVTNSDASEKFSP-SKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT-----KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSRF---GVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            DS+KT L KG     K     + AA L    +     D YD MLNQTN+  NNNKYY+IQ+++ + +  + VW RWGRVG+ G    +        A + F KKF DKTKN+W++R+NF+ V GKY +L+M      +DE +T E         E   P S+L    Q L+ LI         + ++K DTK+ PLGKL+  QI  G++ L+++++ I       A L+E  ++FYT IPHDFG   P  I T   + +K+ +L  L DIE    L+K      S +Q  +   +PLD+ ++ L   L  LDH+S E+K+I QY+++T     K   + +++V++V++  E++ FR  + + NR LLWHG+ ++    IL  GLR+ P     +G   G+GIYFA  + KSA Y  C  SR    G++ L+EVALG+   L   +        G  S    GK  P   +   I L+G+   VPLG      I +  G +    E+++Y  +Q R+RY
Sbjct:   61 DSVKTLLLKG-----KAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGKYDMLQMDYAASTQDESKTKE--------EETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKRAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRA-LVEACNEFYTRIPHDFGLSIPPVIRTEKELSDKVKLLEALGDIEIALKLVK------SERQGLE---HPLDQHYRNLHCALRPLDHESNEFKVISQYLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFR--EDLPNRMLLWHGSRLSNWVGILSHGLRVAPPEAPITGYMFGKGIYFADMSSKSANY--CFASRLKNTGLLLLSEVALGQCNELLEANPKAQGLLRGKHSTKGMGKMAPSPAHF--ITLNGS--TVPLGPASDTGILNPEGYTLNYNEFIVYSPNQVRMRY 547          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Match: Parp1 (poly (ADP-ribose) polymerase family, member 1 [Source:MGI Symbol;Acc:MGI:1340806])

HSP 1 Score: 246.128 bits (627), Expect = 3.030e-70
Identity = 164/486 (33.74%), Postives = 266/486 (54.73%), Query Frame = 2
Query:  203 IDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYN--GKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQS-RFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNIT-SSFGQSEYLIYQESQCRIRY 1621
            ++  A  L  GG V   +   L   +I    N YY +Q+++ +   +Y+++  WGRVG    + KL    +KEDA + F K +++KT N W ++ NF     K+  LE+    ++E  + L          + SKL K  Q LV +IF  +    AL + ++D +K+PLGKLS+ QI   + +L E+Q  +S+ + ++ ++L+LS++FYT+IPHDFG ++P  +   D+V+ K++ML  L DIE   +LL+    +SS         +P+D  ++ L  D+ ++D  SEE ++I +YV+NT        ++++I+++K++R  E + ++  + + NR+LLWHG+     A IL  GLRI P     +G   G+GIYFA    KSA Y   +Q    G++ L EVALG    L H    I K P G  SV   GKT PD   +  I L+G  V VPLG  +   +  +    +EY++Y  +Q  ++Y
Sbjct:  539 LEHSAHVLEKGGKV---FSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNKLEQMPSKEDAVEHFMKLYEEKTGNAWHSK-NFTKYPKKFYPLEIDYGQDEEAVKKLTVKPG-----TKSKLPKPVQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQAVSQGSSES-QILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSK--------DPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHAS-HISKLPKGKHSVKGLGKTTPDP--SASITLEG--VEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKY 1001          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q9Y6F1|PARP3_HUMAN (Protein mono-ADP-ribosyltransferase PARP3 OS=Homo sapiens OX=9606 GN=PARP3 PE=1 SV=4)

HSP 1 Score: 400.979 bits (1029), Expect = 2.352e-132
Identity = 241/506 (47.63%), Postives = 326/506 (64.43%), Query Frame = 2
Query:  137 NEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYF-VWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDA---SEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC--RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYV---ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPV--HRNITSSFGQSEYLIYQESQCRIRY 1621
            + F S   AL   P+ ++          +   G  V +DY+C LNQTNI+ NNNK+Y+IQ++Q + ++F  W RWGRVGE G + K+  +   EDA K F+KKF++KTKN+W  RD+F S  GKYTL+E+  +DE + + V V        +++  P  L   TQ L+  IF  +MF + +A + LD KK+PLGKLSK QI +GFE LE L+  +    +    L ELSS FYT+IPH+FG  +P  I + + ++ K DMLLVL DIE  QAL    + E + ++     P+PLD  +++L   L +LD  + EYK+I+ Y+E T    R   + ++WKV++  EE  F+ H  + NRKLLWHGTN+AVVAAIL SGLRIMPHSGGRVG+GIYFASEN KSAGYV    C     G MFL EVALG+E  +  D+ S+  PP GF+SV+A+G TEPD   + E++LDG +VVVP G+PV      +S+F QSEYLIYQESQCR+RY
Sbjct:   27 DPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGTQVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQS-KINHFTRLEDAKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRVQPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV----PHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRY 527          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q3ULW8|PARP3_MOUSE (Protein mono-ADP-ribosyltransferase PARP3 OS=Mus musculus OX=10090 GN=Parp3 PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 2.867e-120
Identity = 245/536 (45.71%), Postives = 328/536 (61.19%), Query Frame = 2
Query:   74 MPPKRXXXXXXXXXXXXXXXXNEFDSIKT---ALTKGPSFRKKTHTIDKFAATLFHGGIVV-DDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVT-------NSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT----KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVA---CNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLD--GNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            M PKRKAS + + +  +++   E DS ++   AL   P+   +   +D       + GI V +DYDC LNQTNI  NNNK+Y+IQ+++   ++F W RWGRVGE G + K+  +   EDA K F KKF +KTKN W+ RD F +   KYTL+E  V+ E E+ E +V        +        P  L   TQ L+  IF  +MF +A+  + LD KK+PLGKL+K QI +GFE LE L+  +         L ELSS FYT+IPH+FGR RP  I + D ++ K DMLLVL DIE  Q L   +      ++K +  P+PLD  +++L   L +LD    EYK I+ Y++ T    +C +++  +VWKV+R  E   F+ H  + NR+LLWHGTN+AVVAAIL SGLRIMPHSGGRVG+GIYFASEN KSAGYV    C   + G MFL EVALGKE  +  DD S+  PP+GF+SV+A+G+TEPD   + E++LD     V            +SSF QSEYLIY+ESQCR+RY
Sbjct:    1 MAPKRKASVQTEGSKKRRQGTEEEDSFRSTAEALRAAPA-DNRVIRVDPSCPFSRNPGIQVHEDYDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEVGQS-KMNHFTCLEDAKKDFKKKFWEKTKNKWEERDRFVAQPNKYTLIE--VQGEAESQEAVVKALSPQVYSGPVRTVVKPCSLDPATQNLITNIFSKEMFKNAMTLMNLDVKKMPLGKLTKQQIARGFEALEALEEAMKNPTGDGQSLEELSSCFYTVIPHNFGRSRPPPINSPDVLQAKKDMLLVLADIELAQTL---QAAPGEEEEKVEEVPHPLDRDYQLLRCQLQLLDSGESEYKAIQTYLKQTGNSYRCPDLR--HVWKVNREGEGDRFQAHSKLGNRRLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVALGKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFKSSSFSQSEYLIYKESQCRLRY 527          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q5Z8Q9|PRP2A_ORYSJ (Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa subsp. japonica OX=39947 GN=PARP2-A PE=3 SV=2)

HSP 1 Score: 271.552 bits (693), Expect = 4.137e-81
Identity = 175/471 (37.15%), Postives = 257/471 (54.56%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYN--GKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFG--RRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYV-ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKP-VHRNITSSFGQSEYLIYQESQCRIRY 1621
            YD  +NQTN+  NNNK+Y+IQ ++ +  G + V+ RWGRVG  G     GP++++E A  +F+ KF  KT NHW +R +F+    KYT LEM   + D  +   V+ S  +++   +KL       + LI    M    + ++  ++ KLPLGKLSK  I KG++VL+ + N IS+ + +  +L +L+ +FYT+IPHDFG  + R   I T   ++ K++M+  L +IE     + TK  E  S  + D    PL  R+K L  D   L+  SEEY +I+ Y+ NT  +      V ++ ++KV R  E + F+      NR LLWHG+ +   A IL  GLRI P     +G   G+G+YFA    KSA Y  A    R GV+ L EVALG+   L + D      P G  S    G+TEP++  +K  D DG  VVVPLGKP    +   S   +E+++Y   Q R+RY
Sbjct:  195 YDATMNQTNVGDNNNKFYIIQALESDAGGSFMVYNRWGRVGARGQDKLHGPFSSREQAIYEFEGKFHGKTNNHWSDRKSFECYARKYTWLEMDYGEADRETNKKVSPS--TDQIKETKLETRIASFISLICNISMMKQQMVEIGYNSDKLPLGKLSKSTIFKGYDVLKRISNVISRADRR--QLEQLTGEFYTVIPHDFGFKKMREFIIDTPQKLKAKLEMVEALGEIE-----IATKLLEDDSTDQDD----PLYARYKQLSCDFTPLEVGSEEYSMIKTYLANTHGKTHTSYTVDVVQIFKVSRHGEMERFQKFATAGNRMLLWHGSRLTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYASEACRSGVLLLCEVALGEMNELLNADYDANNLPKGKLSTKGVGQTEPNTAESKITD-DG--VVVPLGKPKAEPSKRGSLLYNEFIVYNVDQIRMRY 649          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|O50017|PARP2_MAIZE (Poly [ADP-ribose] polymerase 2 OS=Zea mays OX=4577 GN=PARP2 PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 6.198e-77
Identity = 176/471 (37.37%), Postives = 252/471 (53.50%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYN--GKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRR--RPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYV-ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHR-NITSSFGQSEYLIYQESQCRIRY 1621
            YD  LNQTN+  NNNK+Y+IQ+++ +  G + V+ RWGRVG  G     GP  T++ A  +F+ KF +KT NHW +R NFK    KYT LEM   D  ET E  +     +++   +KL       + LI    M    + ++  + +KLPLGKL K  I+KG+ VL+ + + ISK + +   L +L+ +FYT+IPHDFG R  R   I T   ++ K++M+  L +IE    LL+    + SS Q      +PL  R+K L  D   L+  S+EY +I+ Y+ NT  +      V I+ ++KV R  E + F+   +  NR LLWHG+ ++  A IL  GLRI P     +G   G+G+YFA    KSA Y  A    R GV+ L EVALG    L + D      P G       G+T P+   +K  D DG  VVVPLG+P    +       +EY++Y   Q R+RY
Sbjct:  190 YDATLNQTNVGDNNNKFYIIQVLESDAGGSFMVYNRWGRVGVRGQDKLHGPSPTRDQAIYEFEGKFHNKTNNHWSDRKNFKCYAKKYTWLEM---DYGET-EKEIEKGSITDQIKETKLETRIAQFISLICNISMMKQRMVEIGYNAEKLPLGKLRKATILKGYHVLKRISDVISKADRR--HLEQLTGEFYTVIPHDFGFRKMREFIIDTPQKLKAKLEMVEALGEIEIATKLLE----DDSSDQD-----DPLYARYKQLHCDFTPLEADSDEYSMIKSYLRNTHGKTHSGYTVDIVQIFKVSRHGETERFQKFASTRNRMLLWHGSRLSNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYASEACRSGVLLLCEVALGDMNELLNADYDANNLPKGKLRSKGVGQTAPNMVESKVAD-DG--VVVPLGEPKQEPSKRGGLLYNEYIVYNVDQIRMRY 642          
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Match: sp|Q11207|PARP2_ARATH (Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana OX=3702 GN=PARP2 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.335e-74
Identity = 171/475 (36.00%), Postives = 253/475 (53.26%), Query Frame = 2
Query:  248 DDYDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVL--VTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRR--PLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQ-SRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSS-FGQSEYLIYQESQCRIRY 1621
            D YD +LNQTN+  NNNK++V+Q+++ + K  Y V+TRWGRVG  G +   GPY++ + A + F  KF DKTKN+W +R  F      YT LEM    E+  S V   + +S +  K   SKL       + LI    M    + ++  +  KLPLGK+SK  I KG+EVL+ +   I + +    +L ELS +FYT+IPHDFG ++     I T   +++K++M+  L +IE    LL              L+ +PL   ++ L+  L  + + SEE+ ++  Y+ENT  +      V+I  +++  R  E   F+   +  NR LLWHG+ +   A IL  GLRI P     +G   G+G+YFA    KSA Y   N  +  GV+ L EVALG    L + D +    P G  S    GKT P+    + ++ DG  VVVPLGKPV R+ +      +EY++Y   Q ++RY
Sbjct:  167 DVYDAILNQTNVRDNNNKFFVLQVLESDSKKTYMVYTRWGRVGVKGQSKLDGPYDSWDRAIEIFTNKFNDKTKNYWSDRKEFIPHPKSYTWLEMDYGKEENDSPVNNDIPSSSSEVKPEQSKLDTRVAKFISLICNVSMMAQHMMEIGYNANKLPLGKISKSTISKGYEVLKRISEVIDRYDR--TRLEELSGEFYTVIPHDFGFKKMSQFVIDTPQKLKQKIEMVEALGEIELATKLLSV---------DPGLQDDPLYYHYQQLNCGLTPVGNDSEEFSMVANYMENTHAKTHSGYTVEIAQLFRASRAVEADRFQQFSSSKNRMLLWHGSRLTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYANTGANDGVLLLCEVALGDMNELLYSDYNADNLPPGKLSTKGVGKTAPNPSEAQTLE-DG--VVVPLGKPVERSCSKGMLLYNEYIVYNVEQIKMRY 627          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: C3Z2P3 (Poly [ADP-ribose] polymerase (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_203655 PE=4 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 1.599e-170
Identity = 271/494 (54.86%), Postives = 343/494 (69.43%), Query Frame = 2
Query:  164 LTKGPSFRKKTHTIDKFAATLFHGGI-VVDDYDCMLNQTNIDGNNNKYYVIQMIQYNG--KYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTK---CRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHR--NITSSFGQSEYLIYQESQCRIRY 1621
            L K  S  KK + +D +    FH    V DDYDCMLNQTNI  NNNKYYVIQ+++  G  +YFVW RWGRVGE G     GP++  E A K F+KKF+DKTKN W  R +F  V GKYTLLEM   + +E  +        + K  PS L   TQ L+ LIF  DMF   +A++++D +K+PLGKLSK QI KGFEVL+E++ E+  +  +T++L ELSS+FYT+IPHDFGR+ P  I   + +R+KMDMLLVL DIE  QA+ K K  +  S +  D+K +PLD  + +L+  L+++   SEE+K+IE+Y E TK    R+ KI+NVWKVDR  E   F+ H  + NRKLLWHGTN+AVVAAILK+GLRIMPHSGGRVGRGIYFASEN KSAGYV C     G+MFLNEVALGKE  +  DD S+ KPPAGF+SVVA G+ EPD K N  + LDG  VVVP G+P+++    +SSF QSEYL+Y+E+QCRIRY
Sbjct:   22 LKKSASPTKKVYKVDSYCP--FHNCAEVQDDYDCMLNQTNIGHNNNKYYVIQLLRTIGISRYFVWNRWGRVGEPGQNAMKGPWDL-ETAKKDFEKKFKDKTKNDWSKRGSFVPVPGKYTLLEMDTDETEEDEQDTAEKVRRTRKVLPSSLNSPTQSLIKLIFDNDMFKEQMAKMEIDVRKMPLGKLSKSQIAKGFEVLDEIEEELKMS--RTSRLTELSSRFYTVIPHDFGRKVPPVINDQEKLRKKMDMLLVLGDIEIAQAMQKDKDKDDGS-EAMDIK-HPLDLNYDLLNCGLELVKPSSEEFKVIEKYTEATKYSGWRDPKILNVWKVDRGGEGDRFQEHDHLENRKLLWHGTNVAVVAAILKTGLRIMPHSGGRVGRGIYFASENSKSAGYVGCASGNVGIMFLNEVALGKENRITRDDSSLTKPPAGFDSVVAVGRKEPDPKKNTTMKLDGRTVVVPQGQPINQTEGQSSSFSQSEYLVYKENQCRIRY 508          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: H3BCR5 (Poly [ADP-ribose] polymerase OS=Latimeria chalumnae OX=7897 GN=PARP3 PE=4 SV=1)

HSP 1 Score: 491.886 bits (1265), Expect = 1.662e-165
Identity = 278/526 (52.85%), Postives = 352/526 (66.92%), Query Frame = 2
Query:   74 MPPKRXXXXXXXXXXXXXXXXNE--FDSIKTALTKGPSFRKKTHTIDKFAATLFH--GGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASE--KFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC--RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRN--ITSSFGQSEYLIYQESQCRIRY 1621
            MPPKRKA++  K+A   K    E  F S   AL   P  + KT  ID  A +L H     V +DYDCMLNQTNI  NNNK+Y+IQ+I+ NG YF W RWGRVGE G + KL P N+ + A K F+KKF+DKTKN W NR+NF +  GKYT++E+   DE E  EV +   D  +  K  P  L   TQ LV LIF  DMF  A+  + LD KK+PLGKLSK QI KGFE LEE++  + K   K  +L EL SKFYTIIPH+FGR RP  I+T + ++ K DMLLVL DI   +AL   K  ES+ K+  +  P+PLDE +++L  +L +L+   EEYKII++Y+E T    R +K++N WKV+R  E + F  H  + NR+LLWHGT+IAV+AAILKSGLRIMPHSGGRVGRGIYFASENGKS+ YV    +  G+MFL EVALGKE  +  DD S+   P G+  VVA+G TEPD   +  I +DG KVVVP GKP+ ++   +S+F QSEY+IY+E+QCRIRY
Sbjct:    1 MPPKRKAASSSKRAKKGKVEPQEDTFRSTVEALKAAPKEKVKTK-IDS-ACSLSHDQASQVYEDYDCMLNQTNIGHNNNKFYIIQLIEKNGAYFCWNRWGRVGEVGQS-KLSPANSLDAAKKDFEKKFKDKTKNDWSNRENFTAHAGKYTMIEVEAGDEGEV-EVKIDAVDGGKLKKVRPCTLNNPTQDLVSLIFNNDMFKDAMETMNLDVKKMPLGKLSKQQIAKGFEALEEIEASLQKKGSKK-QLEELCSKFYTIIPHNFGRMRPPVISTTEVIQAKKDMLLVLADIVLAKALQAEK--ESNKKEDIEEVPHPLDEDYQLLKCELSLLEPDIEEYKIIKKYIEATGSTHRTLKLLNAWKVNREGESERFSTHDDLDNRRLLWHGTSIAVIAAILKSGLRIMPHSGGRVGRGIYFASENGKSSAYVGTTSNSIGIMFLGEVALGKEYHITTDDSSLRAAPPGYNCVVARGCTEPDPSKDTAITVDGKKVVVPQGKPIRQDKFASSNFSQSEYVIYKENQCRIRY 519          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: B1WBK7 (Poly [ADP-ribose] polymerase OS=Xenopus tropicalis OX=8364 GN=parp3 PE=2 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 3.495e-165
Identity = 268/503 (53.28%), Postives = 337/503 (67.00%), Query Frame = 2
Query:  137 NEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGI-VVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLV---TNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT--KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPV--HRNITSSFGQSEYLIYQESQCRIRY 1621
            + F S   AL K  S +K    ID       +G   V +DYDCMLNQTNI  NNNK+YVIQ+I    +Y+ W RWGRVGE G + KL P+   E+A K F+KKF+DKTKN W  R+NF    GKYT++E+   D++ + E  V   T     +K  P  L K TQ L+ LIF TDMF  A+  + LD KK+PLGKLSK QI KGFE L+ELQ  + +   K   L +LSS+FYTIIPH+FGRR P  I T + ++ K DMLLVL DIE  Q L   K  +   ++K    P+PLD  +++L  DL +LD  +EEYK+I+ YVENT    R +KI NVW V+R +EE+ F  HK I NR+LLWHGTNIAVV AILKSGLRIMPHSGGRVG+GIYFASEN KSAGYV C     G+MFLNEVALG+E  +  DD S+  PP G++SVVA+G TEP+   ++++DLDG K+ VP G+PV   +   SSFGQSEYL+Y+ESQ R+RY
Sbjct:   39 DRFQSAVQAL-KAASGKKGKAKIDSSCHLSSYGDYEVYEDYDCMLNQTNIGSNNNKFYVIQLITKKNEYYCWNRWGRVGEVGQS-KLSPFPKLENAQKDFEKKFKDKTKNSWSERENFTPHPGKYTIIEVEHDDDNGSGEATVKADTVDGTVQKVRPCSLDKPTQDLISLIFSTDMFKEAMQTMNLDIKKMPLGKLSKAQIAKGFEALDELQAALDRKANKGV-LSDLSSRFYTIIPHNFGRRTPPVIDTSEVLQAKKDMLLVLADIELAQTLQADKVKKEEEEEKVQEVPHPLDVDYELLKCDLSLLDTSTEEYKVIKTYVENTGPTYRTLKIQNVWCVNRETEEERFSAHKDIENRRLLWHGTNIAVVVAILKSGLRIMPHSGGRVGKGIYFASENSKSAGYVGCTSKNLGIMFLNEVALGREHHIKMDDCSLQSPPKGYDSVVARGLTEPEPAKDRKLDLDGRKITVPQGRPVKMEKYSDSSFGQSEYLVYKESQARMRY 538          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: G1KLC9 (Poly [ADP-ribose] polymerase OS=Anolis carolinensis OX=28377 GN=PARP3 PE=4 SV=2)

HSP 1 Score: 489.574 bits (1259), Expect = 2.235e-164
Identity = 264/506 (52.17%), Postives = 341/506 (67.39%), Query Frame = 2
Query:  137 NEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGG--IVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSD-----ASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC--RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGK--PVHRNITSSFGQSEYLIYQESQCRIRY 1621
            + F S   AL   P  + K+  ID         G   + +DYDCMLNQTNI  NNNK+Y+IQ+I+ NGKY  W RWGRVGE G + KL  + + E A K F+KKF+DKTKN+W +RDNF    GKYTL+E+   DE++   ++  +S      A +K  P  L K TQ LV LIF  DMF  A+  + +D KK+PLGKLSK QI KGFE LE ++  + + +    KL ELSS+FYTIIPH+FGR RP  I T + ++ K DMLLVL DIE  Q+L   KK E   +++    P+PLD+ + +L   L ++D    +YK+I  Y+E T C  R + ++N+WKV+R SE   F+IH  + NR+LLWHGTNIAVVAAILKSGLRIMPHSGGRVG+G+YFASEN KSAGYV     + G+MFLNEVALGKE  +  DD S+ KPP G++SV+A G+TEPD  ++KE+ LDG KV++  GK  P+ +  +SSF QSEYLIYQESQCRIRY
Sbjct:   33 DSFHSTLVALKAAPKEKLKS-KIDSACWLSSSAGDAKIYEDYDCMLNQTNIGHNNNKFYIIQLIEENGKYSCWNRWGRVGEAGQS-KLNSFPSLEAAKKDFEKKFRDKTKNNWADRDNFVCHDGKYTLIEVQQGDEEDQEVIVKVDSTDGVKPAKQKIRPCTLDKPTQELVSLIFSNDMFKDAMQTMNIDVKKMPLGKLSKQQIAKGFEALEAIETTLQEQSYSQKKLEELSSRFYTIIPHNFGRCRPPAINTQEIIQAKKDMLLVLADIELAQSLQAQKKEEEEEEEEMKEVPHPLDKDYGLLKCQLTLVDPSVADYKLIVNYIEKTGCSYRKLNVMNIWKVNRESENSRFKIHDHLQNRRLLWHGTNIAVVAAILKSGLRIMPHSGGRVGKGLYFASENSKSAGYVGTTSKQVGIMFLNEVALGKEHRITCDDSSLRKPPDGYDSVLACGRTEPDPAHDKELILDGKKVLISQGKPIPIKQYESSSFSQSEYLIYQESQCRIRY 536          
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Match: V3ZW97 (Poly [ADP-ribose] polymerase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_214893 PE=4 SV=1)

HSP 1 Score: 483.026 bits (1242), Expect = 4.835e-162
Identity = 261/484 (53.93%), Postives = 341/484 (70.45%), Query Frame = 2
Query:  185 RKKTHTIDKFAATLFH-GGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLK---PNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            +KK+H IDK      +    V+DDY+CMLNQTNI  NNNK+Y+IQ+I+ NG+Y  W RWGRVGE G   K    +TK +A K F+KKFQDKTKN W NRD+F++  GKYT+++M   DE+E          + +  + SKL K TQ  V LIF  DMF  ++ +  +D KK+PLGKLSK QI KGFEVL+E++  +  N +K+  L+ELSS+FYT IPHDFGRR P  I   + +R+KMDML+VL DIE  Q + K K      K+ A +K   PNP+D  ++ML  +L++L+ KSEEYK+IE Y   T+  R+VK+ +VWK DR  ++  F+ H  + NRKLLWHGTNIAVVAAILK+GLRIMPHSGGRVG+GIYFASENGKSAGYV+CN ++ G+MFL+EVALGK+  +  DD ++   P GF+SV+A+G TEPD K +K I ++G KVV+P GKP      SSF QSEYL+Y+ESQ R+RY
Sbjct:   48 KKKSHAIDKACYLASNTNARVLDDYNCMLNQTNIGHNNNKFYIIQVIETNGQYCAWNRWGRVGEMG-DFKDMMCSTKAEAIKLFEKKFQDKTKNKWANRDSFEAKTGKYTMIDMAGDDEEEDEVDAPKVDLSGKTIAESKLDKVTQKFVSLIFDLDMFKESMKKFDIDVKKMPLGKLSKTQIAKGFEVLDEIEEVL--NKKKSGNLVELSSRFYTAIPHDFGRRVPPKIDNAEALRQKMDMLMVLADIEIAQEMTKEK-----DKKMATVKGEVPNPIDVNYEMLKCNLELLNPKSEEYKLIETYTNETQGYRSVKLQHVWKCDREGDDDRFKAHDKLGNRKLLWHGTNIAVVAAILKTGLRIMPHSGGRVGKGIYFASENGKSAGYVSCN-NKTGIMFLSEVALGKQNVILRDDHTLKAAPKGFDSVLAKGNTEPDCKKDKTITINGKKVVIPQGKPTKFATGSSFSQSEYLVYKESQNRLRY 522          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:103034813])

HSP 1 Score: 429.098 bits (1102), Expect = 2.239e-144
Identity = 253/469 (53.94%), Postives = 324/469 (69.08%), Query Frame = 2
Query:  242 VVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDA-----SEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGK----PVHRNITSSFGQSEYLIYQESQCRIRY 1621
            V +DYDCMLNQTNI  NNNK+YVIQ++   G Y+ WTRWGRVGE+G     GP N  + A K F+KKF+DKTKN+W +R+NF S  GKYTL+E+   D D+ +EV V   D       +   P  L   TQ L+  IF  DMF  A+  + LD KK+PLGKLSK QI KGFE LEE++    KN  + + L ELSSKF+TIIPH+FGR RP  I T + +  K +MLLVL DIE  Q+L    + E + ++  +  P+P+D+ ++ L  +L IL  KS+E+KIIE+Y++ T    + I++VW+VDR  E + F+ + A+ NRKLLWHGTN+AVVAAILKSGLRIMPHSGGRVG+GIYFASEN KSAGYV  + +R G+MFLNEVALG+E  +  DD ++ K PAG++SVVA+G+ EPDS  +  IDLDG KV VP GK    P +    S F  SEYLIY+ESQCRIRY
Sbjct:   61 VHEDYDCMLNQTNIGNNNNKFYVIQVLVDGGTYYCWTRWGRVGESGQNNLAGPTNA-DAAIKNFEKKFKDKTKNNWSDRENFVSHSGKYTLIEV---DGDQDAEVKVDAVDGRAAEVKKNILPCTLDDPTQRLIKFIFNNDMFKEAMENMNLDIKKMPLGKLSKQQIAKGFEALEEIEEA-IKNKSRESTLSELSSKFFTIIPHNFGRNRPPVINTDEIIHSKKEMLLVLADIEIAQSL--KAESEKAKEEMVETVPHPIDQDYQSLKCNLSILKKKSKEFKIIEKYLKAT-GHGLTIVDVWQVDREKEAERFKENNALENRKLLWHGTNVAVVAAILKSGLRIMPHSGGRVGQGIYFASENEKSAGYVRLS-NRIGIMFLNEVALGREYTITQDDHTLRKAPAGYDSVVARGRQEPDSANDVTIDLDGKKVTVPQGKAKKQPQYEE--SYFHNSEYLIYKESQCRIRY 518          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:103034813])

HSP 1 Score: 402.134 bits (1032), Expect = 1.862e-132
Identity = 238/438 (54.34%), Postives = 307/438 (70.09%), Query Frame = 2
Query:  242 VVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSD--ASE---KFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGK 1540
            V +DYDCMLNQTNI  NNNK+YVIQ++   G Y+ WTRWGRVGE+G     GP N  + A K F+KKF+DKTKN+W +R+NF S  GKYTL+E+   D D+ +EV V   D  A+E      P  L   TQ L+  IF  DMF  A+  + LD KK+PLGKLSK QI KGFE LEE++    KN  + + L ELSSKF+TIIPH+FGR RP  I T + +  K +MLLVL DIE  Q+L    + E + ++  +  P+P+D+ ++ L  +L IL  KS+E+KIIE+Y++ T    + I++VW+VDR  E + F+ + A+ NRKLLWHGTN+AVVAAILKSGLRIMPHSGGRVG+GIYFASEN KSAGYV  + +R G+MFLNEVALG+E  +  DD ++ K PAG++SVVA+G+ EPDS  +  IDLDG KV VP GK
Sbjct:   61 VHEDYDCMLNQTNIGNNNNKFYVIQVLVDGGTYYCWTRWGRVGESGQNNLAGPTNA-DAAIKNFEKKFKDKTKNNWSDRENFVSHSGKYTLIEV---DGDQDAEVKVDAVDGRAAEVKKNILPCTLDDPTQRLIKFIFNNDMFKEAMENMNLDIKKMPLGKLSKQQIAKGFEALEEIEEA-IKNKSRESTLSELSSKFFTIIPHNFGRNRPPVINTDEIIHSKKEMLLVLADIEIAQSL--KAESEKAKEEMVETVPHPIDQDYQSLKCNLSILKKKSKEFKIIEKYLKATG-HGLTIVDVWQVDREKEAERFKENNALENRKLLWHGTNVAVVAAILKSGLRIMPHSGGRVGQGIYFASENEKSAGYVRLS-NRIGIMFLNEVALGREYTITQDDHTLRKAPAGYDSVVARGRQEPDSANDVTIDLDGKKVTVPQGK 489          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:103034813])

HSP 1 Score: 380.948 bits (977), Expect = 3.092e-126
Identity = 223/417 (53.48%), Postives = 291/417 (69.78%), Query Frame = 2
Query:  242 VVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDA-----SEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEP 1477
            V +DYDCMLNQTNI  NNNK+YVIQ++   G Y+ WTRWGRVGE+G     GP N  + A K F+KKF+DKTKN+W +R+NF S  GKYTL+E+   D D+ +EV V   D       +   P  L   TQ L+  IF  DMF  A+  + LD KK+PLGKLSK QI KGFE LEE++    KN  + + L ELSSKF+TIIPH+FGR RP  I T + +  K +MLLVL DIE  Q+L    + E + ++  +  P+P+D+ ++ L  +L IL  KS+E+KIIE+Y++ T    + I++VW+VDR  E + F+ + A+ NRKLLWHGTN+AVVAAILKSGLRIMPHSGGRVG+GIYFASEN KSAGYV  + +R G+MFLNEVALG+E  +  DD ++ K PAG++SVVA+G+ EP
Sbjct:   61 VHEDYDCMLNQTNIGNNNNKFYVIQVLVDGGTYYCWTRWGRVGESGQNNLAGPTNA-DAAIKNFEKKFKDKTKNNWSDRENFVSHSGKYTLIEV---DGDQDAEVKVDAVDGRAAEVKKNILPCTLDDPTQRLIKFIFNNDMFKEAMENMNLDIKKMPLGKLSKQQIAKGFEALEEIEEA-IKNKSRESTLSELSSKFFTIIPHNFGRNRPPVINTDEIIHSKKEMLLVLADIEIAQSL--KAESEKAKEEMVETVPHPIDQDYQSLKCNLSILKKKSKEFKIIEKYLKAT-GHGLTIVDVWQVDREKEAERFKENNALENRKLLWHGTNVAVVAAILKSGLRIMPHSGGRVGQGIYFASENEKSAGYVRLS-NRIGIMFLNEVALGREYTITQDDHTLRKAPAGYDSVVARGRQEP 468          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:103030103])

HSP 1 Score: 259.996 bits (663), Expect = 7.669e-78
Identity = 175/474 (36.92%), Postives = 255/474 (53.80%), Query Frame = 2
Query:  248 DDYDCMLNQTNIDGNNNKYYVIQMIQ--YNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQ-SRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            D YD MLNQTN+  NNNKYY+IQ++Q  +   Y VW RWGRVG+ G    +       +A + F KKF DKTKN W++R NF+ V GKY L+ M     D   E    ++   +K  PS+L  + Q L++LI         + ++K DTKK PLGKL+  QI  G+  L+ ++ E  K      +LLE  ++FYT IPHDFG R P TI T + ++EKM +L  L+DI+     +  K  ESSS        +PLD ++  L   L  +   S E+++IE+Y+++T         + +++++ VDR  E  +F     + NR LLWHG+ ++    IL  GLR+ P     +G   G+GIYFA  + KSA Y   NQ +  G++ L EVALG    +   +    + P+G  S    G+T PD K    + LDG    VP+G  V   +    G S    E+++Y  +Q R+RY
Sbjct:  175 DIYDVMLNQTNLQFNNNKYYLIQLLQDDHAKAYSVWMRWGRVGKVGQNNLVSCGGNLAEAKEIFKKKFLDKTKNEWEDRANFEKVPGKYDLVFMDYTGNDNEEESCDVSTSVQKK--PSQLDLKLQSLLELICDIKAMEECVLEMKFDTKKAPLGKLTVEQIRAGYASLKRIE-ECLKKKGSNRELLEACNQFYTRIPHDFGLRVPPTIRTEEELKEKMALLEALSDIQ-----IAVKMVESSSHSDE----HPLDRQYHSLKCQLQPVTPNSHEFQVIEKYLQSTHAPTHSDYTMTVLDIFLVDREGERDSFLTE--MHNRMLLWHGSRLSNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFTNQKNNIGLLLLCEVALGDCNEMLDANYDADRLPSGKHSTKGLGQTGPDPK--NFVTLDG--ATVPMGPGVKTGVGQGGGCSLLYNEFVVYNPAQTRMRY 630          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:103030103])

HSP 1 Score: 248.825 bits (634), Expect = 7.903e-74
Identity = 173/485 (35.67%), Postives = 256/485 (52.78%), Query Frame = 2
Query:  221 TLFHGGIVVDDYDCM--LNQTNIDGNNNKYYVIQMIQ--YNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQ-SRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            T+   G    D +C   L +TN+  NNNKYY+IQ++Q  +   Y VW RWGRVG+ G    +       +A + F KKF DKTKN W++R NF+ V GKY L+ M     D   E    ++   +K  PS+L  + Q L++LI         + ++K DTKK PLGKL+  QI  G+  L+ ++ E  K      +LLE  ++FYT IPHDFG R P TI T + ++EKM +L  L+DI+     +  K  ESSS        +PLD ++  L   L  +   S E+++IE+Y+++T         + +++++ VDR  E  +F     + NR LLWHG+ ++    IL  GLR+ P     +G   G+GIYFA  + KSA Y   NQ +  G++ L EVALG    +   +    + P+G  S    G+T PD K    + LDG    VP+G  V   +    G S    E+++Y  +Q R+RY
Sbjct:  147 TVVMKGKAPVDLECKAKLGKTNLQFNNNKYYLIQLLQDDHAKAYSVWMRWGRVGKVGQNNLVSCGGNLAEAKEIFKKKFLDKTKNEWEDRANFEKVPGKYDLVFMDYTGNDNEEESCDVSTSVQKK--PSQLDLKLQSLLELICDIKAMEECVLEMKFDTKKAPLGKLTVEQIRAGYASLKRIE-ECLKKKGSNRELLEACNQFYTRIPHDFGLRVPPTIRTEEELKEKMALLEALSDIQ-----IAVKMVESSSHSDE----HPLDRQYHSLKCQLQPVTPNSHEFQVIEKYLQSTHAPTHSDYTMTVLDIFLVDREGERDSFLTE--MHNRMLLWHGSRLSNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFTNQKNNIGLLLLCEVALGDCNEMLDANYDADRLPSGKHSTKGLGQTGPDPK--NFVTLDG--ATVPMGPGVKTGVGQGGGCSLLYNEFVVYNPAQTRMRY 613          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003213.1 (pep scaffold:Pmarinus_7.0:GL484848:6623:9574:1 gene:ENSPMAG00000002936.1 transcript:ENSPMAT00000003213.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 1.514e-8
Identity = 22/39 (56.41%), Postives = 29/39 (74.36%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYNG--KYFVWTRWGR 364
            YD MLNQTN+  NNNK+Y+IQ+++ N    + VW RWGR
Sbjct:  100 YDVMLNQTNVGLNNNKFYLIQLLRDNDIKSFSVWMRWGR 138          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009885.1 (pep scaffold:Pmarinus_7.0:GL476547:520883:546470:1 gene:ENSPMAG00000008938.1 transcript:ENSPMAT00000009885.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.192e-7
Identity = 60/237 (25.32%), Postives = 106/237 (44.73%), Query Frame = 2
Query:  638 FQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEI-SKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIE-QYVENTKCR--NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSG-----------GRVGRGIYFA 1303
            F + +++ AL  L     ++P+  +   Q+ K   +L +L+  + SK+      L  LS++FY IIP       PL  T + ++  K+D+       +  +  L  KK  +SS     L       +F  L   L  L+  S ++  I  Q ++++  R    KI+ +++VDR +E   FR    + N + L+H      +  IL  GL ++P +            G +G GIYF+
Sbjct:    8 FVSTVWSEALGHLS-QILQVPILLIEPKQVTKAEAILLQLKKAVLSKDVHDEGALERLSNEFYKIIPQKHVAVCPL--TGMASISAKLDL------CQMRKENLALKKLTASSHSATTLA------QFTALRCSLLHLEPNSSDFNSIRNQLLQSSHGRLDGFKILKIFRVDRPAEIGQFR--SEVGNTRSLFHAFAPRSLLGILSRGL-LLPKTVVGEFGVERTDIGMLGCGIYFS 226          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009886.1 (pep scaffold:Pmarinus_7.0:GL476547:520883:541043:1 gene:ENSPMAG00000008938.1 transcript:ENSPMAT00000009886.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.340e-7
Identity = 60/239 (25.10%), Postives = 107/239 (44.77%), Query Frame = 2
Query:  638 FQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEI-SKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIE-QYVENTKCRNVK----IINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSG-----------GRVGRGIYFA 1303
            F + +++ AL  L     ++P+  +   Q+ K   +L +L+  + SK+      L  LS++FY IIP       PL  T + ++  K+D+       +  +  L  KK  +SS     L       +F  L   L  L+  S ++  I  Q ++++  R+V     I+ +++VDR +E   FR    + N + L+H      +  IL  GL ++P +            G +G GIYF+
Sbjct:    8 FVSTVWSEALGHLS-QILQVPILLIEPKQVTKAEAILLQLKKAVLSKDVHDEGALERLSNEFYKIIPQKHVAVCPL--TGMASISAKLDL------CQMRKENLALKKLTASSHSATTLA------QFTALRCSLLHLEPNSSDFNSIRNQLLQSSHGRSVAAPSDILKIFRVDRPAEIGQFR--SEVGNTRSLFHAFAPRSLLGILSRGL-LLPKTVVGEFGVERTDIGMLGCGIYFS 228          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO46812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNW1])

HSP 1 Score: 241.121 bits (614), Expect = 3.367e-69
Identity = 165/470 (35.11%), Postives = 251/470 (53.40%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYN--GKYFVWTRWGRVGENGATLKLGPY-NTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRN-----VKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQS-RFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNIT-SSFGQSEYLIYQESQCRIRY 1621
            Y   L   +I    N YY +Q+++ +   + +++  WGRVG      KL    N+   A + F++ +++KT N W  RDNF     ++  LE+   D  +  E +V      E  S SKL  + Q L+ +IF  +     L + ++D KK+PLGKL+K QI K + VL E Q  +S+   KTA +L++S++FYT+IPHDFG R+P  +   + ++ K++ML  L DIE   +LL++   E +         +P+D  +K L  D+++LDHKS E+ +I +YV NT         +++++V+K+ R  EE  F+  K + NR+LLWHG+     A IL  GLRI P     +G   G+G+YFA    KSA Y   + S   G++ L EVALG    L H    I K P G  SV   GKT PD       + DG   +VP GK     +  SS   +EY++Y  +Q  ++Y
Sbjct:  505 YSATLGMVDISRGTNSYYKLQVLKKDKSSRCYLFRSWGRVGTTIGGSKLEDCGNSHNSAVQSFEELYREKTGNEWSERDNFVKHPNRFYPLEI---DYGQAHEDVVKAK--IEMGSKSKLPSQIQELIKMIFDVESMKKTLIEFEIDLKKMPLGKLTKRQIEKAYSVLGEAQQILSEAASKTA-VLDVSNRFYTLIPHDFGMRKPPLLDNQELIKTKIEMLDNLIDIEVAFSLLQSSDGEDAE--------DPIDINYKKLKTDIEVLDHKSAEFGLISEYVSNTHADTHRQYELELLDVFKIKREGEEALFKPFKQLHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCCTSPSNNIGLLLLCEVALGNMHELKH-ASFIKKVPKGKHSVKGLGKTAPDPSATHTFE-DGT--IVPKGKGCPAPVKDSSLLYNEYIVYDTAQINMKY 956          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO46480 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ13])

HSP 1 Score: 219.55 bits (558), Expect = 1.494e-64
Identity = 170/473 (35.94%), Postives = 254/473 (53.70%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYNG--KYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXX-XXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRN-----VKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSR-FGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            +D MLNQTN+  NNNKYY+IQ+++ N   KY+ W RWGRVG +G    L  +    DA K+  +K   DKTKN W++R +F  V+GKY LL M  K E E  EV     +       SKL    + LV+LI        AL ++K DTKK PLG  S+  +   + +   +   I   + +    +  SS + T +      +RP  + T + V+EK+++L  L DI+    +LK         +K D K +P D+ ++ L  DL+ LDH  +++K+++ YVENT  +      +++ +V+ V  R ++++F     + NR LLWHG+ +   A ILK GLRI P     +G   G+GIYFA  + KSA Y    +S+  G++ L+EV+LGK   L   D +  K PAG +SV A GK  PD   N  +  DG  + +P GK +   +TS  G +    EY++Y   Q R+RY
Sbjct:   32 WDAMLNQTNVMNNNNKYYLIQLLEDNTAKKYYTWMRWGRVGFDGQK-NLQAFGANLDAAKRTFEKKFSDKTKNDWEDRASFTKVQGKYDLLIMDYKAE-ENDEVDAPVKEEKPAKPESKLDCRVRELVELICNVQAMEEALKEMKYDTKKAPLGSFSEYHVCH-YTIQLRMTGRIVPVSPRCKGSMTCSS-WITRLKRTMKMKRPPLLRTNEEVKEKLELLEALGDIQVAITMLK---------EKVDDKMHPADKHYESLHCDLEPLDHAHDDFKMVKMYVENTHAQTHNQYKMEVEDVFVV--RHQKEDFL---DVGNRMLLWHGSRLTNWAGILKQGLRIAPPEAPVTGYMFGKGIYFADMSSKSANYCFATRSKNTGLVLLSEVSLGKSNVLLTADYNAAKLPAGHQSVKALGKFAPDPTQN-VVRPDG--LTIPCGKGIATGVTSPNGYTLMYNEYIVYDTRQVRMRY 483          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO26345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC91])

HSP 1 Score: 103.605 bits (257), Expect = 4.870e-25
Identity = 63/153 (41.18%), Postives = 90/153 (58.82%), Query Frame = 2
Query:  455 TKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLV 913
            TKN W++R +F  V+GKY LL M  K E E  EV     +       SKL    + LV+LI        AL ++K DTKK PLGKL+  QI  G+E L+++++ ISK +    KL++   +FYT IPH FG +RP  + T + V+EK+++L V
Sbjct:    5 TKNDWEDRASFTKVQGKYDLLIMDYKAE-ENDEVDAPVKEEKPAKPESKLDCRVRELVELICNVQAMEEALKEMKYDTKKAPLGKLTTDQIKAGYEALKKIESCISKGDYGN-KLVKACDEFYTRIPHCFGMKRPPLLRTNEEVKEKLELLEV 155          

HSP 2 Score: 56.6102 bits (135), Expect = 4.860e-9
Identity = 30/77 (38.96%), Postives = 45/77 (58.44%), Query Frame = 2
Query: 1160 NFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSR-FGVMFLNE 1375
            ++ I   + ++ LLWHG+ +   A ILK GLRI P     +G   G+GIYFA  + KSA Y    +S+  G++ L+E
Sbjct:  165 SYTIQPLLYSQMLLWHGSRLTNWAGILKQGLRIAPPEAPVTGYMFGKGIYFADMSSKSANYCFATRSKNTGLVLLSE 241          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO46659 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC2])

HSP 1 Score: 77.7962 bits (190), Expect = 6.538e-15
Identity = 78/308 (25.32%), Postives = 132/308 (42.86%), Query Frame = 2
Query:  743 VLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYV--ENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMP-----------HSGGRVGRGIYFASENGKSAGYVACNQ--SRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            ++EE  N  ++N EK +KL E   +F ++IPH    +       L  + EK ++  ++ D      ++   +  + S   + L       ++K L   ++ L  +  EYK I++    E T   ++ ++NV+ + R  E+ N+R    +  +KLL+H + +     IL  GL ++P              G +G GIYFA     SA Y +     SRF  M +N+VALGK K        + +PP G+ SV+    TE                             S F   E+++Y   Q ++RY
Sbjct:   71 MIEEFDN--TQNKEKISKLWE---EFDSLIPHQIKIKDSTVNKGL--IAEKQNLCQLIRD------MVTISEATNMSTVSSHLA------KYKALRCHIEALHPEEAEYKAIKELAIEEQTGSNDIIVLNVFSLHRPVEDINYR--HGLGRQKLLFHASRVRNFVGILSRGL-LLPTIVVDDFGGQRSDAGMLGHGIYFADRASTSAKYSSPGMLGSRF--MLVNKVALGKSKEYRKFTKDLTRPPDGYNSVIGVKATETQP--------------------------SDFKDDEFVVYDTKQQQMRY 328          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Match: EDO29976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T240])

HSP 1 Score: 62.7734 bits (151), Expect = 9.090e-11
Identity = 63/227 (27.75%), Postives = 109/227 (48.02%), Query Frame = 2
Query:  254 YDCMLNQTNID----GNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLL--EMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQ--LKLDTKKLPLGKLSKPQIMKGFEVLE-------------ELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLT 865
            YD ++ + ++     G NN +Y +Q+I   GK  + + TRWGR+G+ G   +L P++  + A  +F K F+ KT N WD + +F     KY+L+  E   +      + ++   D  E   PSKL K  Q L+  I   +    +++   L++D + +P G+LS   I +   VLE             ++ + +   ++    L+ LS   Y +I H  G RR L+
Sbjct:   89 YDILMTKVDVKYGYFGLNN-FYKMQVIFEKGKNLWVLLTRWGRIGDRGQH-QLTPFSDAKAATDEFKKIFRSKTGNLWDEKGSFVKHPKKYSLVLPERNPQFHHRKPKDILKPFDL-EACPPSKLPKPLQTLMKAITDQEWLRKSVSHHSLQVDPEFMPFGRLSLETINRARGVLEKICKRDGYVISFSKIDDYVISFSKIDGYLISLSKSGYFVISHSVGPRRKLS 312          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp3 (poly(ADP-ribose) polymerase family member 3 [Source:NCBI gene;Acc:101172069])

HSP 1 Score: 439.884 bits (1130), Expect = 1.348e-148
Identity = 253/502 (50.40%), Postives = 330/502 (65.74%), Query Frame = 2
Query:  143 FDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDA-----SEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT--KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVH--RNITSSFGQSEYLIYQESQCRIRY 1621
            F S K AL    +  K    +D+    L   G V +DY CMLNQTNI  NNNK+YVIQ++Q N +++ W RWGRVGE G   KL  ++T E A K F+KKF+DKTKN W NR NF +  GKYTL+E+   + ++ +EV V + D       +   P  L + TQ L+ LIF  DMF  A+  + LD KK+PLGKLSK QI KGFEVLEE++  ++K N++   L ELSSKF+T IPH+FGR RP TI T + +  K  ML+VL DIE  Q L    + E + ++  +  P+ LD+ +  L   L +LD KS+ +KIIE Y++ T  K  N  I+NVW+VDR  E + F  +  + NR+LLWHGTNIAVVAAILKSGLRIMP SGGRVGRGIYFASEN KS  YV  + ++ GVMFL+EVALG+E  +  D+ S+ + P+GF+SVVA+G+ EPD   +  I L+G +V VP GK  H  R   SSF  SEYLIY+ESQCR+R+
Sbjct:   26 FTSAKEALLAAGAQPKGRRAVDE-QCPLASTGEVYEDYGCMLNQTNIGHNNNKFYVIQVVQENKRFYSWNRWGRVGEVGQN-KLNSFDTPEKAVKDFEKKFKDKTKNDWSNRSNFVTHPGKYTLIEV---EGEQDAEVKVDSVDGKAVKVPKNTLPCTLDEATQKLITLIFSNDMFKEAMECMDLDIKKMPLGKLSKVQIAKGFEVLEEIEAALNKPNQRHL-LEELSSKFFTTIPHNFGRNRPPTINTKEIIEHKKQMLMVLADIELAQTL--KSETEKAQEEMIETVPHHLDQDYMSLKCKLSLLDKKSKTFKIIETYLKATSDKFYNPTIVNVWEVDREMEGQRFAENDKLENRRLLWHGTNIAVVAAILKSGLRIMPQSGGRVGRGIYFASENSKSICYVRTS-NKTGVMFLSEVALGREYTITKDEPSLKEAPSGFDSVVARGRVEPDPSKDTFITLEGKEVAVPQGKAQHQPRFSNSSFCNSEYLIYKESQCRLRF 518          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 259.996 bits (663), Expect = 5.329e-78
Identity = 182/508 (35.83%), Postives = 268/508 (52.76%), Query Frame = 2
Query:  152 IKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEM--GVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQS-RFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            +KT + KG +            A ++  G +V  YD MLNQTN+  NNNK+Y+IQ++Q +    + VW RWGRVG+ G             A   F KKF DKT+N W+ R +F  V GKY ++ M     +++E + V+    DA+      KL  + Q L++LI         + ++K DT+K PLGKL+  QI  G+  L++++ E  K    +  LLE  ++FYT IPHDFG R P  I T   ++EK+ +L  L+DI+     +  K  +SS    AD + +PLD  +  L  +L  LD  S E+K+IE+Y+++T         + +++++ VDR  E ++F     + NR LLWHG+ ++    IL  GLR+ P     +G   G+GIYFA  + KSA Y   NQS   G++ L EVALG    L   D      PAG  S    G+T PD K    + LDG  V VP+G  V     +S G S    E+++Y  +Q R+RY
Sbjct:  141 VKTVVMKGRAPVDPECNAKLGKAHVYSEGSIV--YDVMLNQTNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKKFFDKTRNEWEQRGSFVKVAGKYDMVFMDYSTNEKEENTTVV----DAATNKRSCKLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIE-ECLKRKGSSRDLLEACNQFYTRIPHDFGLRPPPVIHTDAELKEKISLLEALSDIQ-----IAVKMVQSS----ADSEEHPLDRHYHSLKCNLQPLDSTSSEFKVIEKYLQSTHAPTHRDYGMTVLDIFSVDRDGESESFL--SDLHNRTLLWHGSRLSNWVGILSKGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFANQSNHVGLLLLCEVALGDCNELLDADYEANNLPAGKHSTKGLGQTAPDPK--NSVTLDG--VTVPMGPGVKTGAANSSGYSLLYNEFIVYSPAQTRMRY 626          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 243.817 bits (621), Expect = 6.055e-73
Identity = 169/469 (36.03%), Postives = 248/469 (52.88%), Query Frame = 2
Query:  263 MLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQS-RFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQS----EYLIYQESQCRIRY 1621
            +L  TN+  NNNK+Y+IQ++Q +    + VW RWGRVG+ G             A   F KKF DKT+N W+ R +F  V GKY ++ M    +  T+E + T +        S L  + Q L++LI         + ++K DT+K PLGKL+  QI  G+  L++++ E  K    +  LLE  ++FYT IPHDFG R P  I T   ++EK+ +L  L+DI+     +  K  +SS    AD + +PLD  +  L  +L  LD  S E+K+IE+Y+++T         + +++++ VDR  E ++F     + NR LLWHG+ ++    IL  GLR+ P     +G   G+GIYFA  + KSA Y   NQS   G++ L EVALG    L   D      PAG  S    G+T PD K    + LDG  V VP+G  V     +S G S    E+++Y  +Q R+RY
Sbjct:   67 LLTSTNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKKFFDKTRNEWEQRGSFVKVAGKYDMVFM----DYSTNEKVETKTRVLSLKVFSSLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIE-ECLKRKGSSRDLLEACNQFYTRIPHDFGLRPPPVIHTDAELKEKISLLEALSDIQ-----IAVKMVQSS----ADSEEHPLDRHYHSLKCNLQPLDSTSSEFKVIEKYLQSTHAPTHRDYGMTVLDIFSVDRDGESESFL--SDLHNRTLLWHGSRLSNWVGILSKGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCFANQSNHVGLLLLCEVALGDCNELLDADYEANNLPAGKHSTKGLGQTAPDPK--NSVTLDG--VTVPMGPGVKTGAANSSGYSLLYNEFIVYSPAQTRMRY 515          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp1 (poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Acc:101157338])

HSP 1 Score: 238.424 bits (607), Expect = 1.213e-67
Identity = 158/469 (33.69%), Postives = 252/469 (53.73%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQ--YNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCR-----NVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSR-FGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNI-TSSFGQSEYLIYQESQCRIRY 1621
            Y   L   +I    N YY +Q+++     +Y+V+  WGRVG      KL  ++ K  A   F   +++KT N W +  NF     K+  LE+    ++E  + L  ++      + SKL K  Q L+ +IF  +    A+ + ++D +K+PLGKLSK QI   + +L E+Q  +S +    A++L+LS++FYT+IPHDFG ++P  + +LD ++ K++ML  L DIE   +LL+            D + +P+D  ++ L   ++++D  ++E ++I QYV+NT         +++  ++K+ R  E + FR  + + NR+LLWHG+     A I+  GLRI P     +G   G+G+YFA    KSA Y   +QS   G++ L EVALG    L      I K P G  SV   G+T PD   +  + LDG  V VPLGK V  NI  +S   +EY++Y  +Q  ++Y
Sbjct:  554 YSATLGLVDIVRGTNSYYKLQLLEDDLQKRYWVFRSWGRVGTTIGGNKLDKFHDKNSALDNFLSVYKEKTGNEWGS-SNFIKYPTKFYPLEIDYGQDEEAVKRLTASAG-----TKSKLPKPVQELIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYALLTEVQQAVS-DCVPEAQILDLSNRFYTLIPHDFGMKKPPLLNSLDYIQAKVEMLDNLLDIEVAYSLLRGG--------AQDNEHDPIDINYEKLKTKIEVVDKSTQEAEVITQYVKNTHAATHNTYTLEVQEIFKIGREGERQRFRPFEELHNRQLLWHGSRATNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLILLAEVALGNMHEL-KKASHITKLPKGKHSVKGLGRTAPDP--SATVTLDG--VQVPLGKGVQTNIDDTSLLYNEYIVYDVAQINLKY 1002          
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Match: parp2 (poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Acc:101165670])

HSP 1 Score: 220.705 bits (561), Expect = 3.118e-63
Identity = 164/503 (32.60%), Postives = 242/503 (48.11%), Query Frame = 2
Query:  152 IKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEM--GVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC-----RNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGG------------------------------------------------RVGRGIYFASENGKSAGYVACNQS-RFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSK 1486
            +KT + KG +            A ++  G +V  YD MLNQTN+  NNNK+Y+IQ++Q +    + VW RWGRVG+ G             A   F KKF DKT+N W+ R +F  V GKY ++ M     +++E + V+    DA+      KL  + Q L++LI         + ++K DT+K PLGKL+  QI  G+  L++++ E  K    +  LLE  ++FYT IPHDFG R P  I T   ++EK+ +L  L+DI+     +  K  +SS    AD + +PLD  +  L  +L  LD  S E+K+IE+Y+++T         + +++++ VDR  E ++F     + NR LLWHG+ ++    IL  GLR+ P                                                    + G+GIYFA  + KSA Y   NQS   G++ L EVALG    L   D      PAG  S    G+T PD K
Sbjct:  141 VKTVVMKGRAPVDPECNAKLGKAHVYSEGSIV--YDVMLNQTNLQFNNNKFYLIQLLQDDSSKSFSVWMRWGRVGKVGQNSLTACGGDLLKAKDIFKKKFFDKTRNEWEQRGSFVKVAGKYDMVFMDYSTNEKEENTTVV----DAATNKRSCKLDPKVQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQIRAGYAALKKIE-ECLKRKGSSRDLLEACNQFYTRIPHDFGLRPPPVIHTDAELKEKISLLEALSDIQ-----IAVKMVQSS----ADSEEHPLDRHYHSLKCNLQPLDSTSSEFKVIEKYLQSTHAPTHRDYGMTVLDIFSVDRDGESESFL--SDLHNRTLLWHGSRLSNWVGILSKGLRVAPPEAPVTGYMVCQEEASRCCTFVLFLFPILREFSRFGLNHFDPLKPTILSFSMQFGKGIYFADMSSKSANYCFANQSNHVGLLLLCEVALGDCNELLDADYEANNLPAGKHSTKGLGQTAPDPK 625          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000011115.1 (SMESG000011115.1)

HSP 1 Score: 971.459 bits (2510), Expect = 0.000e+0
Identity = 502/516 (97.29%), Postives = 502/516 (97.29%), Query Frame = 2
Query:   74 MPPKRXXXXXXXXXXXXXXXXNEFDSIKTALTKGPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            MPPKRKASAKLKKAPVKKKVKNEFDSIKTALTKGPSFRKK HTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHKQFDKKFQDKTKNHWDNRDNFKS             DEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY
Sbjct:    1 MPPKRKASAKLKKAPVKKKVKNEFDSIKTALTKGPSFRKKIHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGENGATLKLGPYNTKEDAHKQFDKKFQDKTKNHWDNRDNFKS-------------DEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSGGRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 503          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000045968.1 (SMESG000045968.1)

HSP 1 Score: 232.261 bits (591), Expect = 6.619e-66
Identity = 160/494 (32.39%), Postives = 256/494 (51.82%), Query Frame = 2
Query:  173 GPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYN--GKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC--RNVKII--NVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYV-ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            G +    +  IDK  A L+      D  + +L   +I   +N +Y IQ+++ +   K++V+  WGR+G    + KL  ++  + A K F   + +KT N W+NR+ FK    K+  L++   +  +  E +   S        S L +  + L+  IF  +    A+ + K+D+ K+PLGK+S+ QI   + +L+ELQ+ +  +N    KL ELS++FYT++PH+FG   P  I +L  V++K +M+  L +IE    L++ +K +           N +D +++ L   +  LD  S+ YK +E Y++NT     N KI+  +++ V R  E   +   K + NR +LWHG+     A IL  GLRI P     +G   G+G+YFA    KSA Y  + + S  G++ L EVALGK    +  D +IV  P G  S    G TEPD   N     D N V+ P+GK V ++I SS   +EY++Y   Q + RY
Sbjct:  461 GAAVDPDSGLIDK--AHLYQDRKTRDPLNAILGTADIITGSNSFYKIQLLESDKLSKWWVFRSWGRIGTAIGSNKLELFHDLDSAIKNFCGIYLEKTGNKWENRNEFKKCPYKFVPLDIDYGNRAKVIENITEES--------SNLPQTVEGLIRFIFDVESMKRAMLEFKIDSNKMPLGKVSQKQIDISYTILKELQDLLINSNPTKTKLCELSNRFYTMMPHNFGMMSPPLINSLSMVKDKCEMIESLMEIEVAYKLMEAEKGK-----------NIIDSQYEKLHNCISPLDKSSDVYKRLETYLQNTHAPTHNYKIMIEDIFDVSREGESNRYHSFKRLPNRMMLWHGSRRTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADVVSKSANYCHSSSTSPDGILLLCEVALGKMTERYQADSNIVLKP-GEHSCKGVGLTEPDPNGN----FDDNGVIYPMGKLVQQDIKSSLLYNEYIVYDIGQIKQRY 928          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000045968.1 (SMESG000045968.1)

HSP 1 Score: 232.261 bits (591), Expect = 8.848e-66
Identity = 160/494 (32.39%), Postives = 256/494 (51.82%), Query Frame = 2
Query:  173 GPSFRKKTHTIDKFAATLFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYN--GKYFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKC--RNVKII--NVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYV-ACNQSRFGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFGQSEYLIYQESQCRIRY 1621
            G +    +  IDK  A L+      D  + +L   +I   +N +Y IQ+++ +   K++V+  WGR+G    + KL  ++  + A K F   + +KT N W+NR+ FK    K+  L++   +  +  E +   S        S L +  + L+  IF  +    A+ + K+D+ K+PLGK+S+ QI   + +L+ELQ+ +  +N    KL ELS++FYT++PH+FG   P  I +L  V++K +M+  L +IE    L++ +K +           N +D +++ L   +  LD  S+ YK +E Y++NT     N KI+  +++ V R  E   +   K + NR +LWHG+     A IL  GLRI P     +G   G+G+YFA    KSA Y  + + S  G++ L EVALGK    +  D +IV  P G  S    G TEPD   N     D N V+ P+GK V ++I SS   +EY++Y   Q + RY
Sbjct:  468 GAAVDPDSGLIDK--AHLYQDRKTRDPLNAILGTADIITGSNSFYKIQLLESDKLSKWWVFRSWGRIGTAIGSNKLELFHDLDSAIKNFCGIYLEKTGNKWENRNEFKKCPYKFVPLDIDYGNRAKVIENITEES--------SNLPQTVEGLIRFIFDVESMKRAMLEFKIDSNKMPLGKVSQKQIDISYTILKELQDLLINSNPTKTKLCELSNRFYTMMPHNFGMMSPPLINSLSMVKDKCEMIESLMEIEVAYKLMEAEKGK-----------NIIDSQYEKLHNCISPLDKSSDVYKRLETYLQNTHAPTHNYKIMIEDIFDVSREGESNRYHSFKRLPNRMMLWHGSRRTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADVVSKSANYCHSSSTSPDGILLLCEVALGKMTERYQADSNIVLKP-GEHSCKGVGLTEPDPNGN----FDDNGVIYPMGKLVQQDIKSSLLYNEYIVYDIGQIKQRY 935          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000067451.1 (SMESG000067451.1)

HSP 1 Score: 214.542 bits (545), Expect = 6.730e-61
Identity = 141/424 (33.25%), Postives = 230/424 (54.25%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASE-KFSP--SKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTK-----CRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSR-FGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPD 1480
            +D MLNQTN+  NNNK+Y+IQ+++   +  Y+VW RW RVG+ G       YN    A + F KKF DKTKN W +R  F+ + GKY L+++    +    E+L TN  AS+ K  P  SKL ++ Q L+ ++F     N A++++K D  K+PLG+L++ QI  G+  L E++  +S+ +     L++  + +YT IPHDFG R P  I ++  ++ ++++L  L+DI+    L+          +  D+  +PLD  ++ L   ++++   +  Y++I  Y+  T        N++++++++V +  E +NF       NR LLWHG+       I+  GLRI P     +G   G+GIYFA  + KSA Y+   +S+  G + L EV+LG    L  ++    K P    SV   G   PD
Sbjct:  264 FDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKK----EILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLI---------NENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF---DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 671          
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Match: SMESG000067451.1 (SMESG000067451.1)

HSP 1 Score: 214.542 bits (545), Expect = 1.134e-60
Identity = 141/424 (33.25%), Postives = 230/424 (54.25%), Query Frame = 2
Query:  254 YDCMLNQTNIDGNNNKYYVIQMIQYNGK--YFVWTRWGRVGENGATLKLGPYNTKEDAHXXXXXXXXXXTKNHWDNRDNFKSVKGKYTLLEMGVKDEDETSEVLVTNSDASE-KFSP--SKLAKETQFLVDLIFQTDMFNHALAQLKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFYTIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSSKQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENT-----KCRNVKIINVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPH----SGGRVGRGIYFASENGKSAGYVACNQSR-FGVMFLNEVALGKEKPLFHDDGSIVKPPAGFESVVAQGKTEPD 1480
            +D MLNQTN+  NNNK+Y+IQ+++   +  Y+VW RW RVG+ G       YN    A + F KKF DKTKN W +R  F+ + GKY L+++    +    E+L TN  AS+ K  P  SKL ++ Q L+ ++F     N A++++K D  K+PLG+L++ QI  G+  L E++  +S+ +     L++  + +YT IPHDFG R P  I ++  ++ ++++L  L+DI+    L+          +  D+  +PLD  ++ L   ++++   +  Y++I  Y+  T        N++++++++V +  E +NF       NR LLWHG+       I+  GLRI P     +G   G+GIYFA  + KSA Y+   +S+  G + L EV+LG    L  ++    K P    SV   G   PD
Sbjct:  290 FDVMLNQTNLQFNNNKFYIIQLLKDEKEPIYYVWMRWARVGKIGQMKLTRFYNNLAAAKECFMKKFYDKTKNDWQDRQKFEKINGKYDLVQIDYCKK----EILETNKIASQVKLEPIESKLEEKLQDLMRIVFDLKEMNDAVSEMKYDNNKVPLGRLTEAQIKAGYLALREIEGLLSEGHSSNKSLVQACNTYYTRIPHDFGMRIPPLIRSISEIKRELELLETLSDIKIALKLI---------NENEDVHVHPLDRHYQNLHCIINLVTIDNPIYQLINDYLLLTHGSTHTTYNLEMLDLFEVRKEQEWQNF---DDKGNRMLLWHGSRTTNYGGIISQGLRIAPAEAPVTGHMFGKGIYFADMSTKSANYIYPTRSKNTGFLLLCEVSLGTCNELIKENSRANKLPPNCHSVKGLGIIAPD 697          
The following BLAST results are available for this feature:
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PARP34.898e-13347.63poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
PARP34.898e-13347.63poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
PARP35.074e-13347.63poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
PARP21.261e-7235.47poly(ADP-ribose) polymerase 2 [Source:HGNC Symbol;... [more]
PARP11.830e-7235.06poly(ADP-ribose) polymerase 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp-11.928e-5431.16Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/... [more]
parp-12.224e-4432.66Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/... [more]
parp-11.590e-2130.35Poly [ADP-ribose] polymerase 1 [Source:UniProtKB/... [more]
tank-11.671e-1625.78Poly [ADP-ribose] polymerase tankyrase [Source:Un... [more]
tank-11.796e-1625.78Poly [ADP-ribose] polymerase tankyrase [Source:Un... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Parp1.920e-6834.75gene:FBgn0010247 transcript:FBtr0113885[more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp34.114e-15051.39poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
parp29.174e-7935.69poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp29.375e-7935.69poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp23.489e-7334.17poly (ADP-ribose) polymerase 2 [Source:ZFIN;Acc:ZD... [more]
parp14.825e-6532.84poly (ADP-ribose) polymerase 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp32.226e-16853.28poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
ENSXETT00000011320.13.034e-7235.03poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
ENSXETT00000011326.13.226e-7235.03poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
ENSXETT00000011323.15.416e-7235.03poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
ENSXETT00000004148.11.226e-7034.39poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Parp31.148e-12245.94poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
Parp31.148e-12245.94poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
Parp34.098e-12145.71poly (ADP-ribose) polymerase family, member 3 [Sou... [more]
Parp22.639e-7435.52poly (ADP-ribose) polymerase family, member 2 [Sou... [more]
Parp13.030e-7033.74poly (ADP-ribose) polymerase family, member 1 [Sou... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y6F1|PARP3_HUMAN2.352e-13247.63Protein mono-ADP-ribosyltransferase PARP3 OS=Homo ... [more]
sp|Q3ULW8|PARP3_MOUSE2.867e-12045.71Protein mono-ADP-ribosyltransferase PARP3 OS=Mus m... [more]
sp|Q5Z8Q9|PRP2A_ORYSJ4.137e-8137.15Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa s... [more]
sp|O50017|PARP2_MAIZE6.198e-7737.37Poly [ADP-ribose] polymerase 2 OS=Zea mays OX=4577... [more]
sp|Q11207|PARP2_ARATH1.335e-7436.00Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thal... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Z2P31.599e-17054.86Poly [ADP-ribose] polymerase (Fragment) OS=Branchi... [more]
H3BCR51.662e-16552.85Poly [ADP-ribose] polymerase OS=Latimeria chalumna... [more]
B1WBK73.495e-16553.28Poly [ADP-ribose] polymerase OS=Xenopus tropicalis... [more]
G1KLC92.235e-16452.17Poly [ADP-ribose] polymerase OS=Anolis carolinensi... [more]
V3ZW974.835e-16253.93Poly [ADP-ribose] polymerase OS=Lottia gigantea OX... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp32.239e-14453.94poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
parp31.862e-13254.34poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
parp33.092e-12653.48poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
parp27.669e-7836.92poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp27.903e-7435.67poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000003213.11.514e-856.41pep scaffold:Pmarinus_7.0:GL484848:6623:9574:1 gen... [more]
ENSPMAT00000009885.11.192e-725.32pep scaffold:Pmarinus_7.0:GL476547:520883:546470:1... [more]
ENSPMAT00000009886.11.340e-725.10pep scaffold:Pmarinus_7.0:GL476547:520883:541043:1... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468123.367e-6935.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464801.494e-6435.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263454.870e-2541.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466596.538e-1525.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299769.090e-1127.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp31.348e-14850.40poly(ADP-ribose) polymerase family member 3 [Sourc... [more]
parp25.329e-7835.83poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp26.055e-7336.03poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
parp11.213e-6733.69poly(ADP-ribose) polymerase 1 [Source:NCBI gene;Ac... [more]
parp23.118e-6332.60poly(ADP-ribose) polymerase 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Poly [ADP-ribose] polymerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011115.10.000e+097.29SMESG000011115.1[more]
SMESG000045968.16.619e-6632.39SMESG000045968.1[more]
SMESG000045968.18.848e-6632.39SMESG000045968.1[more]
SMESG000067451.16.730e-6133.25SMESG000067451.1[more]
SMESG000067451.11.134e-6033.25SMESG000067451.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015453 ID=SMED30015453|Name=Poly [ADP-ribose] polymerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1796bp
GAGTTTTTAAAATTATTTTTAATTGTTAAACTATTTTACTTTTTAAGTAT
TTTTTATTACTTTGAATATTTCAATGCCACCAAAACGAAAAGCATCTGCT
AAGCTTAAAAAAGCGCCTGTGAAAAAGAAGGTGAAAAATGAATTTGATAG
CATTAAAACAGCGCTAACCAAAGGCCCATCGTTTCGTAAAAAAACCCACA
CTATTGATAAATTTGCTGCAACTTTATTTCATGGAGGAATCGTCGTTGAC
GATTACGATTGCATGTTGAATCAGACGAACATCGACGGAAATAATAATAA
ATATTATGTGATACAAATGATTCAGTACAATGGGAAATATTTTGTCTGGA
CGAGATGGGGACGAGTTGGGGAAAACGGTGCGACTCTCAAACTTGGACCC
TACAACACAAAGGAAGACGCTCATAAACAATTTGACAAAAAGTTTCAAGA
CAAAACGAAAAATCATTGGGATAATAGAGACAACTTTAAATCTGTTAAAG
GAAAATATACGCTTCTTGAAATGGGAGTAAAGGATGAGGATGAAACTTCT
GAAGTACTTGTCACTAATTCTGATGCATCAGAGAAATTTTCTCCCTCGAA
ACTTGCAAAGGAAACCCAATTCCTGGTGGACCTGATATTTCAAACTGACA
TGTTTAACCATGCATTGGCTCAACTGAAACTTGATACTAAAAAGTTACCT
TTGGGAAAATTGAGTAAGCCGCAAATCATGAAGGGATTTGAGGTGCTTGA
AGAGTTACAAAATGAAATCTCAAAAAATAATGAAAAGACAGCAAAACTTT
TGGAATTGTCATCAAAATTCTATACAATAATTCCTCATGATTTTGGAAGA
AGAAGACCACTGACAATTACAACTCTCGATACGGTAAGAGAGAAAATGGA
CATGCTACTGGTTTTGACAGATATTGAAAGTACTCAAGCTCTTTTGAAAA
CCAAAAAACCTGAAAGTTCCTCCAAGCAAAAGGCTGACCTGAAGCCCAAT
CCGTTGGATGAAAGGTTCAAGATGCTCGATGTTGACTTAGATATATTGGA
TCACAAATCTGAAGAATATAAAATAATCGAACAATATGTTGAAAACACTA
AATGTAGAAACGTGAAAATCATCAATGTGTGGAAAGTCGACAGGCGTTCC
GAAGAAAAGAACTTTCGAATTCATAAGGCGATTGCAAACCGCAAACTCTT
GTGGCATGGAACCAATATTGCTGTTGTTGCAGCCATTTTGAAATCAGGGT
TGAGAATAATGCCTCACAGTGGAGGCCGAGTTGGGAGGGGTATTTATTTT
GCATCGGAAAATGGCAAATCAGCAGGCTATGTGGCTTGTAACCAATCGAG
ATTCGGAGTGATGTTTCTCAATGAAGTTGCCTTAGGTAAGGAAAAGCCTC
TTTTTCATGACGACGGAAGCATCGTGAAGCCACCAGCCGGATTTGAGTCG
GTCGTTGCACAAGGGAAAACTGAACCCGATAGCAAATACAACAAAGAAAT
AGATTTGGATGGAAACAAAGTCGTAGTGCCACTGGGGAAACCAGTCCATA
GGAACATTACAAGCTCTTTTGGTCAAAGCGAATATCTAATTTATCAGGAA
TCGCAATGCCGAATTCGCTATCTGTTACTCTGTCAGTTTTAGTAGTTACG
CTACTTGGTGTGATACTTATCTTTTACTAACAAATCGTTACATTCTTATT
TCTTACCGTATTTATATATCGTGATTTATTTCCTAGATTTGCTTTTATTT
GTCCGAGTATCTTTGATTATCTTTAGAATTTTTCATCGGGTAATTT
back to top

protein sequence of SMED30015453-orf-1

>SMED30015453-orf-1 ID=SMED30015453-orf-1|Name=SMED30015453-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=523bp
MPPKRKASAKLKKAPVKKKVKNEFDSIKTALTKGPSFRKKTHTIDKFAAT
LFHGGIVVDDYDCMLNQTNIDGNNNKYYVIQMIQYNGKYFVWTRWGRVGE
NGATLKLGPYNTKEDAHKQFDKKFQDKTKNHWDNRDNFKSVKGKYTLLEM
GVKDEDETSEVLVTNSDASEKFSPSKLAKETQFLVDLIFQTDMFNHALAQ
LKLDTKKLPLGKLSKPQIMKGFEVLEELQNEISKNNEKTAKLLELSSKFY
TIIPHDFGRRRPLTITTLDTVREKMDMLLVLTDIESTQALLKTKKPESSS
KQKADLKPNPLDERFKMLDVDLDILDHKSEEYKIIEQYVENTKCRNVKII
NVWKVDRRSEEKNFRIHKAIANRKLLWHGTNIAVVAAILKSGLRIMPHSG
GRVGRGIYFASENGKSAGYVACNQSRFGVMFLNEVALGKEKPLFHDDGSI
VKPPAGFESVVAQGKTEPDSKYNKEIDLDGNKVVVPLGKPVHRNITSSFG
QSEYLIYQESQCRIRYLLLCQF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR031275PARP3
IPR008893WGR_domain
IPR012317Poly(ADP-ribose)pol_cat_dom
IPR004102Poly(ADP-ribose)pol_reg_dom
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0003910DNA ligase (ATP) activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006471protein ADP-ribosylation
GO:0006273lagging strand elongation
GO:0006302double-strand break repair
GO:0051103DNA ligation involved in DNA repair
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012317Poly(ADP-ribose) polymerase, catalytic domainPFAMPF00644PARPcoord: 13..205
e-value: 4.5E-50
score: 169.9
IPR012317Poly(ADP-ribose) polymerase, catalytic domainPROSITEPS51059PARP_CATALYTICcoord: 1..206
score: 56.829
NoneNo IPR availableGENE3DG3DSA:3.90.228.10coord: 4..204
e-value: 1.0E-64
score: 220.1
NoneNo IPR availablePANTHERPTHR10459DNA LIGASEcoord: 2..205
NoneNo IPR availableSUPERFAMILYSSF56399ADP-ribosylationcoord: 2..206
IPR031275Protein mono-ADP-ribosyltransferase PARP3PANTHERPTHR10459:SF66POLY [ADP-RIBOSE] POLYMERASE 3coord: 2..205