Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30015451
Length (bp)1584
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30015451) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30015451) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30015451) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30015451) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015451

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30015451h1SMcG0019225 dd_Smed_v4_11533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015451h1SMcG0019225 dd_Smed_v6_11533_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 54.299 bits (129), Expect = 5.283e-7
Identity = 72/263 (27.38%), Postives = 104/263 (39.54%), Query Frame = 3
Query:  102 SSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKF----KISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHC---SSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            SS +CP  C    C NG++ C   GLT+IP  LP  +  ++L         EL    I S  P  F    K+ +I + + ++  IAP++F  L  L  L L  N++   LPR           L  N N K +C    +FQ   +++LSL    L + D      I  + K    S   +QT+                        DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  278 SSGSCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL---------ELN--GIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITD-LPRGVFGGLYTLQLLLLNAN-KINCIRPDAFQD--LQNLSL----LSLYD----NKIQSLAKGTFTSLRAIQTL---------------HLAQNPFICDCNLKWLADFLRTN------------PIETSGARCASPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 54.299 bits (129), Expect = 5.555e-7
Identity = 76/285 (26.67%), Postives = 112/285 (39.30%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            N+   Q  E +     SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  +DLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQTI          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  246 NVAEVQKREFVCSGHQSFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLH----NLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 2 Score: 53.9138 bits (128), Expect = 6.766e-7
Identity = 41/120 (34.17%), Postives = 63/120 (52.50%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGN 470
            CP  C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN
Sbjct:  727 CPTEC---TCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN 835          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 54.299 bits (129), Expect = 5.995e-7
Identity = 76/285 (26.67%), Postives = 112/285 (39.30%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            N+   Q  E +     SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  +DLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQTI          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  246 NVAEVQKREFVCSGHQSFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLHN----LNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 2 Score: 53.9138 bits (128), Expect = 7.240e-7
Identity = 41/120 (34.17%), Postives = 63/120 (52.50%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGN 470
            CP  C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN
Sbjct:  719 CPTEC---TCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN 827          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 54.299 bits (129), Expect = 6.008e-7
Identity = 41/120 (34.17%), Postives = 63/120 (52.50%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGN 470
            CP  C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN
Sbjct:  731 CPTEC---TCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN 839          

HSP 2 Score: 52.7582 bits (125), Expect = 1.944e-6
Identity = 73/269 (27.14%), Postives = 107/269 (39.78%), Query Frame = 3
Query:   84 SFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  +DLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQTI          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  266 SFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLHN----LNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 482          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: IGSF10 (immunoglobulin superfamily member 10 [Source:HGNC Symbol;Acc:HGNC:26384])

HSP 1 Score: 54.299 bits (129), Expect = 6.064e-7
Identity = 79/306 (25.82%), Postives = 120/306 (39.22%), Query Frame = 3
Query:   33 MNIKLTQIWELLL-FVLTSFFHKSSSFNCPNFCNKDACDNGV-LSCSKSGLTSIPNVLPPNVDN--------VQLINQDFSQAGELTYANISSYG----PPKF-----KISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLN-LKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKS 890
            M +K   I  LL+ F +           CP  C   AC     + C+   LTSIP+ +PPNV+         V+L+  DFS   +L    + S G    P K       +  + + + ++  +  ++F  L  L  L + +N +  I P  F  LN L+ + L+GN   K H  +F             SL  L        I  +K L LS N L ++          L  L L  N + C DC LKWL+  +  +        ++S    +  P C  P     + L  +    F C  P+I S
Sbjct:    1 MKVKGRGITCLLVSFAVICLVATPGGKACPRRC---ACYMPTEVHCTFRYLTSIPDSIPPNVERINLGYNSLVRLMETDFSGLTKLELLMLHSNGIHTIPDKTFSDLQALQVLKMSYNKVRKLQKDTFYGLRSLTRLHMDHNNIEFINPEVFYGLNFLRLVHLEGNQLTKLHPDTF------------VSLSYLQIFK----ISFIKFLYLSDNFLTSLPQEMVSYMPDLDSLYLHGNPWTC-DCHLKWLSDWIQEKPDVIKCKKDRSPSSAQQCPLCMNPRTSKGKPLAMVSAAAFQCAKPTIDS 286          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 52.7582 bits (125), Expect = 6.003e-7
Identity = 75/318 (23.58%), Postives = 133/318 (41.82%), Query Frame = 3
Query:   54 IWELLLFVLTSFFHKSSSFNCPNFCNKDACDNG--VLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSKNDYVMW-YQDSKIEDSN 998
            ++ LLL + TS +   +   CP  C    CD    V+ CS SGLT IP  +  NV ++ + N    +   L  +++  +     ++  + + H ++  I      HL  L+ L L++N L  I P   +S  L  L L  N     H     + ++R+       L  LDF               S N +Q++ ++       L    L +N ++C DCR   +   L           +K     KV+  C  P  L  + L ++D+   +C  P+ +S        E++ L+C   S +  V+W Y++ +++ S+
Sbjct:    3 LYLLLLVIATSSWQFVAGLECPVEC---TCDKKGLVVDCSSSGLTRIPKNISRNVRSLVIRNNRIHK---LKRSDLEGFN----QLETLVLTHNKIKIIEENVLDHLPELKRLSLAHNELVYIPPLCSDSRPLASLNLKRN-----HIQFIDEQVLRYFP----DLTQLDF---------------SHNRIQSLRTKLFDNLPALSHAHLHSNPWHC-DCRASKVKALL-----------QKVKWEKKVY--CTNPVELRHQALDEVDDSALTCARPAEESW-----TGEEIKLTCAKNSSSKLVVWMYENVEVDSSS 267          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 50.0618 bits (118), Expect = 4.532e-6
Identity = 37/120 (30.83%), Postives = 62/120 (51.67%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLN-LKFLRLDGN 470
            CP  C   +C + V+ CS   LTS P+ +P +   + L   D +   E+   +++      + ++K+ + H RL+ +   +FS+L  L  L +SYN+L  + P  F  LN L+ L L GN
Sbjct:  677 CPPKC---SCLDRVVRCSNKNLTSFPSRIPFDTTELYL---DANYINEIPAHDLNRL----YSLTKLDLSHNRLISLENNTFSNLTRLSTLIISYNKLRCLQPLAFNGLNALRILSLHGN 786          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330734)

HSP 1 Score: 54.299 bits (129), Expect = 2.952e-7
Identity = 72/257 (28.02%), Postives = 114/257 (44.36%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLD--GNVNLKFHCSSFQKS-IIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTL--STRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            CP  C   +C    + CS  GLTS+P  +  +V+ ++L   + +   E  +  ++       K+  + +   ++  I   SF  L  LE L L+ NRL  I P  F + +   LRLD   NV        F+ +  +R L L N  +  LD    K ++  L+ L L++N L ++         RL  LRL +N F C DC L WL++ L  +TR   Y               +C  P+ L  + +  + +QEF C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLT-------KLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV-ELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFAC-DCHLSWLSRFLRSATRLAPYT--------------RCQSPSQLKGQNVADLHDQEFKC 302          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330733)

HSP 1 Score: 52.7582 bits (125), Expect = 8.091e-7
Identity = 72/257 (28.02%), Postives = 114/257 (44.36%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLD--GNVNLKFHCSSFQKS-IIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTL--STRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            CP  C   +C    + CS  GLTS+P  +  +V+ ++L   + +   E  +  ++       K+  + +   ++  I   SF  L  LE L L+ NRL  I P  F + +   LRLD   NV        F+ +  +R L L N  +  LD    K ++  L+ L L++N L ++         RL  LRL +N F C DC L WL++ L  +TR   Y               +C  P+ L  + +  + +QEF C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLT-------KLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV-ELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFAC-DCHLSWLSRFLRSATRLAPYT--------------RCQSPSQLKGQNVADLHDQEFKC 302          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330731)

HSP 1 Score: 52.7582 bits (125), Expect = 8.091e-7
Identity = 72/257 (28.02%), Postives = 114/257 (44.36%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLD--GNVNLKFHCSSFQKS-IIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTL--STRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            CP  C   +C    + CS  GLTS+P  +  +V+ ++L   + +   E  +  ++       K+  + +   ++  I   SF  L  LE L L+ NRL  I P  F + +   LRLD   NV        F+ +  +R L L N  +  LD    K ++  L+ L L++N L ++         RL  LRL +N F C DC L WL++ L  +TR   Y               +C  P+ L  + +  + +QEF C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLT-------KLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV-ELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFAC-DCHLSWLSRFLRSATRLAPYT--------------RCQSPSQLKGQNVADLHDQEFKC 302          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: aspn (asporin (LRR class 1) [Source:ZFIN;Acc:ZDB-GENE-041105-7])

HSP 1 Score: 53.9138 bits (128), Expect = 2.687e-7
Identity = 36/115 (31.30%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  111 NCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQI---LPRTFESLNL 446
            +CP  C    C   VL CS  GLT +P  +P N   + L N D ++  E  +  + +       +  + + + ++  I P++F ++N L+IL LSYN L Q+   LP + +SL L
Sbjct:   64 DCPEGCR---CSKKVLQCSDQGLTKVPKDIPANTLLLDLQNNDITEIKEDDFKGLDN-------LYALFLLNNQISKIHPKAFRNMNKLKILHLSYNLLTQMPENLPISVQSLRL 168          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: aspn (asporin (LRR class 1) [Source:ZFIN;Acc:ZDB-GENE-041105-7])

HSP 1 Score: 53.9138 bits (128), Expect = 2.687e-7
Identity = 36/115 (31.30%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  111 NCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQI---LPRTFESLNL 446
            +CP  C    C   VL CS  GLT +P  +P N   + L N D ++  E  +  + +       +  + + + ++  I P++F ++N L+IL LSYN L Q+   LP + +SL L
Sbjct:   64 DCPEGCR---CSKKVLQCSDQGLTKVPKDIPANTLLLDLQNNDITEIKEDDFKGLDN-------LYALFLLNNQISKIHPKAFRNMNKLKILHLSYNLLTQMPENLPISVQSLRL 168          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: mxra5a (matrix-remodelling associated 5a [Source:ZFIN;Acc:ZDB-GENE-090312-22])

HSP 1 Score: 54.299 bits (129), Expect = 3.468e-7
Identity = 82/316 (25.95%), Postives = 142/316 (44.94%), Query Frame = 3
Query:   51 QIWELLLFVLTSFFHKSSSFNCPNFCNKDACDNGV-LSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPE-SFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKF-HCSSFQK-SIIRHLSLVNCSLKILDFCTLKPI-------IGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQI--DKVFPK------CNRPTFLAERFLHQIDEQEFSCRTP--SIKSIDLKIENIEKLILS 932
            QIW +L+ +      +     CP  C   AC   V + C+   L ++P  +P  V+ + L    F+   ++TY++ +       +  ++ + H   V   P+ +F  L  L++L LSYN+L  +  +T   L +L  L LD N  L+F H  +FQ  + +R L L    L+ L   T           +  LK L LS N+L T+  +       L  L L  N + C DCR++W        F  +N + +  ++   DK +P       C  P  L ++ L ++++   +C +P  SI +  +  E+ E  +L+
Sbjct:    7 QIWIMLMLIAVPVAVQC----CPRPC---ACHQPVEVHCTFRSLLTVPAGVPKQVERMNL---GFNTIHKITYSSFAG-----LRKMELLLMHGNNVHQIPDGTFRDLISLQMLKLSYNKLKLLSRQTLMGLWSLTRLHLDHN-RLEFIHPDAFQGLTNLRLLHLEGNQLQQLHPATFSTFSVLGHFPVSTLKHLYLSDNILTTLSQKMLASMPYLESLSLHGNPWTC-DCRMRW--------FNEWNKNSQGVLKCKKDKAYPSGQLCPLCFSPKQLKKKQLQELEKP--TCNSPIISISNRAISSEDTESDLLT 295          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: mxra5b (matrix-remodelling associated 5b [Source:ZFIN;Acc:ZDB-GENE-081104-119])

HSP 1 Score: 54.299 bits (129), Expect = 4.054e-7
Identity = 73/270 (27.04%), Postives = 113/270 (41.85%), Query Frame = 3
Query:  114 CPNFCNKDACDN-GVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPE-SFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-SIIRHLSLVNCSLKIL------DFCTLKPI-IGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKS 890
            CP  C   AC     + C+   L ++P  +      VQ IN  F+   ++T A+ S       +  ++ + H   V   P+ +F  L  L++L +SYN+L  I  RTF  L  +  L LD N     H  +F   + +R L L    L+ L       F  L+   +  LK L +S NLLQT+ SR        L   L        DCR++WL    +          +++    ++ P C  P  L  +    +D ++  C  PSI S
Sbjct:   49 CPRQC---ACSAPAEVHCTFRALLAVPAGI---SKQVQRINFGFNTISQITDASFSG-----LRKLELLMMHGNNVQKIPDGAFQDLVSLQVLKMSYNKLTVITDRTFSGLTGIIRLHLDHNHISSIHPQAFLGLTSLRLLHLEANRLQQLHPHTFSTFSVLRRFPVSTLKHLHISDNLLQTL-SRSVLENTPQLETLLLTGNPWSCDCRMRWLQDWSARHPGVMKCKKDRTFTSGQLCPLCASPKHL--KAADMLDLKQLVCSGPSIIS 304          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: mxra5b (matrix-remodelling associated 5b [Source:ZFIN;Acc:ZDB-GENE-081104-119])

HSP 1 Score: 53.9138 bits (128), Expect = 4.605e-7
Identity = 73/270 (27.04%), Postives = 113/270 (41.85%), Query Frame = 3
Query:  114 CPNFCNKDACDN-GVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPE-SFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-SIIRHLSLVNCSLKIL------DFCTLKPI-IGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKS 890
            CP  C   AC     + C+   L ++P  +      VQ IN  F+   ++T A+ S       +  ++ + H   V   P+ +F  L  L++L +SYN+L  I  RTF  L  +  L LD N     H  +F   + +R L L    L+ L       F  L+   +  LK L +S NLLQT+ SR        L   L        DCR++WL    +          +++    ++ P C  P  L  +    +D ++  C  PSI S
Sbjct:   22 CPRQC---ACSAPAEVHCTFRALLAVPAGI---SKQVQRINFGFNTISQITDASFSG-----LRKLELLMMHGNNVQKIPDGAFQDLVSLQVLKMSYNKLTVITDRTFSGLTGIIRLHLDHNHISSIHPQAFLGLTSLRLLHLEANRLQQLHPHTFSTFSVLRRFPVSTLKHLHISDNLLQTL-SRSVLENTPQLETLLLTGNPWSCDCRMRWLQDWSARHPGVMKCKKDRTFTSGQLCPLCASPKHL--KAADMLDLKQLVCSGPSIIS 277          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: nedd4 (NEDD4 E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-478443])

HSP 1 Score: 59.6918 bits (143), Expect = 1.054e-8
Identity = 77/303 (25.41%), Postives = 131/303 (43.23%), Query Frame = 3
Query:   15 KIYNDIMNIKLTQIWELLLFVLTSFFHKSSSFNCPNFCNKDAC-DNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFES-LNLKFLRLDGNVNLKFHCSSFQKSI-IRHLSLVNCSLKIL---DFCTLKPIIG-----VLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKS 890
            K+YN I       +W +L  ++   F   ++ +CP+ C   AC  N  + C+   L ++P+ +P +V+ + L        GE ++A +S       K+  + I    +  +   +F  L  L++  +SYN+L  I   T    L L  L +D N     H ++F   + +R L L    L+ L    FCT    +G      LK L LS N++Q++ +        L  L L  N + C DC +KWL               ++S +  ++ P C+ P  L  R +  +  ++  C  P I S
Sbjct:    7 KMYNGI------HLWLILAVII---FVPQNALSCPHPC---ACYVNSEVHCTFRSLAAVPSRIPKHVERINLGFNSIQSIGEDSFAGLS-------KLELLLIHSNDVRNVPNGAFRDLVSLQVFKMSYNKLKTITSHTLHGLLGLTRLHIDHNQIEFIHPNAFNGLMSLRLLHLEGNLLQQLHANTFCTFN-FLGYFRQSTLKHLYLSENMIQSLPADMIKTMPLLENLYLHGNPWVC-DCNIKWLLDWTEQTDGILKCKKDRSYENGQLCPTCSSPKHLQNREIQSL--KDAYCSRPVIYS 286          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 53.5286 bits (127), Expect = 9.482e-7
Identity = 72/279 (25.81%), Postives = 110/279 (39.43%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFF-HKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            NI   Q  E +     SF  H  S  +CP  C    C N ++ C   GLT IP  LP  +  ++L      +   +      ++ P K K+ +I + + ++  IA ++F  L  L  L L  N++ ++    FE                       + ++ + + +NC L++  F  L      L  L L  N LQTI          +  L L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  255 NIAEVQKREFVCTGQQSFMVHSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRL------EQNSIKVIPPGAFSPYK-KLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEG------------------LVLLQLLLLNANKINC-LRVDSFQDLHN----LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 53.5286 bits (127), Expect = 9.815e-7
Identity = 72/279 (25.81%), Postives = 110/279 (39.43%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFF-HKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            NI   Q  E +     SF  H  S  +CP  C    C N ++ C   GLT IP  LP  +  ++L      +   +      ++ P K K+ +I + + ++  IA ++F  L  L  L L  N++ ++    FE                       + ++ + + +NC L++  F  L      L  L L  N LQTI          +  L L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  255 NIAEVQKREFVCTGQQSFMVHSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRL------EQNSIKVIPPGAFSPYK-KLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEG------------------LVLLQLLLLNANKINC-LRVDSFQDLHN----LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 53.1434 bits (126), Expect = 1.080e-6
Identity = 72/279 (25.81%), Postives = 110/279 (39.43%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFF-HKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            NI   Q  E +     SF  H  S  +CP  C    C N ++ C   GLT IP  LP  +  ++L      +   +      ++ P K K+ +I + + ++  IA ++F  L  L  L L  N++ ++    FE                       + ++ + + +NC L++  F  L      L  L L  N LQTI          +  L L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  255 NIAEVQKREFVCTGQQSFMVHSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRL------EQNSIKVIPPGAFSPYK-KLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEG------------------LVLLQLLLLNANKINC-LRVDSFQDLHN----LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 53.1434 bits (126), Expect = 1.128e-6
Identity = 72/279 (25.81%), Postives = 110/279 (39.43%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFF-HKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            NI   Q  E +     SF  H  S  +CP  C    C N ++ C   GLT IP  LP  +  ++L      +   +      ++ P K K+ +I + + ++  IA ++F  L  L  L L  N++ ++    FE                       + ++ + + +NC L++  F  L      L  L L  N LQTI          +  L L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  246 NIAEVQKREFVCTGQQSFMVHSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRL------EQNSIKVIPPGAFSPYK-KLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEG------------------LVLLQLLLLNANKINC-LRVDSFQDLHN----LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 478          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 55.4546 bits (132), Expect = 1.463e-7
Identity = 41/120 (34.17%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGN 470
            CP+ C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN
Sbjct:  719 CPSEC---TCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN 827          

HSP 2 Score: 55.4546 bits (132), Expect = 1.651e-7
Identity = 77/284 (27.11%), Postives = 110/284 (38.73%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCS----LKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            N+   Q  E +     SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  LDLS N+++++ P  F+ L +L  L L GN   +   S F+      L L+N +    L++  F  L      L  L L  N LQT+          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  246 NVAEVQKREFVCSGHQSFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN----LNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 478          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 55.4546 bits (132), Expect = 1.870e-7
Identity = 76/285 (26.67%), Postives = 112/285 (39.30%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            N+   Q  E +     SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  LDLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQT+          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  246 NVAEVQKREFVCSGHQSFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLH----NLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 2 Score: 54.299 bits (129), Expect = 3.497e-7
Identity = 60/264 (22.73%), Postives = 106/264 (40.15%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLK 902
            CP+ C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN            S++   +  +              +  L  L + +N L                           DC ++WL+  + + +K    +            +C  P  +A++ L     ++F+C+ P   +I  K
Sbjct:  719 CPSEC---TCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN----------DISVVPEGAFND--------------LSALSHLAIGANPLY-------------------------CDCNMQWLSDWVKSEYKEPGIA------------RCAGPGEMADKLLLTTPSKKFTCQGPVDITIQAK 910          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 54.6842 bits (130), Expect = 2.730e-7
Identity = 60/264 (22.73%), Postives = 106/264 (40.15%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLK 902
            CP+ C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN            S++   +  +              +  L  L + +N L                           DC ++WL+  + + +K    +            +C  P  +A++ L     ++F+C+ P   +I  K
Sbjct:  731 CPSEC---TCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN----------DISVVPEGAFND--------------LSALSHLAIGANPLY-------------------------CDCNMQWLSDWVKSEYKEPGIA------------RCAGPGEMADKLLLTTPSKKFTCQGPVDITIQAK 922          

HSP 2 Score: 53.5286 bits (127), Expect = 7.012e-7
Identity = 73/269 (27.14%), Postives = 107/269 (39.78%), Query Frame = 3
Query:   84 SFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  LDLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQT+          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  266 SFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLH----NLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 482          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 54.6842 bits (130), Expect = 2.853e-7
Identity = 60/264 (22.73%), Postives = 106/264 (40.15%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLK 902
            CP+ C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN            S++   +  +              +  L  L + +N L                           DC ++WL+  + + +K    +            +C  P  +A++ L     ++F+C+ P   +I  K
Sbjct:  731 CPSEC---TCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN----------DISVVPEGAFND--------------LSALSHLAIGANPLY-------------------------CDCNMQWLSDWVKSEYKEPGIA------------RCAGPGEMADKLLLTTPSKKFTCQGPVDITIQAK 922          

HSP 2 Score: 53.5286 bits (127), Expect = 6.840e-7
Identity = 73/269 (27.14%), Postives = 107/269 (39.78%), Query Frame = 3
Query:   84 SFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  LDLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQT+          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  266 SFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLH----NLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 482          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 54.6842 bits (130), Expect = 2.947e-7
Identity = 60/264 (22.73%), Postives = 106/264 (40.15%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLK 902
            CP+ C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN            S++   +  +              +  L  L + +N L                           DC ++WL+  + + +K    +            +C  P  +A++ L     ++F+C+ P   +I  K
Sbjct:  723 CPSEC---TCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN----------DISVVPEGAFND--------------LSALSHLAIGANPLY-------------------------CDCNMQWLSDWVKSEYKEPGIA------------RCAGPGEMADKLLLTTPSKKFTCQGPVDITIQAK 914          

HSP 2 Score: 53.5286 bits (127), Expect = 7.634e-7
Identity = 73/269 (27.14%), Postives = 107/269 (39.78%), Query Frame = 3
Query:   84 SFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  LDLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQT+          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  266 SFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLH----NLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 482          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9R1B9|SLIT2_MOUSE (Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.308e-6
Identity = 76/285 (26.67%), Postives = 112/285 (39.30%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            N+   Q  E +     SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  LDLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQT+          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  246 NVAEVQKREFVCSGHQSFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLH----NLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 2 Score: 54.299 bits (129), Expect = 2.446e-6
Identity = 60/264 (22.73%), Postives = 106/264 (40.15%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLK 902
            CP+ C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN            S++   +  +              +  L  L + +N L                           DC ++WL+  + + +K    +            +C  P  +A++ L     ++F+C+ P   +I  K
Sbjct:  719 CPSEC---TCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN----------DISVVPEGAFND--------------LSALSHLAIGANPLY-------------------------CDCNMQWLSDWVKSEYKEPGIA------------RCAGPGEMADKLLLTTPSKKFTCQGPVDITIQAK 910          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|O88279|SLIT1_RAT (Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.554e-6
Identity = 72/263 (27.38%), Postives = 105/263 (39.92%), Query Frame = 3
Query:  102 SSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKF----KISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHC---SSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            SS +CP  C   +C NG++ C   GLT+IP  LP  +  ++L         EL    I S  P  F    K+ +I + + ++  IAP++F  L  L  L L  N++   LPR           L  N N K +C    +FQ   +++LSL    L + D      I  + K    S   +QT+                        DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  278 SSGSCPAMC---SCSNGIVDCRGKGLTAIPANLPETMTEIRL---------ELN--GIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITD-LPRGVFGGLYTLQLLLLNAN-KINCIRPDAFQD--LQNLSL----LSLYD----NKIQSLAKGTFTSLRAIQTLH---------------LAQNPFICDCNLKWLADFLRTN------------PIETTGARCASPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|O94813|SLIT2_HUMAN (Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.667e-6
Identity = 76/285 (26.67%), Postives = 112/285 (39.30%), Query Frame = 3
Query:   36 NIKLTQIWELLLFVLTSFFHKSSS-FNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-----SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            N+   Q  E +     SF   S S  +CP  C    C N ++ C   GLT IP  LP                                 I++I ++   +  I P +FS    L  +DLS N+++++ P  F+ L +L  L L GN   +   S F+       ++ + + +NC L++  F  L      L  L L  N LQTI          +  + L  N F C DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  246 NVAEVQKREFVCSGHQSFMAPSCSVLHCPAAC---TCSNNIVDCRGKGLTEIPTNLPET-------------------------------ITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINC-LRVDAFQDLH----NLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFIC-DCHLKWLADYLHTN------------PIETSGARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 2 Score: 53.9138 bits (128), Expect = 3.249e-6
Identity = 41/120 (34.17%), Postives = 63/120 (52.50%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGN 470
            CP  C    C + V+ CS  GL  +P  +P +V  + L    F+    L    +S+Y      ++ I + + R+  ++ +SFS++  L  L LSYNRL  I PRTF+ L +L+ L L GN
Sbjct:  727 CPTEC---TCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFT----LVPKELSNYK----HLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGN 835          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6WRI0|IGS10_HUMAN (Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.912e-6
Identity = 79/306 (25.82%), Postives = 120/306 (39.22%), Query Frame = 3
Query:   33 MNIKLTQIWELLL-FVLTSFFHKSSSFNCPNFCNKDACDNGV-LSCSKSGLTSIPNVLPPNVDN--------VQLINQDFSQAGELTYANISSYG----PPKF-----KISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLN-LKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKS 890
            M +K   I  LL+ F +           CP  C   AC     + C+   LTSIP+ +PPNV+         V+L+  DFS   +L    + S G    P K       +  + + + ++  +  ++F  L  L  L + +N +  I P  F  LN L+ + L+GN   K H  +F             SL  L        I  +K L LS N L ++          L  L L  N + C DC LKWL+  +  +        ++S    +  P C  P     + L  +    F C  P+I S
Sbjct:    1 MKVKGRGITCLLVSFAVICLVATPGGKACPRRC---ACYMPTEVHCTFRYLTSIPDSIPPNVERINLGYNSLVRLMETDFSGLTKLELLMLHSNGIHTIPDKTFSDLQALQVLKMSYNKVRKLQKDTFYGLRSLTRLHMDHNNIEFINPEVFYGLNFLRLVHLEGNQLTKLHPDTF------------VSLSYLQIFK----ISFIKFLYLSDNFLTSLPQEMVSYMPDLDSLYLHGNPWTC-DCHLKWLSDWIQEKPDVIKCKKDRSPSSAQQCPLCMNPRTSKGKPLAMVSAAAFQCAKPTIDS 286          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|O75093|SLIT1_HUMAN (Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4)

HSP 1 Score: 53.9138 bits (128), Expect = 3.393e-6
Identity = 72/263 (27.38%), Postives = 104/263 (39.54%), Query Frame = 3
Query:  102 SSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKF----KISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHC---SSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            SS +CP  C    C NG++ C   GLT+IP  LP  +  ++L         EL    I S  P  F    K+ +I + + ++  IAP++F  L  L  L L  N++   LPR           L  N N K +C    +FQ   +++LSL    L + D      I  + K    S   +QT+                        DC LKWLA  L T              I+    +C  P  LA + + QI  ++F C
Sbjct:  278 SSGSCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL---------ELN--GIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITD-LPRGVFGGLYTLQLLLLNAN-KINCIRPDAFQD--LQNLSL----LSLYD----NKIQSLAKGTFTSLRAIQTLH---------------LAQNPFICDCNLKWLADFLRTN------------PIETSGARCASPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5P8I4L0 (PXDN-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 3.691e-60
Identity = 171/458 (37.34%), Postives = 253/458 (55.24%), Query Frame = 3
Query:   39 IKLTQIWELLLFVLTSFFHKSSS-FN-CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSK---NDYVMWYQDSK------IEDSNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWP--RFVQIDEPEST--VSPPDEI----NSN-----KGVLHIPQFSLLELLAAXXXXXXXXXXXXVCVIRYLL-----NRKENHYVQYPVII 1325
            +K+  +  +LLF+L  F  K+S+ FN CP+ C++ AC  GVL+C+  GL  IP VL      + + NQ FS +  LTY+N S+YGPP +KI KI +Q C LV IA   FSHL  L +LDLS+N L +I P TF++L+L+FLRLD N  ++FH  SF+   +  LSL +C+L  LDF     I   LKKLIL++N L  ID R+  LF  L  L+++ N FNC  C L+WL   L +R K  N S  K I       +CN P  +  + +  +D ++F C +P +K ID+ + +     L+C S+ K   +  V+W  + K      I+   +A  +++  S     + KC+I N N  ++  I+I WP  R     +  +T  VSP D I    N+N     + V +  QF+LLE++  + GTF I   +F+C+ R+L      N K+  Y+ Y   I
Sbjct:    1 MKIPFLLPMLLFIL--FLAKTSAHFNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFS-SPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCT-CNLRWLNSVLVSRKKAINLSSSKRIPNQA---QCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMTEHKNTYVPEIQSIEKASLSVLRKS--RIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGVVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAI 449          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: I1ZIL5 (Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.053e-46
Identity = 137/361 (37.95%), Postives = 192/361 (53.19%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQS-KNDYVMW---YQDSKI------EDSNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWPRFVQIDEPESTVSPPDEIN 1166
            CP  CN+ AC   +L C   GL  IP   P  +  V L NQ+F     LTY N+S YG  +  + K+TI +C L  I  E+FSHL YL+ LDLS NRL  I P TF+SL+LK L LD N NL+    SF+  +++ LS+ +C LKIL   ++K I G L  L L+ N L+ + + +D LF  L  L L+NNLFNC+ C+LKWLA TL TR K  + S + S+ +    P C  P  L    +  +    F C+ P ++ ID+K+ +     +SC S    N  V W   Y  S +      ++S   Q++I++     +    CLI N NGN +  I I WP   +        SPP+ +N
Sbjct:   35 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYP-RLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNLFNCS-CQLKWLALTLQTRTKRRDNSPKHSL-LRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVN 392          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0X3PLP8 (Ig-like domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR119428 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.156e-30
Identity = 120/376 (31.91%), Postives = 182/376 (48.40%), Query Frame = 3
Query:  135 DACDNGVLSCSKSG-LTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPII--GVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYN-------FSIEKSIQID------KVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLI-------------LSCHSQSKNDY-VMWYQDSKIEDSNRAQ----------------SNIVLHS----GKAYR--QLKCLINNPNGNISTKINIGW 1106
            + C  G +SC + G L  +PN LPP +  V LI Q F ++  L   N+SSY   + KI ++TI  C L GI P++F  L  L  LD+S N L++I  RTF  L L+ LRLD N+ L     +F+   +  LS+ NC+L+ L F  L+P+I  G L  L L+ N L T+++R + LF  L  L L  N F C DC L WL+K L  + ++            E S+  D      +++P C  P  L ER L  + +++F C  P +++++L ++  +  I             L C +Q   +  V WY+ ++  DS +                  + IVLH     G +    QL C   +  GNIS  + + W
Sbjct:   38 EGCLYGSVSCQEPGRLQMVPNDLPPGIRKVILIGQRF-KSRYLQRQNLSSYSTSRVKIVELTIMDCGLQGIEPQTFQGLTNLTKLDVSKNALSRIHRRTFAGLRLELLRLDDNLGLSLSPGAFENLSVSSLSIQNCNLRSLTFKDLEPLIRTGTLSTLRLTGNSLTTLETRLEPLFLSLKALSLSQNPFRC-DCELVWLSKMLQRKHQDEEQDMPPVPSGFENSLVNDDFTVSTEIYPVCASPPRLYERKLLGLTDEDFFCAPPQLRALELDLKGQQHAINSAGDSAGGAVARLKCIAQGSPELRVGWYRRTQRSDSKQGANFLESLLATQVVSPGVAEIVLHQPTSDGGSLEDDQLTCFGTDTYGNISADVTLSW 411          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183T4Y2 (Ig-like domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS11530 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 9.635e-29
Identity = 114/358 (31.84%), Postives = 174/358 (48.60%), Query Frame = 3
Query:  186 IPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPII--GVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSI-------EKSIQID------KVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLI-------------LSCHSQSKNDY-VMWYQDSKIEDSNRAQ----------------SNIVLHS----GKAYR--QLKCLINNPNGNISTKINIGW 1106
            +PN LPP +  V LI Q F ++  L   N+SSY   + KI ++TI  C L GI P++F  L  L  LD+S N L++I  RTF  L L+ LRLD N+ L     +F+   +  LS+ NC+L+ L F  L+P+I  G L  L L+ N L T+++R + LF  L  L L  N F C DC L WL+K L  + ++    +       E S+  D      +++P C  P  L ER L  + +++F C  P +++++L ++  +  I             L C +Q   +  V WY+ ++  DS +                  + IVLH     G +    QL C   +  GNIS  + + W
Sbjct:    2 VPNDLPPGIRKVILIGQRF-KSRYLQRQNLSSYSTSRVKIVELTIMDCGLQGIEPQTFQGLTNLTKLDVSKNALSRIHRRTFAGLRLELLRLDDNLGLSLSPGAFENLSVSSLSIQNCNLRSLTFKDLEPLIRTGTLSTLRLTGNSLTTLETRLEPLFLSLKALSLSQNPFRC-DCELVWLSKMLQRKHQDEEQDMPPVPSGFENSLVNDDFTVSTEIYPVCASPPRLYERKLLGLTDEDFFCAPPQLRALELDLKGQQHAINSAGDSAGGAVARLKCIAQGSPELRVGWYRRTQRSDSKQGANFLESLLATQVVSPGVAEIVLHQPTSDGGSLEDDQLTCFGTDTYGNISADVTLSW 357          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183LHT3 (LRRCT domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS3358 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 2.602e-28
Identity = 111/331 (33.53%), Postives = 162/331 (48.94%), Query Frame = 3
Query:   63 LLLFV-LTSFFHKSSSFNCPNFC-NK--DACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGV--LKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTR--------FKNYNFSIEK--------------------SIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSKN 953
            LL FV L S F   SS N  + C NK    C  G LSC + GLT +P+ L  ++ ++ ++   F+    LT  N S Y     K+ ++T+++C +  I P +F  L  L+ LDLS NR+  IL  TFE L+L FLRLD N  L     +FQ + I  LS+  C LKIL +  L P+I    LK L LS N L T++SR + +F  L  L L+ N F C DC+L WL   L+ R           +N  I+                      +  D + P C+ P  L  R +  +   +F C TP ++ I++   ++ +L    H+Q+ N
Sbjct:    7 LLFFVILQSIFQTISSLNSNDLCLNKTCSGCIAGSLSCQEGGLTHLPDRLSSDIQSMIMMGHKFNNP-TLTSDNFSIYIQQNVKLQRLTLRNCGIQSIQPRTFQSLKGLQQLDLSQNRIKTILEGTFEGLHLDFLRLDENFGLSIEDGAFQDTSIVSLSMNQCGLKILSYNVLLPLINSKQLKNLHLSGNQLITLESRLEPIFLHLQSLSLEQNPFYC-DCKLSWLVSVLNRRQVQRRTRGLSMFNGDIDDVETNLLHKSNSLMEMNQHNTPLDGDLLKPLCHNPRRLIGRSIESLTASDFYCGTPKLQVIEV---DLGQLTTFYHNQNNN 332          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 55.4546 bits (132), Expect = 1.579e-7
Identity = 68/269 (25.28%), Postives = 118/269 (43.87%), Query Frame = 3
Query:  114 CPNFCNKDACDN-GVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-SIIRHLSLVNCSLKIL---DFCTLKPI----IGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKS 890
            CP  C   AC     + C+   L ++P  +P  V+ + L     ++  + ++A +        K+  + +    +  I   +F  L  L+++ +SYN+L  I   TF+ L NL  L LD N     H  +FQ  + +R L L    L+ L    F TL  +    +  LK L LS N L ++  +       L  L L  N + C DCR+KW      +         ++++   ++ P C+ P  L ++ L ++D    +C +P I +
Sbjct:   29 CPRPC---ACPQPKEVHCTFRSLLTVPAGVPKQVERMNLGFNTMNRITDSSFAGMR-------KLELLMMHGNDIHNIPNGAFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPVSTLKHLYLSENGLTSLSQKMLAGMPHLENLFLHENPWVC-DCRMKWFRDWSKSAPGVLKCKKDRALAGGQLCPMCSSPKHLKKKDLQELDNP--TCSSPVISA 284          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 55.4546 bits (132), Expect = 1.619e-7
Identity = 68/269 (25.28%), Postives = 118/269 (43.87%), Query Frame = 3
Query:  114 CPNFCNKDACDN-GVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-SIIRHLSLVNCSLKIL---DFCTLKPI----IGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKS 890
            CP  C   AC     + C+   L ++P  +P  V+ + L     ++  + ++A +        K+  + +    +  I   +F  L  L+++ +SYN+L  I   TF+ L NL  L LD N     H  +FQ  + +R L L    L+ L    F TL  +    +  LK L LS N L ++  +       L  L L  N + C DCR+KW      +         ++++   ++ P C+ P  L ++ L ++D    +C +P I +
Sbjct:   29 CPRPC---ACPQPKEVHCTFRSLLTVPAGVPKQVERMNLGFNTMNRITDSSFAGMR-------KLELLMMHGNDIHNIPNGAFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPVSTLKHLYLSENGLTSLSQKMLAGMPHLENLFLHENPWVC-DCRMKWFRDWSKSAPGVLKCKKDRALAGGQLCPMCSSPKHLKKKDLQELDNP--TCSSPVISA 284          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 55.0694 bits (131), Expect = 2.020e-7
Identity = 68/269 (25.28%), Postives = 118/269 (43.87%), Query Frame = 3
Query:  114 CPNFCNKDACDN-GVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQK-SIIRHLSLVNCSLKIL---DFCTLKPI----IGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKS 890
            CP  C   AC     + C+   L ++P  +P  V+ + L     ++  + ++A +        K+  + +    +  I   +F  L  L+++ +SYN+L  I   TF+ L NL  L LD N     H  +FQ  + +R L L    L+ L    F TL  +    +  LK L LS N L ++  +       L  L L  N + C DCR+KW      +         ++++   ++ P C+ P  L ++ L ++D    +C +P I +
Sbjct:   21 CPRPC---ACPQPKEVHCTFRSLLTVPAGVPKQVERMNLGFNTMNRITDSSFAGMR-------KLELLMMHGNDIHNIPNGAFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPVSTLKHLYLSENGLTSLSQKMLAGMPHLENLFLHENPWVC-DCRMKWFRDWSKSAPGVLKCKKDRALAGGQLCPMCSSPKHLKKKDLQELDNP--TCSSPVISA 276          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: slit1a (slit homolog 1a (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030722-3])

HSP 1 Score: 52.373 bits (124), Expect = 1.054e-6
Identity = 67/259 (25.87%), Postives = 106/259 (40.93%), Query Frame = 3
Query:  102 SSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHC---SSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
            ++ +CP  C    C N ++ C   GLT+IP  LP N+  ++L            ++       P  K+ +I + + ++  IAP++F  L  L  L L  N++ ++    F+ L    L L      K HC   ++FQ   +++LSL                      L L  N +QT+          +  L L  N F C DC LKWLA  L            +S  I+    +C  P  LA + + QI  ++F C
Sbjct:  251 AAGSCPAMC---TCSNNIVDCRGKGLTAIPANLPDNMAEIRLEQNGIKSVPPGAFS-------PYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITELPKGVFDGLYALQLLL--LNANKIHCVRANTFQD--LQNLSL----------------------LSLYDNKIQTLAKGTFASLRAIQTLHLAQNPFIC-DCNLKWLADYL------------RSNPIETSGARCASPRRLANKRIGQIKSKKFRC 460          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: aspn (asporin [Source:NCBI gene;Acc:103022364])

HSP 1 Score: 48.9062 bits (115), Expect = 6.969e-6
Identity = 31/115 (26.96%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  111 NCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQI---LPRTFESLNL 446
            +CP  C    C   V+ CS  GLT++P  +P +   + L N D ++  E  +  +++       +  + + + R+  I P++F +++ L++L LSYN L Q+   LP+    L +
Sbjct:   62 DCPFGC---TCSKRVVQCSDLGLTAVPREIPADTLMIDLQNNDITEIKEDDFKGLNT-------LYAMFLVNNRISKIHPKAFQNMDKLQLLYLSYNLLTQVPENLPKNVLELRI 166          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lingo4b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 [Source:NCBI gene;Acc:101164675])

HSP 1 Score: 56.9954 bits (136), Expect = 3.350e-8
Identity = 77/317 (24.29%), Postives = 120/317 (37.85%), Query Frame = 3
Query:  303 ISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTF-ESLNLKFLRLDGNVNLKFHCSSFQK-SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQE----FSCRTPSI---KSIDLKIENIEKLILSCHSQSKN-DYVMWYQDSKIEDSNRAQSNIVLHSGKAYR--------QLKCLINNPNGNISTKINI---GWPR------FVQIDEPESTVSPPDEINSN 1172
            ++ +TI  C L  +   +  HL YL  LDLSYN +  I      + L L+ L L G   L+    +F+  S  R L++ +  L  L+       +G L+ L L  N L                           DCRL W+ +    R +  NF        D   P C+ P  + +R      E+E    F+CR   I   +  + ++E    ++ SC +       + W    K   S   +  ++ +     R          +CL  N  GN S  + +   G PR      F++    ES V PPD  N+N
Sbjct:  251 LTSLTISSCNLTAVPYAALRHLVYLRFLDLSYNPITVIQGNLLGDLLRLQELHLAGASLLRIEPGAFKGLSFFRMLNVTSNMLTTLEESAFHS-VGNLQVLRLDGNPL-------------------------ACDCRLLWVMR----RRQRLNF--------DGHQPTCSSPDAVQQREFRDFSEKELVRLFTCRPARIMDRRPQEARVEEGTTVLFSCKADGDPFPTITWISSHKNTVSPTGRIRVLPNGTLEVRFAQVQDSGTYQCLAVNAAGNDSMSVGLYVKGVPRNKTTPFFLE----ESWVEPPDLQNAN 525          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lingo4b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 [Source:NCBI gene;Acc:101164675])

HSP 1 Score: 56.9954 bits (136), Expect = 3.350e-8
Identity = 77/317 (24.29%), Postives = 120/317 (37.85%), Query Frame = 3
Query:  303 ISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTF-ESLNLKFLRLDGNVNLKFHCSSFQK-SIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQE----FSCRTPSI---KSIDLKIENIEKLILSCHSQSKN-DYVMWYQDSKIEDSNRAQSNIVLHSGKAYR--------QLKCLINNPNGNISTKINI---GWPR------FVQIDEPESTVSPPDEINSN 1172
            ++ +TI  C L  +   +  HL YL  LDLSYN +  I      + L L+ L L G   L+    +F+  S  R L++ +  L  L+       +G L+ L L  N L                           DCRL W+ +    R +  NF        D   P C+ P  + +R      E+E    F+CR   I   +  + ++E    ++ SC +       + W    K   S   +  ++ +     R          +CL  N  GN S  + +   G PR      F++    ES V PPD  N+N
Sbjct:  251 LTSLTISSCNLTAVPYAALRHLVYLRFLDLSYNPITVIQGNLLGDLLRLQELHLAGASLLRIEPGAFKGLSFFRMLNVTSNMLTTLEESAFHS-VGNLQVLRLDGNPL-------------------------ACDCRLLWVMR----RRQRLNF--------DGHQPTCSSPDAVQQREFRDFSEKELVRLFTCRPARIMDRRPQEARVEEGTTVLFSCKADGDPFPTITWISSHKNTVSPTGRIRVLPNGTLEVRFAQVQDSGTYQCLAVNAAGNDSMSVGLYVKGVPRNKTTPFFLE----ESWVEPPDLQNAN 525          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: slit1a (slit guidance ligand 1 [Source:NCBI gene;Acc:101164917])

HSP 1 Score: 51.9878 bits (123), Expect = 1.544e-6
Identity = 77/287 (26.83%), Postives = 117/287 (40.77%), Query Frame = 3
Query:  102 SSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKF----KISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHC---SSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHS 941
               +CP  C    C N ++ C   GLT+IP  LP N+  ++L      Q G      I S  P  F    K+ +I + + ++  IAP++F  L  L  L L  N++  +    F+ L    L L      K HC   ++FQ   +++LSL                      L L  N +QT+          +  L L  N F C DC LKWLA  L            +S  I+    +C  P  LA + + QI  ++F C    +    L  E++ +L  +C+S
Sbjct:  280 GGGSCPAMC---TCSNNIVDCRGKGLTAIPANLPDNMAEIRL-----EQNG------IKSVPPGAFSSYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFDGLYALQLLL--LNANKIHCIRANTFQD--LQNLSL----------------------LSLYDNKIQTLAKGTFTSLRAIQTLHLAQNPFIC-DCNLKWLADYL------------RSNPIETSGARCASPRRLANKRIGQIKSKKFRCSGSILTFSPLGTEDV-RLNDACNS 512          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: slit1a (slit guidance ligand 1 [Source:NCBI gene;Acc:101164917])

HSP 1 Score: 51.2174 bits (121), Expect = 2.836e-6
Identity = 72/263 (27.38%), Postives = 106/263 (40.30%), Query Frame = 3
Query:  102 SSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKF----KISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHC---SSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSC 869
               +CP  C    C N ++ C   GLT+IP  LP N+  ++L      Q G      I S  P  F    K+ +I + + ++  IAP++F  L  L  L L  N++  +    F+ L    L L      K HC   ++FQ   +++LSL                      L L  N +QT+          +  L L  N F C DC LKWLA  L            +S  I+    +C  P  LA + + QI  ++F C
Sbjct:  280 GGGSCPAMC---TCSNNIVDCRGKGLTAIPANLPDNMAEIRL-----EQNG------IKSVPPGAFSSYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFDGLYALQLLL--LNANKIHCIRANTFQD--LQNLSL----------------------LSLYDNKIQTLAKGTFTSLRAIQTLHLAQNPFIC-DCNLKWLADYL------------RSNPIETSGARCASPRRLANKRIGQIKSKKFRC 489          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrit2 (leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 [Source:NCBI gene;Acc:101156762])

HSP 1 Score: 50.447 bits (119), Expect = 3.343e-6
Identity = 64/244 (26.23%), Postives = 107/244 (43.85%), Query Frame = 3
Query:  303 ISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESL-NLKFLRLDGNVNLKFHCSSFQKS-IIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLL-----------------QTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIEN--IEKLILSCHSQSKNDYVMWY 971
            ++KI I+      I   +FS    LE L L++N +  I  +  E L NL  LRL GN       ++F+ + +++ L L +  L +L    LK + G L  L LS N L                 Q ++ R        +VL L +N + C DCRLK         F  +  S+   I +   +  C+ P F A +F H+I+ Q  +C  P++ +    +       + L C ++++ D  +W+
Sbjct:   57 LTKIRIEKSHFTEIPRGAFSITKLLENLWLNFNDITVINSKGLEGLGNLSELRLQGNKLRSVPWTAFEDTPVLKILDLKHNQLDVLPEHALKFLPG-LTYLDLSFNRLTVISKEVFQNWPLYQKLQNMEEREAMASGPNVVLALHDNAWLC-DCRLK--------GFVEFILSLSPPIILMNSYLTCSGPDFKAGKFFHEIELQ--ACVKPAVTTTTANVSRPLGSNVTLQCVAKARPDPAVWW 288          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000025920.1 (SMESG000025920.1)

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 494/498 (99.20%), Postives = 496/498 (99.60%), Query Frame = 3
Query:   33 MNIKLTQIWELLLFVLTSFFHKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSKNDYVMWYQDSKIEDSNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWPRFVQIDEPESTVSPPDEINSNKGVLHIPQFSLLELLAAXXXXXXXXXXXXVCVIRYLLNRKENHYVQYPVIIDCNKYINKSSLIDHNNLTINATYPECELIRYDVSSSTSFCNSQTYDVPVYPNSVFIDFKTHQQIHTT 1526
            MNIKLTQIWELLLFVLTSFFHKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTY+NISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGN+NLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYDFLFNRLLVLRLDNNLFNCADCRLKWLAKTLSTRFKNYNFSIEK IQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSKNDYVMWYQDSKIEDSNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWPRFVQIDEPESTVSPPDE NSNKGVLHIPQFSLLELLAAIFGTFMIFFFIFVCVIRYLLNRKENHYVQYPVIIDCNKYINKSSLIDHNNLTINATYPECELIRYDVSSSTSFCNSQTYDVPVYPNSVFIDFKTHQQIHTT
Sbjct:    1 MNIKLTQIWELLLFVLTSFFHKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYSNISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNMNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYDFLFNRLLVLRLDNNLFNCADCRLKWLAKTLSTRFKNYNFSIEKKIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSKNDYVMWYQDSKIEDSNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWPRFVQIDEPESTVSPPDETNSNKGVLHIPQFSLLELLAAIFGTFMIFFFIFVCVIRYLLNRKENHYVQYPVIIDCNKYINKSSLIDHNNLTINATYPECELIRYDVSSSTSFCNSQTYDVPVYPNSVFIDFKTHQQIHTT 498          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000001734.1 (SMESG000001734.1)

HSP 1 Score: 252.292 bits (643), Expect = 3.518e-77
Identity = 182/511 (35.62%), Postives = 279/511 (54.60%), Query Frame = 3
Query:   87 FFHKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTL-STRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKI--ENIEKLILSCHSQSKNDYVMWYQDSKIED-------------SNRAQSN-IVLHSGKAYRQLKCLINNPNGNI-STKINIGWPR----FVQIDEPESTV-----SPPDEINSNKGVLHIPQFSLLELLAAXXXXXXXXXXXXVCVIRYLLNRKENHYVQYPVIIDCNKYINKSSLIDHNNLTINATYPECELIRYDVSSSTSFCNSQTYDVPVYPNSV-----FIDFKTHQQIHT 1523
            F H +    CP  CN+ AC+ G+L+CS++GL+ IP ++PP  + + LINQDFS+AG LT  N+S Y   K KI+KITIQ+C L  I   +FS + YLE LDLS+N+L ++ P TF  LNLKFLRLDGN+NLK   +SF++  +  LSL+ C L  L F  L+PI   L +LIL+SN   T++SRY+ LF RL    LD+N F+C+ C L W+A T+ S  +KN N       Q   ++PKC++P  L ++F+H +   +F C  PSI+ I + I   N  +LI  C +      V+W Q  +  D             SN A SN +V++  +      C + +  GN  ST++ I WP+    F  ++     V     +P       K     PQFSL+E+++ + GTF+    +F+ ++R +  R               +  +K+S +  + L++ ++  + +  +Y       + +SQTYD+P  P +      FIDFKT Q +++
Sbjct:   30 FSHDNKKIICPPVCNQMACNMGILTCSETGLSEIPKLIPPKTNKILLINQDFSEAGTLTRLNLSDYSSKKHKITKITIQNCSLQAIESRAFSQIIYLETLDLSFNKLTELEPFTFADLNLKFLRLDGNLNLKLTANSFKELRVDSLSLLGCHLSHLPFTVLEPISTGLIQLILTSNRFTTLESRYETLFQRLSRFGLDDNRFDCSQCSLIWMANTMKSIYYKNQN-----KDQQTIIYPKCHQPYKLKDKFIHSLSSSDFQCPKPSIEKISIFILPNNTAQLI--CTASDVQSSVIWSQVFEPNDKDFLLIEQRKQILSNSAHSNKLVINKNQDIDVFLCTVTSLIGNASSTRLQISWPKYKTQFRLLNNSHRNVWNDPLTPMPGEKYPKNYFFQPQFSLIEMISGVVGTFIATLIVFITMLRCIFYRI--------------RLFSKNSQLRDHQLSLTSSKKD-KRKQYMTYEPPVYSDSQTYDIPTLPVNQSTLGHFIDFKTQQTLYS 518          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000026559.1 (SMESG000026559.1)

HSP 1 Score: 216.468 bits (550), Expect = 7.989e-64
Identity = 170/458 (37.12%), Postives = 252/458 (55.02%), Query Frame = 3
Query:   39 IKLTQIWELLLFVLTSFFHKSSSFN--CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSK---NDYVMWYQDSK------IEDSNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWP--RFVQIDEPEST--VSPPDEI----NSN-----KGVLHIPQFSLLELLAAXXXXXXXXXXXXVCVIRYLL-----NRKENHYVQYPVII 1325
            +K+  +  +LLF+L  F  K+S+ +  CP+ C++ AC  GVL+C+  GL  IP VL      + + NQ FS +  LTY+N S+YGPP +KI KI +Q C LV IA   FSHL  L +LDLS+N L +I P TF++L+L+FLRLD N  ++FH  SF+   +  LSL +C+L  LDF     I   LKKLIL++N L  ID R+  LF  L  L+++ N FNC  C L+WL   L +R K  N S  K I       +CN P  +  + +  +D ++F C +P +K ID+ + +     L+C S+ K   +  V+W  + +      I+ S  A  +++  S     + KC+I N N  ++  I+I WP  R     +  +T  VSP D I    N+N     + V +  QF+LLE++  I GTF I   +F+C+ R+L      N K+  Y+ Y   I
Sbjct:    1 MKIPFLLPMLLFIL--FLAKTSAHSNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFS-SPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCT-CNLRWLNSVLVSRKKAINLSSSKRIPNQA---QCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNTYVPEIQSSENASLSVLRKS--RIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAI 449          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000026986.1 (SMESG000026986.1)

HSP 1 Score: 190.274 bits (482), Expect = 4.467e-54
Identity = 129/359 (35.93%), Postives = 194/359 (54.04%), Query Frame = 3
Query:   66 LLFVLTSFF-HKSSSFNCPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQSKNDYVMW-------YQDSKIED--SNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWPR 1112
              F+L  F  ++S   NCP  CN+++C  G L C   GL  IP   PP    V + NQ F     L Y N+S YG  +  +  +TIQ+C L  I  ESFSHL +L  +DLS+N+L  I PRTF++LNLK L+L+GN  LK   +SFQ  ++  LSL NC L  L+F ++K I G L +  LS N L++++ R+  LF RL  ++L  N   C DCR+KWL + L ++ ++   SIE  I       KC++P  +  + + Q++E +F C  P++K+I + I     ++    S + +  V W       Y   K+ED       ++I ++         C++ N NGN+S  +NI WP 
Sbjct:    4 FFFILIIFLSYRSIQANCPVLCNQNSCTYGFLFCVDIGLEMIPENPPPKTTQVIVKNQIFKNP-ILGYKNLSRYGTEEILLKVLTIQNCGLTEIESESFSHLVHLMEMDLSFNQLQMIYPRTFKALNLKSLKLNGNRLLKLTGNSFQGLVVSSLSLANCGLDSLEFDSIKEIAGHLIRFDLSQNDLKSLNFRFYLLFKRLEEIQLGGNQLKC-DCRIKWLNRILKSKNQS-KASIESLI-------KCSQPYEIRGKAISQLEESQFLCSKPNLKAISVDISTRSAILYCSSSPNSDTQVSWHLRNAVNYSLHKLEDLIETPFNASIKVNKNSQSDMFSCIVKNENGNVSVDLNIKWPE 352          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000033458.1 (SMESG000033458.1)

HSP 1 Score: 179.874 bits (455), Expect = 5.235e-50
Identity = 136/361 (37.67%), Postives = 191/361 (52.91%), Query Frame = 3
Query:  114 CPNFCNKDACDNGVLSCSKSGLTSIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCRLVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLKFHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTIDSRYXXXXXXXXXXXXXXXXXXCADCRLKWLAKTLSTRFKNYNFSIEKSIQIDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILSCHSQS-KNDYVMW---YQDSKI------EDSNRAQSNIVLHSGKAYRQLKCLINNPNGNISTKINIGWPRFVQIDEPESTVSPPDEIN 1166
            CP  CN+ AC   +L C   GL  IP   P  +  V L NQ+F     LTY N+S YG  +  + K+TI +C L  I  E+FSHL YL+ LDLS NRL  I P TF+SL+LK L LD N NL+    SF+  +++ LS+ +C LKIL   ++K I G L  L L+ N L+ + + +D LF  L  L L+NN FNC+ C+LKWLA TL TR K  + S + S+ +    P C  P  L    +  +    F C+ P ++ ID+K+ +     +SC S    N  V W   Y  S +      ++S   Q++I++     +    CLI N NGN +  I I WP   +        SPP+ +N
Sbjct:   35 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYP-RLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCS-CQLKWLALTLQTRTKRRDNSPKHSL-LRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGLNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPIKSPPNTVN 392          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLIT15.283e-727.38slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT25.555e-726.67slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT25.995e-726.67slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT26.008e-734.17slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
IGSF106.064e-725.82immunoglobulin superfamily member 10 [Source:HGNC ... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pxn-16.003e-723.58Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
slt-14.532e-630.83Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sli2.952e-728.02gene:FBgn0264089 transcript:FBtr0330734[more]
sli8.091e-728.02gene:FBgn0264089 transcript:FBtr0330733[more]
sli8.091e-728.02gene:FBgn0264089 transcript:FBtr0330731[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aspn2.687e-731.30asporin (LRR class 1) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
aspn2.687e-731.30asporin (LRR class 1) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
mxra5a3.468e-725.95matrix-remodelling associated 5a [Source:ZFIN;Acc:... [more]
mxra5b4.054e-727.04matrix-remodelling associated 5b [Source:ZFIN;Acc:... [more]
mxra5b4.605e-727.04matrix-remodelling associated 5b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nedd41.054e-825.41NEDD4 E3 ubiquitin protein ligase [Source:Xenbase;... [more]
atad3a9.482e-725.81ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a9.815e-725.81ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a1.080e-625.81ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a1.128e-625.81ATPase family, AAA domain containing 3A [Source:Xe... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slit21.463e-734.17slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit21.870e-726.67slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit22.730e-722.73slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit22.853e-722.73slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit22.947e-722.73slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R1B9|SLIT2_MOUSE1.308e-626.67Slit homolog 2 protein OS=Mus musculus OX=10090 GN... [more]
sp|O88279|SLIT1_RAT1.554e-627.38Slit homolog 1 protein OS=Rattus norvegicus OX=101... [more]
sp|O94813|SLIT2_HUMAN2.667e-626.67Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=... [more]
sp|Q6WRI0|IGS10_HUMAN2.912e-625.82Immunoglobulin superfamily member 10 OS=Homo sapie... [more]
sp|O75093|SLIT1_HUMAN3.393e-627.38Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4L03.691e-6037.34PXDN-like protein OS=Schmidtea mediterranea OX=793... [more]
I1ZIL51.053e-4637.95Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A0X3PLP85.156e-3031.91Ig-like domain-containing protein OS=Schistocephal... [more]
A0A183T4Y29.635e-2931.84Ig-like domain-containing protein OS=Schistocephal... [more]
A0A183LHT32.602e-2833.53LRRCT domain-containing protein OS=Schistosoma mar... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxra5a1.579e-725.28matrix-remodeling-associated protein 5 [Source:NCB... [more]
mxra5a1.619e-725.28matrix-remodeling-associated protein 5 [Source:NCB... [more]
mxra5a2.020e-725.28matrix-remodeling-associated protein 5 [Source:NCB... [more]
slit1a1.054e-625.87slit homolog 1a (Drosophila) [Source:ZFIN;Acc:ZDB-... [more]
aspn6.969e-626.96asporin [Source:NCBI gene;Acc:103022364][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lingo4b3.350e-824.29leucine-rich repeat and immunoglobulin-like domain... [more]
lingo4b3.350e-824.29leucine-rich repeat and immunoglobulin-like domain... [more]
slit1a1.544e-626.83slit guidance ligand 1 [Source:NCBI gene;Acc:10116... [more]
slit1a2.836e-627.38slit guidance ligand 1 [Source:NCBI gene;Acc:10116... [more]
lrit23.343e-626.23leucine-rich repeat, immunoglobulin-like domain an... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025920.10.000e+099.20SMESG000025920.1[more]
SMESG000001734.13.518e-7735.62SMESG000001734.1[more]
SMESG000026559.17.989e-6437.12SMESG000026559.1[more]
SMESG000026986.14.467e-5435.93SMESG000026986.1[more]
SMESG000033458.15.235e-5037.67SMESG000033458.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015451 ID=SMED30015451|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1584bp
CTTGAAATTCGTGGAAAATTTACAATGATATAATGAATATTAAGCTCACA
CAAATATGGGAGCTATTACTATTTGTGTTAACTTCCTTTTTTCACAAATC
AAGTTCTTTCAATTGCCCGAATTTCTGTAACAAGGACGCATGTGACAATG
GAGTTCTTAGTTGCTCAAAATCAGGTCTCACATCCATTCCCAATGTGCTG
CCTCCGAATGTCGATAATGTCCAGTTAATCAATCAGGATTTCAGTCAAGC
CGGTGAATTGACATATGCAAACATTTCCAGTTACGGCCCCCCAAAATTCA
AAATCTCAAAGATCACCATACAACATTGCCGATTAGTCGGTATAGCGCCC
GAGTCTTTTTCTCACTTGAATTACTTGGAAATTCTCGATTTGTCCTACAA
TCGACTCGCACAAATTCTTCCTCGGACTTTTGAGTCGCTCAATTTGAAAT
TTTTACGCTTGGACGGCAACGTGAATTTGAAATTTCACTGCTCCTCATTC
CAAAAATCAATAATCCGACATCTTTCATTGGTAAATTGTTCTTTGAAAAT
TTTAGACTTTTGCACACTGAAACCGATAATTGGGGTGCTGAAAAAATTAA
TCTTATCGAGTAACTTATTGCAAACTATAGATTCCCGCTATGATTTCCTA
TTCAACAGATTACTGGTATTGCGATTGGATAATAATTTGTTTAACTGTGC
TGATTGCCGACTGAAATGGTTGGCTAAAACCCTGTCAACGAGATTTAAAA
ATTACAATTTTTCAATCGAGAAAAGCATTCAAATCGACAAAGTTTTCCCG
AAATGCAACAGGCCGACGTTTCTTGCTGAAAGATTCCTTCATCAAATTGA
TGAACAGGAGTTCTCGTGCCGAACTCCGTCCATAAAGTCGATAGATTTAA
AAATTGAAAACATTGAAAAGTTGATTCTCTCCTGTCACTCGCAATCGAAA
AATGATTACGTCATGTGGTACCAAGACTCGAAAATCGAGGATTCTAATCG
AGCTCAATCAAACATCGTCTTGCACAGCGGCAAAGCCTACAGACAACTGA
AGTGTCTCATCAATAATCCAAACGGAAACATTTCCACAAAAATCAACATC
GGCTGGCCGAGATTCGTCCAGATTGATGAGCCAGAGTCAACCGTGTCCCC
GCCAGACGAAATCAATTCAAACAAAGGCGTTCTTCATATTCCACAGTTTT
CGTTGCTTGAATTACTCGCAGCGATTTTTGGAACTTTCATGATTTTCTTC
TTTATTTTTGTCTGTGTTATCCGGTACTTATTGAACCGGAAAGAGAATCA
TTATGTGCAATATCCAGTGATTATCGACTGCAACAAATACATCAATAAAT
CGTCACTGATTGACCATAACAATCTAACAATAAATGCCACATATCCCGAA
TGTGAACTGATTAGATATGACGTTTCCAGTAGCACATCCTTTTGTAACAG
TCAAACCTATGACGTTCCCGTTTATCCCAACTCTGTGTTTATAGATTTTA
AAACTCATCAGCAAATACACACGACTTAATATTTGTTTATATATTTAAAA
AAATAAATCAAAATTAACATACAATTATGTGACA
back to top

protein sequence of SMED30015451-orf-1

>SMED30015451-orf-1 ID=SMED30015451-orf-1|Name=SMED30015451-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MNIKLTQIWELLLFVLTSFFHKSSSFNCPNFCNKDACDNGVLSCSKSGLT
SIPNVLPPNVDNVQLINQDFSQAGELTYANISSYGPPKFKISKITIQHCR
LVGIAPESFSHLNYLEILDLSYNRLAQILPRTFESLNLKFLRLDGNVNLK
FHCSSFQKSIIRHLSLVNCSLKILDFCTLKPIIGVLKKLILSSNLLQTID
SRYDFLFNRLLVLRLDNNLFNCADCRLKWLAKTLSTRFKNYNFSIEKSIQ
IDKVFPKCNRPTFLAERFLHQIDEQEFSCRTPSIKSIDLKIENIEKLILS
CHSQSKNDYVMWYQDSKIEDSNRAQSNIVLHSGKAYRQLKCLINNPNGNI
STKINIGWPRFVQIDEPESTVSPPDEINSNKGVLHIPQFSLLELLAAIFG
TFMIFFFIFVCVIRYLLNRKENHYVQYPVIIDCNKYINKSSLIDHNNLTI
NATYPECELIRYDVSSSTSFCNSQTYDVPVYPNSVFIDFKTHQQIHTT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 158..291
e-value: 2.9E-11
score: 45.2
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 25..157
e-value: 4.6E-17
score: 63.6
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 93..147
e-value: 3.6E-12
score: 45.8
NoneNo IPR availablePANTHERPTHR24366:SF116RE50361Pcoord: 75..361
NoneNo IPR availablePANTHERPTHR24366FAMILY NOT NAMEDcoord: 75..361
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.772
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 29..243
NoneNo IPR availableTMHMMTMhelixcoord: 396..418
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 283..358
score: 6.651