Signal recognition particle subunit SRP68

Overview
NameSignal recognition particle subunit SRP68
Smed IDSMED30015434
Length (bp)2055
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Signal recognition particle subunit SRP68 (SMED30015434) t-SNE clustered cells

Violin plots show distribution of expression levels for Signal recognition particle subunit SRP68 (SMED30015434) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Signal recognition particle subunit SRP68 (SMED30015434) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Signal recognition particle subunit SRP68 (SMED30015434) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015434

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30015434h1SMcG0008766 Contig46802uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015434h1SMcG0008766 Contig46802newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30015434h1SMcG0008766 dd_Smed_v4_2240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015434h1SMcG0008766 dd_Smed_v4_2240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Human
Match: SRP68 (signal recognition particle 68 [Source:HGNC Symbol;Acc:HGNC:11302])

HSP 1 Score: 117.472 bits (293), Expect = 4.174e-48
Identity = 80/251 (31.87%), Postives = 125/251 (49.80%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMD-----QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLE--TMSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVS-RPQNMARLYDTVMQNLQEMAGLPGL 855
            +   +EWK A   + K    Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     ++  +    G  +     +   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++S+L  C +A+  VR++LK   P    +   L  E   +S LQ L  YL Y+KL   ++RN          LL  +   D+  S RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  198 RFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIVQAE-SEETKERLFESMLSECRDAIQVVREELK---PDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELLQLPGL 444          

HSP 2 Score: 95.9005 bits (237), Expect = 4.174e-48
Identity = 68/201 (33.83%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+EI  K   + AYRC++++Q+++L+K+++E   L  R L++            +NE  S   +    L   P V E++  + S       E+ S +A   L   D    E + S +   D+ PL +R + F  DP+L  K   L+   P F+PIP KPLFFDLAL HV FP L     + K +     GLTG +KG I+G
Sbjct:  451 QKEIGLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKY------------ANEVNSDAGAFKNSLKDLPDVQELITQVRS-------EKCSLQAAAILDANDAHQTETSSSQV--KDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL-----EDKLEQKTKSGLTGYIKG-IFG 624          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Human
Match: SRP68 (signal recognition particle 68 [Source:HGNC Symbol;Acc:HGNC:11302])

HSP 1 Score: 117.472 bits (293), Expect = 4.353e-48
Identity = 80/251 (31.87%), Postives = 125/251 (49.80%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMD-----QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLE--TMSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVS-RPQNMARLYDTVMQNLQEMAGLPGL 855
            +   +EWK A   + K    Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     ++  +    G  +     +   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++S+L  C +A+  VR++LK   P    +   L  E   +S LQ L  YL Y+KL   ++RN          LL  +   D+  S RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  160 RFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIVQAE-SEETKERLFESMLSECRDAIQVVREELK---PDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELLQLPGL 406          

HSP 2 Score: 95.9005 bits (237), Expect = 4.353e-48
Identity = 68/201 (33.83%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+EI  K   + AYRC++++Q+++L+K+++E   L  R L++            +NE  S   +    L   P V E++  + S       E+ S +A   L   D    E + S +   D+ PL +R + F  DP+L  K   L+   P F+PIP KPLFFDLAL HV FP L     + K +     GLTG +KG I+G
Sbjct:  413 QKEIGLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKY------------ANEVNSDAGAFKNSLKDLPDVQELITQVRS-------EKCSLQAAAILDANDAHQTETSSSQV--KDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL-----EDKLEQKTKSGLTGYIKG-IFG 586          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Human
Match: SRP68 (signal recognition particle 68 [Source:HGNC Symbol;Acc:HGNC:11302])

HSP 1 Score: 96.2857 bits (238), Expect = 2.395e-29
Identity = 68/201 (33.83%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+EI  K   + AYRC++++Q+++L+K+++E   L  R L++            +NE  S   +    L   P V E++  + S       E+ S +A   L   D    E + S +   D+ PL +R + F  DP+L  K   L+   P F+PIP KPLFFDLAL HV FP L     + K +     GLTG +KG I+G
Sbjct:  112 QKEIGLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKY------------ANEVNSDAGAFKNSLKDLPDVQELITQVRS-------EKCSLQAAAILDANDAHQTETSSSQV--KDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL-----EDKLEQKTKSGLTGYIKG-IFG 285          

HSP 2 Score: 53.9138 bits (128), Expect = 2.395e-29
Identity = 40/111 (36.04%), Postives = 58/111 (52.25%), Query Frame = 1
Query:  571 LLKTCTEALNSVRDDLKGSGPSNPAQITNLSLET--MSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVS-RPQNMARLYDTVMQNLQEMAGLPGLNTE 864
            +L  C +A+  VR++LK   P    +   L  E   +S LQ L  YL Y+KL   ++RN          LL  +   D+  S RPQ++ RLYD ++QNL E+  LPGL  +
Sbjct:    1 MLSECRDAIQVVREELK---PDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELLQLPGLEED 108          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Celegans
Match: srpa-68 (Probable signal recognition particle subunit SRP68 [Source:UniProtKB/Swiss-Prot;Acc:Q20822])

HSP 1 Score: 84.3445 bits (207), Expect = 7.475e-31
Identity = 53/183 (28.96%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  867 HENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVE-DPNLSKKPNRLIQAC---PDFEPIPVKPLFFDLALFHVKFPNL 1403
            H+ N  Q  + K+  Y A+RC+Y++ ++  + +++E +AL  RT+   + A G LK + S+                   +E   ++N L   V + +++ RA R  S   D   ++ L+ I   D  PL + ++E+ + D   S K  + I      P F P+P KP+FFDLA FH+  PN+
Sbjct:  400 HDKNLIQAFEVKVEYYRAFRCFYMASSYSALHKYSEAAALFDRTVSRVQDAEGKLKKLKSS---------------SFITNETQSSLNELRSEVESAKVTVRAARLASAAGDVKTDSELAKI--IDKRPLLETVNEWRQWDVRNSLKDKKTIPVASLPPAFIPMPNKPIFFDLANFHLTMPNV 565          

HSP 2 Score: 69.707 bits (169), Expect = 7.475e-31
Identity = 56/239 (23.43%), Postives = 104/239 (43.51%), Query Frame = 1
Query:  169 KEWKKAKAMYEKAYLEYSGLAKAVDKDQ-QQIYLSKCDELKPLIRYCANN-------DGNLQETPDIASLHAAGGDMDQFNDLLKQIYKNQV-AVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGLN 858
            + W+KA    + A   Y  LA+A +      I+  +C E++P +R C  N        G + E  ++      GGD    + L+ ++  +   A +  + W G    V  E  +  +        EL +       K+A+++       +A++ + D ++     N              LQ +  YL ++K+  T  R L II+N      S+PQ++ RLYD+V++  +E+A +PG +
Sbjct:  172 RNWQKASESLKLAKTVYEKLAEATNNTTLSSIFKGRCREIQPQLRLCEFNIAESPGAVGTMTELMELRMQMGEGGD-SSVDKLISEMRASATSAEVVTIEWGGAKSTVDDEKAKQVVQEWKQTEVELAQCQTPKE-KMALFEKATADTRDAIDRISDIIRRKSSENADTTV---------LQSIKAYLEFLKMNGTASRYLAIIDNTKSEKKSKPQDLLRLYDSVIEIYKEVAEIPGAD 399          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Fly
Match: Srp68 (gene:FBgn0035947 transcript:FBtr0076517)

HSP 1 Score: 118.242 bits (295), Expect = 3.635e-40
Identity = 74/252 (29.37%), Postives = 132/252 (52.38%), Query Frame = 1
Query:  175 WKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANN------DGNLQETPDIASLHAAGGDMDQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIE---------------NNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGLNTES 867
            WK A    ++A + Y  L KA+ +D+Q++Y +K +E  P +RYCA N       G + E  ++     A G ++  + L+ Q        +  ++W G  + V+ E VRL +L+  + +K L K     +AKI + + +L  C +A+ +VRD++K     +P   +  + +T+S +Q L  YL Y++  +T++RNL ++E               N  D    RPQ++ARLY+ ++QN+ EM  + GL  ++
Sbjct:  179 WKTAGEHLKRAQVVYENLGKALPEDEQELYRAKVNEFTPNLRYCAYNISGGASGGKIDEILEL----RAQGVLENLDVLVSQTKTESSEGLQTIDWRGRKVTVRPEKVRLFLLSAQELDKSLAK-TTKQDAKIELIERILMDCKDAIQAVRDEIK----QDPKLRSLTTGQTVSGVQYLLAYLSYIRHSRTLQRNLCLVEQAKLNFYDPNLQSQQNVGDGKRVRPQDLARLYEIILQNVTEMQQINGLEDDA 421          

HSP 2 Score: 67.3958 bits (163), Expect = 3.635e-40
Identity = 47/174 (27.01%), Postives = 77/174 (44.25%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNL 1403
            Q E++     + A+RCYY++   + +K++ E  AL  R   +   A     L G +  E                 ++   +  +V  +   + S  A   L   DD   E+  +        PL +RL  + ED +L  K   + +  PD EPIP KP+FFDLA+ +V+ P+L
Sbjct:  424 QSEVENLAITFKAFRCYYIALTLIDIKKWKEAVALYERASNYATEA-----LKGKSSPEF----------------QLQEELKKVVSAIDGCKFSAHAYSVLE--DDNSEESGTTTKSQKTTKPLYERLSLYKEDQSLHTKAPNVFKLTPDMEPIPCKPIFFDLAMTYVELPSL 574          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Zebrafish
Match: srp68 (signal recognition particle 68 [Source:ZFIN;Acc:ZDB-GENE-040831-3])

HSP 1 Score: 120.939 bits (302), Expect = 3.877e-28
Identity = 81/273 (29.67%), Postives = 131/273 (47.99%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDM-----DQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSVS-----------RPQNMARLYDTVMQNLQEMAGLPGLNTE-------SMKTTPSKRYKPRY 906
            +  ++EWK A   +      Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     D+  +  + G       ++   L+ Q    Q AVM+EV W G  +P+K +  R+ +L L D    + + D N   K  +Y+SLL  C + + +VR++L+                 +S LQ L  YL Y+KL   V+RN  +  ++L T +            RPQ++ RLYD ++Q+L E++ L GL  +       S+KT   K Y+  Y
Sbjct:  165 QFELQEWKSAMEAFNNCKTIYEKLASAFTEEQAVLYHQRVEEISPNIRYCAYNIGDQNAINDLMQMRLSAGGGGGMMAEKLESLITQTRAKQAAVMSEVEWRGRTVPIKIDKARIFLLGLADNEAAITQAD-NEETKEHLYESLLAECRDTIQAVREELRTDVKQRERATDVAESSKVSNLQYLHSYLTYIKLWTVVKRNESMA-HSLQTKLKEPQTDENKRGPRPQDLIRLYDIILQSLAELSSLQGLEEDHTFQKELSLKTLVYKAYRCFY 435          

HSP 2 Score: 104.375 bits (259), Expect = 6.383e-23
Identity = 68/175 (38.86%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNL-SKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNL 1403
            Q+E+  K   Y AYRC+Y++Q+++L+K+++E   L  R L++            + E +S   S++  L   P V E++  +N       AE+ S +A   L   D A L    S     D  PL+ RLD F  D NL SK+PN L+Q  PDF+PIP KPLFFDLAL HV  P L
Sbjct:  418 QKELSLKTLVYKAYRCFYIAQSYVLVKKWSEALVLYERVLKY------------TKEVQSKAKSLSNNLKDLPDVQELIAEVN-------AEKYSLQAAAILDTEDIAELP---SQQQIKDTTPLSDRLDNFRLDSNLLSKQPN-LVQFPPDFQPIPCKPLFFDLALNHVVLPPL 569          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Zebrafish
Match: srp68 (signal recognition particle 68 [Source:ZFIN;Acc:ZDB-GENE-040831-3])

HSP 1 Score: 120.939 bits (302), Expect = 4.502e-28
Identity = 81/273 (29.67%), Postives = 131/273 (47.99%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDM-----DQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSVS-----------RPQNMARLYDTVMQNLQEMAGLPGLNTE-------SMKTTPSKRYKPRY 906
            +  ++EWK A   +      Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     D+  +  + G       ++   L+ Q    Q AVM+EV W G  +P+K +  R+ +L L D    + + D N   K  +Y+SLL  C + + +VR++L+                 +S LQ L  YL Y+KL   V+RN  +  ++L T +            RPQ++ RLYD ++Q+L E++ L GL  +       S+KT   K Y+  Y
Sbjct:  189 QFELQEWKSAMEAFNNCKTIYEKLASAFTEEQAVLYHQRVEEISPNIRYCAYNIGDQNAINDLMQMRLSAGGGGGMMAEKLESLITQTRAKQAAVMSEVEWRGRTVPIKIDKARIFLLGLADNEAAITQAD-NEETKEHLYESLLAECRDTIQAVREELRTDVKQRERATDVAESSKVSNLQYLHSYLTYIKLWTVVKRNESMA-HSLQTKLKEPQTDENKRGPRPQDLIRLYDIILQSLAELSSLQGLEEDHTFQKELSLKTLVYKAYRCFY 459          

HSP 2 Score: 104.76 bits (260), Expect = 6.730e-23
Identity = 68/175 (38.86%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNL-SKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNL 1403
            Q+E+  K   Y AYRC+Y++Q+++L+K+++E   L  R L++            + E +S   S++  L   P V E++  +N       AE+ S +A   L   D A L    S     D  PL+ RLD F  D NL SK+PN L+Q  PDF+PIP KPLFFDLAL HV  P L
Sbjct:  442 QKELSLKTLVYKAYRCFYIAQSYVLVKKWSEALVLYERVLKY------------TKEVQSKAKSLSNNLKDLPDVQELIAEVN-------AEKYSLQAAAILDTEDIAELP---SQQQIKDTTPLSDRLDNFRLDSNLLSKQPN-LVQFPPDFQPIPCKPLFFDLALNHVVLPPL 593          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Xenopus
Match: c6.2 (complement component 6, gene 2 [Source:Xenbase;Acc:XB-GENE-974694])

HSP 1 Score: 114.39 bits (285), Expect = 1.000e-48
Identity = 73/247 (29.55%), Postives = 119/247 (48.18%), Query Frame = 1
Query:  169 KEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDM-----DQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSV-------------SRPQNMARLYDTVMQNLQEMAGLPGL 855
            + W+ A   + K    Y  LA A  ++Q  +Y  + DE+ P IRYCA N G+     ++  +    G       ++   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++++L  C +A+  VR++LK       A   +     +S LQ L  YL Y+KL   + RN   + + L  ++              RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  146 QHWEDAMKAFNKCKTIYEKLASAFTEEQAVLYNQRVDEISPNIRYCAYNIGDKTAMDELMQMRLRTGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRAVPVKIDKVRIFLLGLADNEAAIAQAE-DEETKERLFETVLSECRDAIQCVREELKTEQRQRDA---DTEFGKVSNLQYLHSYLSYIKLSTAIRRN-ESMASGLQKALLQQPQAEEDGKRGPRPQDLIRLYDIILQNLAELNPLPGL 387          

HSP 2 Score: 100.908 bits (250), Expect = 1.000e-48
Identity = 71/203 (34.98%), Postives = 105/203 (51.72%), Query Frame = 3
Query:  870 ENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWI 1478
            + N Q+EI  K   Y AYRC++++Q+++L+K+++E   L  R L++ +                TG + N  L   P V E++  +N       AE+ S  A   L    D P E + S +   ++ PL+ RLD F  DP++  K   L+Q  P+F PIP KPLFFDLAL HV FP+L     + K +     GLTG  KG+ 
Sbjct:  390 DRNFQREITLKTLVYKAYRCFFIAQSYVLVKKWSEALVLYDRVLKYAKEV-----------QAQTGAAKNT-LKELPDVKELILQVN-------AEKYSLHAAAILDS-SDKPEEVSPSQV--KNNKPLSDRLDVFSLDPSVVGKHASLVQFPPNFHPIPCKPLFFDLALNHVTFPSL-----EDKLEQKAKSGLTGYFKGFF 565          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Xenopus
Match: c6.2 (complement component 6, gene 2 [Source:Xenbase;Acc:XB-GENE-974694])

HSP 1 Score: 114.39 bits (285), Expect = 1.104e-48
Identity = 73/247 (29.55%), Postives = 119/247 (48.18%), Query Frame = 1
Query:  169 KEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDM-----DQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSV-------------SRPQNMARLYDTVMQNLQEMAGLPGL 855
            + W+ A   + K    Y  LA A  ++Q  +Y  + DE+ P IRYCA N G+     ++  +    G       ++   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++++L  C +A+  VR++LK       A   +     +S LQ L  YL Y+KL   + RN   + + L  ++              RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  152 QHWEDAMKAFNKCKTIYEKLASAFTEEQAVLYNQRVDEISPNIRYCAYNIGDKTAMDELMQMRLRTGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRAVPVKIDKVRIFLLGLADNEAAIAQAE-DEETKERLFETVLSECRDAIQCVREELKTEQRQRDA---DTEFGKVSNLQYLHSYLSYIKLSTAIRRN-ESMASGLQKALLQQPQAEEDGKRGPRPQDLIRLYDIILQNLAELNPLPGL 393          

HSP 2 Score: 100.908 bits (250), Expect = 1.104e-48
Identity = 71/203 (34.98%), Postives = 105/203 (51.72%), Query Frame = 3
Query:  870 ENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWI 1478
            + N Q+EI  K   Y AYRC++++Q+++L+K+++E   L  R L++ +                TG + N  L   P V E++  +N       AE+ S  A   L    D P E + S +   ++ PL+ RLD F  DP++  K   L+Q  P+F PIP KPLFFDLAL HV FP+L     + K +     GLTG  KG+ 
Sbjct:  396 DRNFQREITLKTLVYKAYRCFFIAQSYVLVKKWSEALVLYDRVLKYAKEV-----------QAQTGAAKNT-LKELPDVKELILQVN-------AEKYSLHAAAILDS-SDKPEEVSPSQV--KNNKPLSDRLDVFSLDPSVVGKHASLVQFPPNFHPIPCKPLFFDLALNHVTFPSL-----EDKLEQKAKSGLTGYFKGFF 571          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Xenopus
Match: c6.2 (complement component 6, gene 2 [Source:Xenbase;Acc:XB-GENE-974694])

HSP 1 Score: 114.005 bits (284), Expect = 1.313e-48
Identity = 73/247 (29.55%), Postives = 119/247 (48.18%), Query Frame = 1
Query:  169 KEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDM-----DQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSV-------------SRPQNMARLYDTVMQNLQEMAGLPGL 855
            + W+ A   + K    Y  LA A  ++Q  +Y  + DE+ P IRYCA N G+     ++  +    G       ++   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++++L  C +A+  VR++LK       A   +     +S LQ L  YL Y+KL   + RN   + + L  ++              RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  183 QHWEDAMKAFNKCKTIYEKLASAFTEEQAVLYNQRVDEISPNIRYCAYNIGDKTAMDELMQMRLRTGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRAVPVKIDKVRIFLLGLADNEAAIAQAE-DEETKERLFETVLSECRDAIQCVREELKTEQRQRDA---DTEFGKVSNLQYLHSYLSYIKLSTAIRRN-ESMASGLQKALLQQPQAEEDGKRGPRPQDLIRLYDIILQNLAELNPLPGL 424          

HSP 2 Score: 100.908 bits (250), Expect = 1.313e-48
Identity = 71/203 (34.98%), Postives = 105/203 (51.72%), Query Frame = 3
Query:  870 ENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWI 1478
            + N Q+EI  K   Y AYRC++++Q+++L+K+++E   L  R L++ +                TG + N  L   P V E++  +N       AE+ S  A   L    D P E + S +   ++ PL+ RLD F  DP++  K   L+Q  P+F PIP KPLFFDLAL HV FP+L     + K +     GLTG  KG+ 
Sbjct:  427 DRNFQREITLKTLVYKAYRCFFIAQSYVLVKKWSEALVLYDRVLKYAKEV-----------QAQTGAAKNT-LKELPDVKELILQVN-------AEKYSLHAAAILDS-SDKPEEVSPSQV--KNNKPLSDRLDVFSLDPSVVGKHASLVQFPPNFHPIPCKPLFFDLALNHVTFPSL-----EDKLEQKAKSGLTGYFKGFF 602          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Xenopus
Match: c6.2 (complement component 6, gene 2 [Source:Xenbase;Acc:XB-GENE-974694])

HSP 1 Score: 114.39 bits (285), Expect = 1.381e-48
Identity = 73/247 (29.55%), Postives = 119/247 (48.18%), Query Frame = 1
Query:  169 KEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDM-----DQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSV-------------SRPQNMARLYDTVMQNLQEMAGLPGL 855
            + W+ A   + K    Y  LA A  ++Q  +Y  + DE+ P IRYCA N G+     ++  +    G       ++   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++++L  C +A+  VR++LK       A   +     +S LQ L  YL Y+KL   + RN   + + L  ++              RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  172 QHWEDAMKAFNKCKTIYEKLASAFTEEQAVLYNQRVDEISPNIRYCAYNIGDKTAMDELMQMRLRTGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRAVPVKIDKVRIFLLGLADNEAAIAQAE-DEETKERLFETVLSECRDAIQCVREELKTEQRQRDA---DTEFGKVSNLQYLHSYLSYIKLSTAIRRN-ESMASGLQKALLQQPQAEEDGKRGPRPQDLIRLYDIILQNLAELNPLPGL 413          

HSP 2 Score: 100.523 bits (249), Expect = 1.381e-48
Identity = 71/203 (34.98%), Postives = 105/203 (51.72%), Query Frame = 3
Query:  870 ENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWI 1478
            + N Q+EI  K   Y AYRC++++Q+++L+K+++E   L  R L++ +                TG + N  L   P V E++  +N       AE+ S  A   L    D P E + S +   ++ PL+ RLD F  DP++  K   L+Q  P+F PIP KPLFFDLAL HV FP+L     + K +     GLTG  KG+ 
Sbjct:  416 DRNFQREITLKTLVYKAYRCFFIAQSYVLVKKWSEALVLYDRVLKYAKEV-----------QAQTGAAKNT-LKELPDVKELILQVN-------AEKYSLHAAAILDS-SDKPEEVSPSQV--KNNKPLSDRLDVFSLDPSVVGKHASLVQFPPNFHPIPCKPLFFDLALNHVTFPSL-----EDKLEQKAKSGLTGYFKGFF 591          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Xenopus
Match: c6.2 (complement component 6, gene 2 [Source:Xenbase;Acc:XB-GENE-974694])

HSP 1 Score: 114.39 bits (285), Expect = 1.628e-48
Identity = 73/247 (29.55%), Postives = 119/247 (48.18%), Query Frame = 1
Query:  169 KEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDM-----DQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSV-------------SRPQNMARLYDTVMQNLQEMAGLPGL 855
            + W+ A   + K    Y  LA A  ++Q  +Y  + DE+ P IRYCA N G+     ++  +    G       ++   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++++L  C +A+  VR++LK       A   +     +S LQ L  YL Y+KL   + RN   + + L  ++              RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  237 QHWEDAMKAFNKCKTIYEKLASAFTEEQAVLYNQRVDEISPNIRYCAYNIGDKTAMDELMQMRLRTGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRAVPVKIDKVRIFLLGLADNEAAIAQAE-DEETKERLFETVLSECRDAIQCVREELKTEQRQRDA---DTEFGKVSNLQYLHSYLSYIKLSTAIRRN-ESMASGLQKALLQQPQAEEDGKRGPRPQDLIRLYDIILQNLAELNPLPGL 478          

HSP 2 Score: 100.138 bits (248), Expect = 1.628e-48
Identity = 71/203 (34.98%), Postives = 105/203 (51.72%), Query Frame = 3
Query:  870 ENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWI 1478
            + N Q+EI  K   Y AYRC++++Q+++L+K+++E   L  R L++ +                TG + N  L   P V E++  +N       AE+ S  A   L    D P E + S +   ++ PL+ RLD F  DP++  K   L+Q  P+F PIP KPLFFDLAL HV FP+L     + K +     GLTG  KG+ 
Sbjct:  481 DRNFQREITLKTLVYKAYRCFFIAQSYVLVKKWSEALVLYDRVLKYAKEV-----------QAQTGAAKNT-LKELPDVKELILQVN-------AEKYSLHAAAILDS-SDKPEEVSPSQV--KNNKPLSDRLDVFSLDPSVVGKHASLVQFPPNFHPIPCKPLFFDLALNHVTFPSL-----EDKLEQKAKSGLTGYFKGFF 656          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Mouse
Match: Srp68 (signal recognition particle 68 [Source:MGI Symbol;Acc:MGI:1917447])

HSP 1 Score: 122.479 bits (306), Expect = 1.239e-28
Identity = 86/272 (31.62%), Postives = 134/272 (49.26%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMD-----QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLET--MSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVS-RPQNMARLYDTVMQNLQEMAGLPGLNTE-------SMKTTPSKRYK 897
            +   +EWK A   + K    Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     ++  +    G  +     +   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++S+L  C +AL +VR++LK   P    +   L  E+  +S LQ L  YL Y+KL   + RN          LL  +   D+  S RPQ++ RLYD ++QNL E+  LPGL  +       S+KT   K Y+
Sbjct:  159 RFEHQEWKSAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIVQAE-SEETKERLFESMLSECRDALQAVREELK---PDQKQRDYALDGESGKVSNLQYLHSYLTYIKLSTAIRRNENMAKGLHRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELLQLPGLEEDRTFQKEISLKTLVFKAYR 426          

HSP 2 Score: 94.7449 bits (234), Expect = 8.342e-20
Identity = 68/201 (33.83%), Postives = 103/201 (51.24%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+EI  K   + AYRC++++Q+++L+K+++E   L  R L++            +NE  S G +    L   P V E++  + S       E+ S +A   L   D    + + S +   D+ PL +R + F  DP+L  K   L+   P F+PIP KPLFFDLAL HV FP L     + K +     GLTG +KG I+G
Sbjct:  412 QKEISLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKY------------ANEVSSHGGASKNSLKDLPDVQELITQVRS-------EKCSLQAAAILDANDSHQTDTS-SQV--KDNTPLVERFESFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL-----EDKLEQKTKSGLTGYIKG-IFG 584          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Mouse
Match: Srp68 (signal recognition particle 68 [Source:MGI Symbol;Acc:MGI:1917447])

HSP 1 Score: 122.094 bits (305), Expect = 1.621e-28
Identity = 86/272 (31.62%), Postives = 134/272 (49.26%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMD-----QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLET--MSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVS-RPQNMARLYDTVMQNLQEMAGLPGLNTE-------SMKTTPSKRYK 897
            +   +EWK A   + K    Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     ++  +    G  +     +   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++S+L  C +AL +VR++LK   P    +   L  E+  +S LQ L  YL Y+KL   + RN          LL  +   D+  S RPQ++ RLYD ++QNL E+  LPGL  +       S+KT   K Y+
Sbjct:  197 RFEHQEWKSAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIVQAE-SEETKERLFESMLSECRDALQAVREELK---PDQKQRDYALDGESGKVSNLQYLHSYLTYIKLSTAIRRNENMAKGLHRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELLQLPGLEEDRTFQKEISLKTLVFKAYR 464          

HSP 2 Score: 94.7449 bits (234), Expect = 9.794e-20
Identity = 68/201 (33.83%), Postives = 103/201 (51.24%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+EI  K   + AYRC++++Q+++L+K+++E   L  R L++            +NE  S G +    L   P V E++  + S       E+ S +A   L   D    + + S +   D+ PL +R + F  DP+L  K   L+   P F+PIP KPLFFDLAL HV FP L     + K +     GLTG +KG I+G
Sbjct:  450 QKEISLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKY------------ANEVSSHGGASKNSLKDLPDVQELITQVRS-------EKCSLQAAAILDANDSHQTDTS-SQV--KDNTPLVERFESFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL-----EDKLEQKTKSGLTGYIKG-IFG 622          
BLAST of Signal recognition particle subunit SRP68 vs. UniProt/SwissProt
Match: sp|Q9UHB9|SRP68_HUMAN (Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68 PE=1 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 1.835e-47
Identity = 80/251 (31.87%), Postives = 125/251 (49.80%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMD-----QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLE--TMSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVS-RPQNMARLYDTVMQNLQEMAGLPGL 855
            +   +EWK A   + K    Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     ++  +    G  +     +   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++S+L  C +A+  VR++LK   P    +   L  E   +S LQ L  YL Y+KL   ++RN          LL  +   D+  S RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  198 RFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIVQAE-SEETKERLFESMLSECRDAIQVVREELK---PDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELLQLPGL 444          

HSP 2 Score: 95.9005 bits (237), Expect = 1.835e-47
Identity = 68/201 (33.83%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+EI  K   + AYRC++++Q+++L+K+++E   L  R L++            +NE  S   +    L   P V E++  + S       E+ S +A   L   D    E + S +   D+ PL +R + F  DP+L  K   L+   P F+PIP KPLFFDLAL HV FP L     + K +     GLTG +KG I+G
Sbjct:  451 QKEIGLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKY------------ANEVNSDAGAFKNSLKDLPDVQELITQVRS-------EKCSLQAAAILDANDAHQTETSSSQV--KDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL-----EDKLEQKTKSGLTGYIKG-IFG 624          
BLAST of Signal recognition particle subunit SRP68 vs. UniProt/SwissProt
Match: sp|Q00004|SRP68_CANLF (Signal recognition particle subunit SRP68 OS=Canis lupus familiaris OX=9615 GN=SRP68 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 6.195e-47
Identity = 77/250 (30.80%), Postives = 122/250 (48.80%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMD-----QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLET--MSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGL 855
            +   +EWK A   + K    Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     ++  +    G  +     +   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++S+L  C +A+ +VR++LK   P    +   L  E+  +S LQ L  YL Y+KL   + RN          L     +      RPQ++ RLYD ++QNL E+  LPGL
Sbjct:  195 RFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIAQAE-SEETKERLFESMLSECRDAIQAVREELK---PDQKQRDYTLDGESGKVSNLQYLHSYLTYIKLSTAIRRNENMAKGLQKALQQQPEDESKRSPRPQDLIRLYDIILQNLVELLQLPGL 440          

HSP 2 Score: 91.6633 bits (226), Expect = 6.195e-47
Identity = 68/201 (33.83%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+EI  K   + AYRC++++Q+++L+K+++E   L  R L++            +NE  S   +    L   P V E++  + S       E+ S +A   L   D    E + S +   D+ PL +R + F  DP+L  K   L+   P F+PIP KPLFFDLAL HV FP L     + K +     GLTG +KG I+G
Sbjct:  447 QKEIGLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKY------------ANEVNSDAGAFRNSLKDLPDVQELITQVRS-------EKCSLQAAAILDASDSHQPETS-SQV--KDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL-----EDKLEQKTKSGLTGYIKG-IFG 619          
BLAST of Signal recognition particle subunit SRP68 vs. UniProt/SwissProt
Match: sp|Q9VSS2|SRP68_DROME (Signal recognition particle subunit SRP68 OS=Drosophila melanogaster OX=7227 GN=Srp68 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.781e-39
Identity = 74/252 (29.37%), Postives = 132/252 (52.38%), Query Frame = 1
Query:  175 WKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANN------DGNLQETPDIASLHAAGGDMDQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIE---------------NNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGLNTES 867
            WK A    ++A + Y  L KA+ +D+Q++Y +K +E  P +RYCA N       G + E  ++     A G ++  + L+ Q        +  ++W G  + V+ E VRL +L+  + +K L K     +AKI + + +L  C +A+ +VRD++K     +P   +  + +T+S +Q L  YL Y++  +T++RNL ++E               N  D    RPQ++ARLY+ ++QN+ EM  + GL  ++
Sbjct:  179 WKTAGEHLKRAQVVYENLGKALPEDEQELYRAKVNEFTPNLRYCAYNISGGASGGKIDEILEL----RAQGVLENLDVLVSQTKTESSEGLQTIDWRGRKVTVRPEKVRLFLLSAQELDKSLAK-TTKQDAKIELIERILMDCKDAIQAVRDEIK----QDPKLRSLTTGQTVSGVQYLLAYLSYIRHSRTLQRNLCLVEQAKLNFYDPNLQSQQNVGDGKRVRPQDLARLYEIILQNVTEMQQINGLEDDA 421          

HSP 2 Score: 67.3958 bits (163), Expect = 2.781e-39
Identity = 47/174 (27.01%), Postives = 77/174 (44.25%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNL 1403
            Q E++     + A+RCYY++   + +K++ E  AL  R   +   A     L G +  E                 ++   +  +V  +   + S  A   L   DD   E+  +        PL +RL  + ED +L  K   + +  PD EPIP KP+FFDLA+ +V+ P+L
Sbjct:  424 QSEVENLAITFKAFRCYYIALTLIDIKKWKEAVALYERASNYATEA-----LKGKSSPEF----------------QLQEELKKVVSAIDGCKFSAHAYSVLE--DDNSEESGTTTKSQKTTKPLYERLSLYKEDQSLHTKAPNVFKLTPDMEPIPCKPIFFDLAMTYVELPSL 574          
BLAST of Signal recognition particle subunit SRP68 vs. UniProt/SwissProt
Match: sp|Q20822|SRP68_CAEEL (Probable signal recognition particle subunit SRP68 OS=Caenorhabditis elegans OX=6239 GN=srpa-68 PE=3 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 7.805e-30
Identity = 53/183 (28.96%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  867 HENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVE-DPNLSKKPNRLIQAC---PDFEPIPVKPLFFDLALFHVKFPNL 1403
            H+ N  Q  + K+  Y A+RC+Y++ ++  + +++E +AL  RT+   + A G LK + S+                   +E   ++N L   V + +++ RA R  S   D   ++ L+ I   D  PL + ++E+ + D   S K  + I      P F P+P KP+FFDLA FH+  PN+
Sbjct:  400 HDKNLIQAFEVKVEYYRAFRCFYMASSYSALHKYSEAAALFDRTVSRVQDAEGKLKKLKSS---------------SFITNETQSSLNELRSEVESAKVTVRAARLASAAGDVKTDSELAKI--IDKRPLLETVNEWRQWDVRNSLKDKKTIPVASLPPAFIPMPNKPIFFDLANFHLTMPNV 565          

HSP 2 Score: 69.707 bits (169), Expect = 7.805e-30
Identity = 56/239 (23.43%), Postives = 104/239 (43.51%), Query Frame = 1
Query:  169 KEWKKAKAMYEKAYLEYSGLAKAVDKDQ-QQIYLSKCDELKPLIRYCANN-------DGNLQETPDIASLHAAGGDMDQFNDLLKQIYKNQV-AVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGLN 858
            + W+KA    + A   Y  LA+A +      I+  +C E++P +R C  N        G + E  ++      GGD    + L+ ++  +   A +  + W G    V  E  +  +        EL +       K+A+++       +A++ + D ++     N              LQ +  YL ++K+  T  R L II+N      S+PQ++ RLYD+V++  +E+A +PG +
Sbjct:  172 RNWQKASESLKLAKTVYEKLAEATNNTTLSSIFKGRCREIQPQLRLCEFNIAESPGAVGTMTELMELRMQMGEGGD-SSVDKLISEMRASATSAEVVTIEWGGAKSTVDDEKAKQVVQEWKQTEVELAQCQTPKE-KMALFEKATADTRDAIDRISDIIRRKSSENADTTV---------LQSIKAYLEFLKMNGTASRYLAIIDNTKSEKKSKPQDLLRLYDSVIEIYKEVAEIPGAD 399          
BLAST of Signal recognition particle subunit SRP68 vs. UniProt/SwissProt
Match: sp|Q8BMA6|SRP68_MOUSE (Signal recognition particle subunit SRP68 OS=Mus musculus OX=10090 GN=Srp68 PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 1.134e-27
Identity = 86/272 (31.62%), Postives = 134/272 (49.26%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMD-----QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLET--MSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVS-RPQNMARLYDTVMQNLQEMAGLPGLNTE-------SMKTTPSKRYK 897
            +   +EWK A   + K    Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     ++  +    G  +     +   L+ Q    Q A M+EV W G  +PVK + VR+ +L L D    + + + +   K  +++S+L  C +AL +VR++LK   P    +   L  E+  +S LQ L  YL Y+KL   + RN          LL  +   D+  S RPQ++ RLYD ++QNL E+  LPGL  +       S+KT   K Y+
Sbjct:  197 RFEHQEWKSAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIVQAE-SEETKERLFESMLSECRDALQAVREELK---PDQKQRDYALDGESGKVSNLQYLHSYLTYIKLSTAIRRNENMAKGLHRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELLQLPGLEEDRTFQKEISLKTLVFKAYR 464          

HSP 2 Score: 94.7449 bits (234), Expect = 6.851e-19
Identity = 68/201 (33.83%), Postives = 103/201 (51.24%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+EI  K   + AYRC++++Q+++L+K+++E   L  R L++            +NE  S G +    L   P V E++  + S       E+ S +A   L   D    + + S +   D+ PL +R + F  DP+L  K   L+   P F+PIP KPLFFDLAL HV FP L     + K +     GLTG +KG I+G
Sbjct:  450 QKEISLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVLKY------------ANEVSSHGGASKNSLKDLPDVQELITQVRS-------EKCSLQAAAILDANDSHQTDTS-SQV--KDNTPLVERFESFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL-----EDKLEQKTKSGLTGYIKG-IFG 622          
BLAST of Signal recognition particle subunit SRP68 vs. TrEMBL
Match: A0A4S2LWG3 (Signal recognition particle subunit SRP68 OS=Opisthorchis felineus OX=147828 GN=CRM22_004384 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 5.788e-74
Identity = 94/271 (34.69%), Postives = 151/271 (55.72%), Query Frame = 1
Query:  160 LSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHA-----AGGDMD-QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITN------------LSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLD----------------TSVSRPQNMARLYDTVMQNLQEMAGLPGLNTESM 870
              +++W KAK   E     Y+GL + +++D + +Y ++ D++ P I YCA N G+     D+  + A      GG  + Q + LL Q   +Q   +TEV WLG+ IPVK E  ++ IL + D+++EL   D N+N K+++Y+S+LK C +A+ +VRD+++ +  +  A                 S + +SRLQ+L+ YL Y+K+ KT+ER LL I+  L                 +S  +PQ ++RLYDT++QNLQE+ GLPG   E M
Sbjct:  164 FELQDWMKAKEFLEATQAIYAGLMQTIEEDNRGVYSARVDDILPQIHYCAYNIGDKSAATDLQRMRAQTTTETGGLAELQLDQLLSQARASQAGQVTEVEWLGMTIPVKLEKAKMAILTVKDSDQELLSMD-NHNTKLSVYESVLKACVDAIGAVRDEIRAALSTEGAVAAGADKKVAAAVAASSSTDKVSRLQVLYAYLQYLKISKTIERTLLHIKGALSADGLEAAGHVKDGLGTSSFPKPQELSRLYDTLVQNLQELIGLPGAVQEHM 433          

HSP 2 Score: 139.813 bits (351), Expect = 5.788e-74
Identity = 84/216 (38.89%), Postives = 122/216 (56.48%), Query Frame = 3
Query:  891 IQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMID--DAPLEAALSGIGGTDDLPLTKRLDEFVE----DPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWGK*AQAAAMGYHH 1520
            +QAKI AY +YRCYYL+  ++  KRF ECSALL R+ RH E A+ +L    ++ +++   +      PGP   +++  + SL+    AE L+CRA   L + D  D P + + S    +  + L  RLD +VE    + + + +P   +Q  P FEP+PVKP+FFDLAL HV FP+L    K   G      GL+G+V+GW+WG  A  A  G  H
Sbjct:  439 LQAKIVAYRSYRCYYLAFTYIHGKRFAECSALLQRSRRHAEEALQALSPTTASWTDNESAAS-----PGPPCDQLITELTSLITQTEAEDLTCRAVYMLDLSDSGDRPFDTSESENKLSQKV-LLDRLDHYVESNVVEKSFTTQPYPFVQLPPHFEPVPVKPIFFDLALNHVNFPSL--TEKTSAGTSKGTSGLSGLVRGWLWGS-ASGADEGPSH 645          
BLAST of Signal recognition particle subunit SRP68 vs. TrEMBL
Match: A0A1S8X5J9 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_02181 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 7.488e-74
Identity = 95/271 (35.06%), Postives = 152/271 (56.09%), Query Frame = 1
Query:  160 LSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHA-----AGGDMD-QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPA------------QITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLD----------------TSVSRPQNMARLYDTVMQNLQEMAGLPGLNTESM 870
              +++W KAK   E     Y+GL + +++D + +Y S+ D++ P I YCA N G+     D+  + A      GG  + Q + LL Q   +Q   +TEV WLG+ IPVK E  ++ IL + D+++EL   D N+N K+++Y+S+LK C +A+ +VRD+++ +  +  A               + S + +SRLQ+L+ YL Y+K+ KT+ER LL I+  L                 +S  +PQ ++RLYDT++QNLQE+ GLPG   E M
Sbjct:  138 FELQDWMKAKEFLEATQAIYAGLMQTIEEDNRGVYSSRVDDILPQIHYCAYNIGDKSAATDLQRMRAQTTTETGGLAELQLDQLLSQARASQAGQVTEVEWLGMTIPVKLEKAKMAILTVKDSDQELLGMD-NHNTKLSVYESVLKACVDAIGAVRDEIRATLSTEGAVAAGADKKMAAAVAASSSTDKVSRLQVLYAYLQYLKISKTIERTLLHIKGALSADGLEAAGHVKDGLGTSSFPKPQELSRLYDTLVQNLQELIGLPGAVQERM 407          

HSP 2 Score: 139.043 bits (349), Expect = 7.488e-74
Identity = 79/204 (38.73%), Postives = 117/204 (57.35%), Query Frame = 3
Query:  891 IQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMID--DAPLEAALSGIGGTDDLPLTKRLDEFVE----DPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            +QAKI AY +YRCYYL+  ++  KRF ECSALL R+ RH E A+ +L    ++ ++    +      PGP   +++  + SL+    AE L+CRA   L + D  D P + + S    +  + L  RLD +VE    + + + +P   +Q  P FEP+PVKP+FFDLAL H+ FP+L    K   G      GL+G+V+GW+WG
Sbjct:  413 LQAKIVAYRSYRCYYLAFTYIHGKRFAECSALLQRSRRHAEEALQALSPTTASWTDDESAAS-----PGPPCDQLITELTSLITQTEAEDLTCRAVYMLDLSDSGDRPFDTSESENKLSQKV-LLDRLDHYVECNVVEKSFTTQPYPFVQLPPHFEPVPVKPIFFDLALNHINFPSL--TEKTSTGMSKGTSGLSGLVRGWLWG 608          
BLAST of Signal recognition particle subunit SRP68 vs. TrEMBL
Match: A0A074ZTA6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_03194 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.231e-73
Identity = 95/271 (35.06%), Postives = 151/271 (55.72%), Query Frame = 1
Query:  160 LSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHA-----AGGDMD-QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITN------------LSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLD----------------TSVSRPQNMARLYDTVMQNLQEMAGLPGLNTESM 870
              +++W KAK   E     Y+GL + +++D + +Y S+ D++ P I YCA N G+     D+  + A      GG  + Q + LL Q   +Q   +TEV WLG+ IPVK E  ++ IL + D+++EL   D N+N K+++Y+S+LK C +A+ +VRD+++ +  +  A                 S + +SRLQ+L+ YL Y+K+ KT+ER LL I+  L                 +S  +PQ ++RLYDT++QNLQE+ GLPG   E M
Sbjct:  266 FELQDWMKAKEFLEATQAIYAGLMQTIEEDNRGVYSSRVDDILPQIHYCAYNIGDKSAATDLQRMRAQTTTETGGLAELQLDQLLSQARASQAGQVTEVEWLGMTIPVKLEKAKMAILTVKDSDQELLGMD-NHNTKLSVYESVLKACVDAIGAVRDEIRATLSTEGAVAAGADKKMAAAVAASSSTDKVSRLQVLYAYLQYLKISKTIERTLLHIKGALSADGLEAAGHVKDGLGTSSFPKPQELSRLYDTLVQNLQELIGLPGAVQERM 535          

HSP 2 Score: 138.658 bits (348), Expect = 1.231e-73
Identity = 79/204 (38.73%), Postives = 117/204 (57.35%), Query Frame = 3
Query:  891 IQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMID--DAPLEAALSGIGGTDDLPLTKRLDEFVE----DPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            +QAKI AY +YRCYYL+  ++  KRF ECSALL R+ RH E A+ +L    ++ ++    +      PGP   +++  + SL+    AE L+CRA   L + D  D P + + S    +  + L  RLD +VE    + + + +P   +Q  P FEP+PVKP+FFDLAL H+ FP+L    K   G      GL+G+V+GW+WG
Sbjct:  541 LQAKIVAYRSYRCYYLAFTYIHGKRFAECSALLQRSRRHAEEALQALSPTTASWTDDESAAS-----PGPPCDQLITELTSLITQTEAEDLTCRAVYMLDLSDSGDRPFDTSESENKLSQKV-LLDRLDHYVECNVVEKSFTTQPYPFVQLPPHFEPVPVKPIFFDLALNHINFPSL--TEKTSTGMSKGTSGLSGLVRGWLWG 736          
BLAST of Signal recognition particle subunit SRP68 vs. TrEMBL
Match: G7Y8I5 (Signal recognition particle subunit SRP68 OS=Clonorchis sinensis OX=79923 GN=CLF_102787 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.838e-70
Identity = 94/271 (34.69%), Postives = 152/271 (56.09%), Query Frame = 1
Query:  160 LSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHA-----AGGDMD-QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPA------------QITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLD----------------TSVSRPQNMARLYDTVMQNLQEMAGLPGLNTESM 870
              +++W KAK   E     Y+GL + +++D + +Y ++ D++ P I YCA N G+     D+  + A      GG  + Q + LL Q   +Q   +TEV WLG+ IPVK E  ++ IL + D+++EL   D N+N K+++Y+S+LK C +A+ +VRD+++ +  +  A               + S + +SRLQ+L+ YL Y+K+ KT+ER LL I+  L                 +S  +PQ ++RLYDT++QNLQE+ GLPG   E M
Sbjct:  164 FELQDWMKAKEFLEATQAIYAGLMQTIEEDNRGVYSARVDDILPQIHYCAYNIGDKSAATDLQRMRAQTTTETGGLAELQLDQLLSQARASQAGQVTEVEWLGMTIPVKLEKAKMAILTVKDSDQELLGMD-NHNTKLSVYESVLKACVDAIGAVRDEIRAALSTEGAVAAGADKKMAAAVAASSSTDKVSRLQVLYAYLQYLKISKTIERTLLHIKGALSADGLEAAGHVKDGLGTSSFPKPQELSRLYDTLVQNLQELIGLPGAVQEHM 433          

HSP 2 Score: 127.872 bits (320), Expect = 2.838e-70
Identity = 70/177 (39.55%), Postives = 105/177 (59.32%), Query Frame = 3
Query:  891 IQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMID--DAPLEAALSGIGGTDDLPLTKRLDEFVE----DPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNL 1403
            +QAKI AY +YRCYYL+  ++  KRF ECSALL R+ RH E A+ +L    ++ +++   +      PGP+  +++  + SL+    AE L+CRA   L + D  D P + + S    +  + L  RLD +VE    + + + +P   +Q  P FEP+PVKP+FFDLAL HV FP+L
Sbjct:  439 LQAKIVAYRSYRCYYLAFTYIHGKRFAECSALLQRSRRHAEEALQALSPTTASWTDTESAAS-----PGPSCDQLITELTSLITQTEAEDLTCRAVYMLDLSDSGDRPFDTSESENKLSQKV-LLDRLDHYVECNAVEKSFTTQPYPFVQLPPHFEPVPVKPIFFDLALNHVNFPSL 609          
BLAST of Signal recognition particle subunit SRP68 vs. TrEMBL
Match: A0A3R7CKF4 (Signal recognition particle subunit SRP68 OS=Clonorchis sinensis OX=79923 GN=SRP68 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 3.797e-70
Identity = 94/271 (34.69%), Postives = 152/271 (56.09%), Query Frame = 1
Query:  160 LSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHA-----AGGDMD-QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPA------------QITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLD----------------TSVSRPQNMARLYDTVMQNLQEMAGLPGLNTESM 870
              +++W KAK   E     Y+GL + +++D + +Y ++ D++ P I YCA N G+     D+  + A      GG  + Q + LL Q   +Q   +TEV WLG+ IPVK E  ++ IL + D+++EL   D N+N K+++Y+S+LK C +A+ +VRD+++ +  +  A               + S + +SRLQ+L+ YL Y+K+ KT+ER LL I+  L                 +S  +PQ ++RLYDT++QNLQE+ GLPG   E M
Sbjct:  164 FELQDWMKAKEFLEATQAIYAGLMQTIEEDNRGVYSARVDDILPQIHYCAYNIGDKSAATDLQRMRAQTTTETGGLAELQLDQLLSQARASQAGQVTEVEWLGMTIPVKLEKAKMAILTVKDSDQELLGMD-NHNTKLSVYESVLKACVDAIGAVRDEIRAALSTEGAVAAGADKKMAAAVAASSSTDKVSRLQVLYAYLQYLKISKTIERTLLHIKGALSADGLEAAGHVKDGLGTSSFPKPQELSRLYDTLVQNLQELIGLPGAVQEHM 433          

HSP 2 Score: 127.487 bits (319), Expect = 3.797e-70
Identity = 70/177 (39.55%), Postives = 105/177 (59.32%), Query Frame = 3
Query:  891 IQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMID--DAPLEAALSGIGGTDDLPLTKRLDEFVE----DPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNL 1403
            +QAKI AY +YRCYYL+  ++  KRF ECSALL R+ RH E A+ +L    ++ +++   +      PGP+  +++  + SL+    AE L+CRA   L + D  D P + + S    +  + L  RLD +VE    + + + +P   +Q  P FEP+PVKP+FFDLAL HV FP+L
Sbjct:  439 LQAKIVAYRSYRCYYLAFTYIHGKRFAECSALLQRSRRHAEEALQALSPTTASWTDTESAAS-----PGPSCDQLITELTSLITQTEAEDLTCRAVYMLDLSDSGDRPFDTSESENKLSQKV-LLDRLDHYVECNAVEKSFTTQPYPFVQLPPHFEPVPVKPIFFDLALNHVNFPSL 609          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Cavefish
Match: srp68 (signal recognition particle 68 [Source:ZFIN;Acc:ZDB-GENE-040831-3])

HSP 1 Score: 114.005 bits (284), Expect = 6.220e-26
Identity = 77/269 (28.62%), Postives = 126/269 (46.84%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDM-----DQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERN----------LLIIENNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGLNTE-------SMKTTPSKRYK 897
            +  ++EWK A   + K    Y  LA A  ++Q  +Y  + +E+ P IRYCA N G+     D+  +  + G       ++   L+ Q    Q A M+EV W G  +PVK +  R+ +L L D    + +   N + K  +Y++LL  C + + +VR++L+                  S LQ L  YL Y+KL   V RN          L   + + +    RPQ++ RLYD ++Q+L E++ L GL  +       ++KT   K Y+
Sbjct:  215 QFELQEWKAAMEAFNKCKTIYEKLASAFTEEQAVLYHQRVEEISPNIRYCAYNIGDQNAINDLMQMRLSAGGGGGMMAEKLETLITQTRAKQAATMSEVEWRGRSVPVKIDKARIFLLGLADNEAAIAQA-ANEDTKERLYETLLAECRDTIQAVREELRTDVKQRERAAEGAESGKASNLQYLHSYLTYIKLWTVVRRNESMARALQAKLKEPQTDENKRGPRPQDLIRLYDIILQSLAELSTLQGLEEDHAFQKEVALKTLVYKAYR 482          

HSP 2 Score: 106.686 bits (265), Expect = 1.203e-23
Identity = 70/199 (35.18%), Postives = 108/199 (54.27%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMID--DAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKG 1472
            Q+E+  K   Y AYRC++++Q+++L+K+++E   L  R L++            + E +S   ++N  L+  P V +++  +N       AE+ S +A   L   D  +AP++  +      D++PL+ RLD F  D +L  K   L+Q  PDF+PIP KPLFFDLAL HV FP L     D K +     GLTG +KG
Sbjct:  468 QKEVALKTLVYKAYRCFFIAQSYVLVKKWSEALVLYERVLKY------------AREVQSKAKNLNNSLMDLPDVQDLIAEVN-------AEKYSLQAAAILDKEDVAEAPVQQQVK-----DNMPLSDRLDTFRLDTSLVGKQPNLVQFPPDFQPIPCKPLFFDLALNHVAFPPL-----DDKVEQKGKGGLTGYIKG 637          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Sea Lamprey
Match: srp68 (signal recognition particle 68 [Source:ZFIN;Acc:ZDB-GENE-040831-3])

HSP 1 Score: 107.071 bits (266), Expect = 3.446e-25
Identity = 73/253 (28.85%), Postives = 121/253 (47.83%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGD-----MDQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETM--SRLQILFVYLHYVKLVKTVERNLLIIENNL----------DTSVSRPQNMARLYDTVMQNLQEMAGLPGLNTE 864
            +   ++W KA   +      Y  LA A   +Q  +Y  + +E+ P +RYCA N G+     D+  +    GD      ++   LL Q+   Q   M+EV W G     K + VR+ +L+L ++   + + +     K  +Y+SLL  C +A+++VR++LK   P+   +      E    S LQ L  YL ++KL  TVERN+++                    RPQ + RLY+ ++Q+L EM  LPG+  +
Sbjct:  137 RFEKQDWTKAMESFGSCKTIYEKLASAFSDEQAVLYRQRVEEISPNLRYCAYNIGDQSAIGDLLQMRLKSGDSSSMLTEKLEVLLAQMRAKQSTSMSEVTWCG----RKVDRVRVFLLSLEESEAAIAQAE-KEEGKEQLYESLLIECRDAIHAVREELK-LDPTWTQKQRERETEAGKNSNLQHLHSYLTFIKLSNTVERNVVMARALRRRLSRGAVDDGRKAPRPQELIRLYELILQSLNEMQQLPGMEAD 383          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Nematostella
Match: EDO32726 (Signal recognition particle subunit SRP68 [Source:UniProtKB/TrEMBL;Acc:A7SU98])

HSP 1 Score: 130.954 bits (328), Expect = 5.156e-32
Identity = 90/292 (30.82%), Postives = 154/292 (52.74%), Query Frame = 1
Query:  160 LSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLH-----AAGGDMD-----QFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIEN-------NL-DTS----------VSRPQNMARLYDTVMQNLQEMAGLPGLNTE-------SMKTTPSKRYKPRY-PHTLLIA 927
              ++ WK+A  ++ ++   Y  LA A  ++Q+ +YL + +E+ P IRYCA N G  +   DI  L      +AGG  D     + +++L Q  + +   MTEV W    IPV+ E VR  IL      +EL + + + + ++ +Y+ LL  C +AL +++DDLKG   S   ++     + ++ LQ L  Y+ Y+KL KT+ER LL+ E+       NL DT+          +++P++M R+YD ++QNL +M+ L  +  +       + +T   K Y+  Y  H+ L+A
Sbjct:  138 FELQNWKEALELFGRSRTIYERLAGAFSEEQRNMYLQRVEEITPNIRYCAYNLG--ESGTDINDLMQLRHCSAGGVQDPVLAAKIDEVLAQTREKEAGAMTEVVWCNRTIPVRNEKVRGFILHAQQMARELDRAE-DLDGRMELYEDLLLECKDALQAIKDDLKGDLVSEELKVHKTEAQ-VANLQFLHTYVTYLKLTKTIERYLLLAESMKNQLPANLQDTANGSEPLPNKKLTKPEDMVRIYDIILQNLSDMSELHSVEDDLELTKEIAAQTLEYKAYRCFYIAHSYLLA 425          

HSP 2 Score: 97.8265 bits (242), Expect = 2.698e-21
Identity = 60/200 (30.00%), Postives = 99/200 (49.50%), Query Frame = 3
Query:  885 QEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            +EI A+   Y AYRC+Y++ ++LL K++ E + L  R   H  SA+   +   + +S+++                    +  L       + S  A+   S++D   +   L+     +D  L +RLD +  D +L  K   +    PDF+P+P KPLFFDLAL HV+FP+L      ++ +  +  G+TG  KGW+WG
Sbjct:  401 KEIAAQTLEYKAYRCFYIAHSYLLAKKWREAAVLYDRVTSHANSAVSHFRECQNFQSQAS-------------------RLQDLASLSRGSKCSAHAS---SILDSEEITDKLAS-ATIEDKTLAERLDVYHVDQSLVSKKPHVTTFPPDFQPVPCKPLFFDLALNHVEFPSL-----AERVETKKAAGITGYFKGWLWG 572          
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Medaka
Match: srp68 (signal recognition particle 68 [Source:NCBI gene;Acc:101167676])

HSP 1 Score: 129.798 bits (325), Expect = 3.699e-31
Identity = 85/275 (30.91%), Postives = 134/275 (48.73%), Query Frame = 1
Query:  157 KLSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGD----MDQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKG-------SGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERN--------LLIIENNLDTSVS--RPQNMARLYDTVMQNLQEMAGLPGLNTE-------SMKTTPSKRYK 897
            +  ++EWK+A   + K    Y  LA A  ++   +Y  + DE+ P IRYCA N G+     D+  +   GG      ++   L+ Q    Q A M+EV W G  +PVK +  R+ +L L D    + +   N   K  +Y++LL  C + + +VR++LK        S  S+  +++N        LQ L  YL Y+KL   V+RN        + + E   D S    RPQ++ RLYD ++Q+L E++ LPGL  +       S+KT   K Y+
Sbjct:  166 EFELQEWKRAMEAFNKCKTIYEKLASAFTEEMAALYRQRVDEISPNIRYCAYNIGDQNAINDLMQMRLTGGGGGMMAEKLETLITQARTKQAATMSEVEWRGRSVPVKVDKARIFLLGLADNEAAIAQA-ANEETKEHLYETLLAECRDTIQAVREELKSEAKLRERSSDSDGGKVSN--------LQFLHSYLTYIKLCTLVKRNESMAHTLQVQLKETGADDSKRGPRPQDLIRLYDIILQSLAELSTLPGLEDDHAFQKEVSLKTLIYKAYR 431          

HSP 2 Score: 94.3597 bits (233), Expect = 8.384e-20
Identity = 69/201 (34.33%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  882 QQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWG 1484
            Q+E+  K   Y AYRC++++Q+++L+K+++E   L  R L++            + E +S   S+N  L   P V E++  +N       AE+ S +A   L   + A +          D+ PL + L+ F  D  L  K   L+   PDF+PIP KPLFFDLAL HV FP L     D K +     GLTG +KG I+G
Sbjct:  417 QKEVSLKTLIYKAYRCFFIAQSYVLVKKWSEALVLYERVLKY------------AKEVQSKAKSLNSSLKDLPDVQELIAEVN-------AEKYSLQAAAILDKDETAEVSVPHQQ---KDNTPLCEHLETFRIDSTLVGKHPNLVPFPPDFQPIPCKPLFFDLALNHVTFPPL-----DDKVEQKGKGGLTGYIKG-IFG 589          
BLAST of Signal recognition particle subunit SRP68 vs. Planmine SMEST
Match: SMESG000034399.1 (SMESG000034399.1)

HSP 1 Score: 478.404 bits (1230), Expect = 0.000e+0
Identity = 233/236 (98.73%), Postives = 233/236 (98.73%), Query Frame = 1
Query:  160 LSIKEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMDQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGLNTES 867
              I EWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMDQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGLNTES
Sbjct:  167 FEISEWKKAKAMYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPDIASLHAAGGDMDQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTILALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNPAQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSVSRPQNMARLYDTVMQNLQEMAGLPGLNTES 402          

HSP 2 Score: 394.815 bits (1013), Expect = 0.000e+0
Identity = 206/207 (99.52%), Postives = 207/207 (100.00%), Query Frame = 3
Query:  867 HENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLXXXXXXXXXXXXXXXXLTGMVKGWIWGK 1487
            +ENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLDDKVKDKKGKGAENKGLTGMVKGWIWGK
Sbjct:  403 NENNAQQEIQAKISAYTAYRCYYLSQAHLLMKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAVSEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPLTKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLDDKVKDKKGKGAENKGLTGMVKGWIWGK 609          
The following BLAST results are available for this feature:
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SRP684.174e-4831.87signal recognition particle 68 [Source:HGNC Symbol... [more]
SRP684.353e-4831.87signal recognition particle 68 [Source:HGNC Symbol... [more]
SRP682.395e-2933.83signal recognition particle 68 [Source:HGNC Symbol... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srpa-687.475e-3128.96Probable signal recognition particle subunit SRP68... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Srp683.635e-4029.37gene:FBgn0035947 transcript:FBtr0076517[more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
srp683.877e-2829.67signal recognition particle 68 [Source:ZFIN;Acc:ZD... [more]
srp684.502e-2829.67signal recognition particle 68 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
c6.21.000e-4829.55complement component 6, gene 2 [Source:Xenbase;Acc... [more]
c6.21.104e-4829.55complement component 6, gene 2 [Source:Xenbase;Acc... [more]
c6.21.313e-4829.55complement component 6, gene 2 [Source:Xenbase;Acc... [more]
c6.21.381e-4829.55complement component 6, gene 2 [Source:Xenbase;Acc... [more]
c6.21.628e-4829.55complement component 6, gene 2 [Source:Xenbase;Acc... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Srp681.239e-2831.62signal recognition particle 68 [Source:MGI Symbol;... [more]
Srp681.621e-2831.62signal recognition particle 68 [Source:MGI Symbol;... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UHB9|SRP68_HUMAN1.835e-4731.87Signal recognition particle subunit SRP68 OS=Homo ... [more]
sp|Q00004|SRP68_CANLF6.195e-4730.80Signal recognition particle subunit SRP68 OS=Canis... [more]
sp|Q9VSS2|SRP68_DROME2.781e-3929.37Signal recognition particle subunit SRP68 OS=Droso... [more]
sp|Q20822|SRP68_CAEEL7.805e-3028.96Probable signal recognition particle subunit SRP68... [more]
sp|Q8BMA6|SRP68_MOUSE1.134e-2731.62Signal recognition particle subunit SRP68 OS=Mus m... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LWG35.788e-7434.69Signal recognition particle subunit SRP68 OS=Opist... [more]
A0A1S8X5J97.488e-7435.06Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A074ZTA61.231e-7335.06Uncharacterized protein OS=Opisthorchis viverrini ... [more]
G7Y8I52.838e-7034.69Signal recognition particle subunit SRP68 OS=Clono... [more]
A0A3R7CKF43.797e-7034.69Signal recognition particle subunit SRP68 OS=Clono... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srp686.220e-2628.62signal recognition particle 68 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srp683.446e-2528.85signal recognition particle 68 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO327265.156e-3230.82Signal recognition particle subunit SRP68 [Source... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srp683.699e-3130.91signal recognition particle 68 [Source:NCBI gene;A... [more]
back to top
BLAST of Signal recognition particle subunit SRP68 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000034399.10.000e+098.73SMESG000034399.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015434 ID=SMED30015434|Name=Signal recognition particle subunit SRP68|organism=Schmidtea mediterranea sexual|type=transcript|length=2055bp
ATTTGTTGCCTGCTTCCGAAATATTTCATTTTTATATCCTTTTACATTGG
GGGGGGGAGGGCAGATGAACTCCTCTGTTGCGTTATAAACCCCTGAATAG
TTACGAATTATAGTATCGATCAGAGATTGAGAGAGAGAGAGAGGAGAACC
TGATTAAAGTTGTCAATTAAGGAATGGAAGAAAGCCAAAGCAATGTATGA
GAAAGCATACCTTGAATACTCGGGATTGGCTAAGGCCGTTGACAAAGACC
AACAGCAAATATATCTATCAAAATGTGATGAATTGAAACCGTTGATCCGG
TATTGTGCAAATAATGACGGCAACCTACAGGAAACACCGGATATTGCCTC
CTTGCATGCCGCTGGAGGGGACATGGATCAATTTAATGATCTGTTGAAGC
AAATCTATAAAAACCAAGTTGCCGTTATGACTGAGGTTAATTGGCTGGGA
ATTGTGATTCCGGTCAAGCAGGAAAATGTCAGGTTGACCATTCTAGCACT
GAATGACGCCAATAAGGAATTAGGCAAGCCAGACTTGAATAATAACGCTA
AAATTGCAATTTACGATTCTCTGCTCAAGACTTGCACTGAGGCGCTGAAC
TCGGTCAGGGATGATTTGAAGGGATCTGGCCCGAGCAACCCAGCTCAAAT
CACTAATCTCAGCTTGGAAACGATGAGTCGGCTGCAAATCCTATTTGTAT
ATTTGCATTATGTGAAACTGGTGAAGACGGTGGAGAGGAATCTGTTGATC
ATTGAAAACAATCTGGATACCAGTGTAAGCAGGCCACAGAACATGGCTCG
ACTGTATGACACTGTGATGCAAAACCTGCAGGAAATGGCAGGGTTACCGG
GGCTCAACACTGAAAGCATGAAAACAACGCCCAGCAAGAGATACAAGCCA
AGATATCCGCATACACTGCTTATCGCTGCTATTATCTCTCCCAGGCGCAT
TTACTGATGAAGCGGTTCAATGAGTGCTCTGCTCTACTGAGCCGGACGTT
GCGGCATTGTGAGAGCGCCATTGGCAGCTTGAAACTGATCGGTAGCAATG
AATCAGAATCCACAGGAGTATCGGTCAATAAGCGGCTGATTCCAGGGCCG
GCGGTATCGGAAATGGTGGGAAATATCAATAGCTTGGTGGACTGTGTTGG
TGCTGAGCAATTGAGTTGCCGTGCTAATCGCTGCCTCTCCATGATTGATG
ATGCACCGCTAGAGGCCGCCTTGTCCGGCATCGGCGGCACTGATGACTTG
CCTCTGACTAAACGTTTGGATGAATTTGTCGAAGATCCGAATCTATCAAA
GAAACCGAATCGCCTTATTCAGGCATGTCCGGATTTTGAACCGATTCCAG
TTAAGCCACTTTTCTTCGATCTTGCCCTTTTCCATGTTAAATTTCCAAAC
TTGGATGATAAAGTCAAGGACAAAAAGGGAAAAGGTGCAGAAAACAAAGG
TCTCACAGGAATGGTGAAAGGATGGATCTGGGGCAAATAGGCGCAAGCGG
CAGCAATGGGTTATCATCATCATCATAATTATTGTGCAACCACCGAATTT
GCGTGTATTTCCAGTTTGATATCGTCATCATTATCTCTTGGTGTGGTCAT
CATTGTTATCATAATTATTTTGATGAAATACATTTTCTCTCTATTCAATT
TATTCGCTAATCAATTTATTGTCCAGCAGCGCCAGTCCCCTCGATGTATT
CACAGGTGTTTTATCCTCACCTTAATGTTGTTGCTTAGTTACCACAGACG
AAAGGTCCGTACGTAATTCAATGTCCTAATAGCAATGGTGATTAAACCCG
TGAAAAGTTCCAAGGAAAAGCGAAATAATCAATATTTCTGAAATATTTGA
CTAGTTACAAAGCTTACGGGCAAGGTCTACTCATCAAGGTTTATTGGAAT
ATTTATGACAGGCATCCATTTTAAAAATTGCGCTGTTCAGTAAAACAAAT
GTAAATTTATGTTGGTAACGAATTCTGTATGATTGCACTGAGTTATCGTG
TTTCTAAACCTGCAAATTATGAATTTATTTATATTTCTACAAACGGCAAT
TATAA
back to top

protein sequence of SMED30015434-orf-1

>SMED30015434-orf-1 ID=SMED30015434-orf-1|Name=SMED30015434-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=255bp
MYEKAYLEYSGLAKAVDKDQQQIYLSKCDELKPLIRYCANNDGNLQETPD
IASLHAAGGDMDQFNDLLKQIYKNQVAVMTEVNWLGIVIPVKQENVRLTI
LALNDANKELGKPDLNNNAKIAIYDSLLKTCTEALNSVRDDLKGSGPSNP
AQITNLSLETMSRLQILFVYLHYVKLVKTVERNLLIIENNLDTSVSRPQN
MARLYDTVMQNLQEMAGLPGLNTESMKTTPSKRYKPRYPHTLLIAAIISP
RRIY*
back to top

protein sequence of SMED30015434-orf-2

>SMED30015434-orf-2 ID=SMED30015434-orf-2|Name=SMED30015434-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=178bp
MKRFNECSALLSRTLRHCESAIGSLKLIGSNESESTGVSVNKRLIPGPAV
SEMVGNINSLVDCVGAEQLSCRANRCLSMIDDAPLEAALSGIGGTDDLPL
TKRLDEFVEDPNLSKKPNRLIQACPDFEPIPVKPLFFDLALFHVKFPNLD
DKVKDKKGKGAENKGLTGMVKGWIWGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005047signal recognition particle binding
GO:00083127S RNA binding
GO:0030942endoplasmic reticulum signal peptide binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005786signal recognition particle, endoplasmic reticulum targeting
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026258SRP68
Vocabulary: biological process
TermDefinition
GO:0006614SRP-dependent cotranslational protein targeting to membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026258Signal recognition particle subunit SRP68PFAMPF16969SRP68coord: 2..254
e-value: 9.1E-43
score: 147.1
IPR026258Signal recognition particle subunit SRP68PANTHERPTHR12860SIGNAL RECOGNITION PARTICLE 68 KDA PROTEINcoord: 4..255