V-type proton ATPase subunit a

Overview
NameV-type proton ATPase subunit a
Smed IDSMED30015427
Length (bp)2683
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase subunit a (SMED30015427) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase subunit a (SMED30015427) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-type proton ATPase subunit a (SMED30015427) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-type proton ATPase subunit a (SMED30015427) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015427

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015427h1SMcG0014202 SmedASXL_008457SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30015427h1SMcG0014202 Contig20289newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015427h1SMcG0014202 Contig20289uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015427h1SMcG0014202 Contig39959newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015427h1SMcG0014202 Contig39959uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30015427h1SMcG0014202 dd_Smed_v4_4805_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015427h1SMcG0014202 dd_Smed_v4_4805_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015427h1SMcG0014202 dd_Smed_v4_4805_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30015427h1SMcG0014202 dd_Smed_v4_4805_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015427h1SMcG0014202 dd_Smed_v4_4805_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015427h1SMcG0014202 dd_Smed_v6_4805_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015427h1SMcG0014202 OX_Smed_1.0.13120ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of V-type proton ATPase subunit a vs. Ensembl Human
Match: ATP6V0A1 (ATPase H+ transporting V0 subunit a1 [Source:HGNC Symbol;Acc:HGNC:865])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 365/626 (58.31%), Postives = 462/626 (73.80%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K+++E+++T F GRYIILLMG+FS+YTGLIYND FSKS+N+FGSSW     +   +   T+    ++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          +     Y GQ  IQ  LVV+A++C+PWML  KP +LR++ +  K    LN G I    G   E  ++   D LS T   + +EF+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGLS  +  G +VLF  F  +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PFSFE I E K+EE
Sbjct:  224 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLNIFGSSWSVRPMFTYNWTEETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPE--------SGYSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLS-THSEDADEFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLVLFFFFTAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE 838          

HSP 2 Score: 251.906 bits (642), Expect = 0.000e+0
Identity = 144/230 (62.61%), Postives = 172/230 (74.78%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEG-MHDSSMNXXXXXXXXXXXXXXXXMA-GQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE  +H   M +  L       L+   M  G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEAELHHQQMADPDLLEESSSLLEPSEMGRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 230          
BLAST of V-type proton ATPase subunit a vs. Ensembl Human
Match: ATP6V0A1 (ATPase H+ transporting V0 subunit a1 [Source:HGNC Symbol;Acc:HGNC:865])

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 365/626 (58.31%), Postives = 462/626 (73.80%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K+++E+++T F GRYIILLMG+FS+YTGLIYND FSKS+N+FGSSW     +   +   T+    ++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          +     Y GQ  IQ  LVV+A++C+PWML  KP +LR++ +  K    LN G I    G   E  ++   D LS T   + +EF+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGLS  +  G +VLF  F  +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PFSFE I E K+EE
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLNIFGSSWSVRPMFTYNWTEETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPE--------SGYSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLS-THSEDADEFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLVLFFFFTAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE 831          

HSP 2 Score: 246.899 bits (629), Expect = 0.000e+0
Identity = 146/228 (64.04%), Postives = 173/228 (75.88%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPSEMGR----GTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Human
Match: ATP6V0A1 (ATPase H+ transporting V0 subunit a1 [Source:HGNC Symbol;Acc:HGNC:865])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 365/626 (58.31%), Postives = 462/626 (73.80%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K+++E+++T F GRYIILLMG+FS+YTGLIYND FSKS+N+FGSSW     +   +   T+    ++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          +     Y GQ  IQ  LVV+A++C+PWML  KP +LR++ +  K    LN G I    G   E  ++   D LS T   + +EF+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGLS  +  G +VLF  F  +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PFSFE I E K+EE
Sbjct:  174 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLNIFGSSWSVRPMFTYNWTEETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPE--------SGYSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLS-THSEDADEFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLVLFFFFTAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE 788          

HSP 2 Score: 155.221 bits (391), Expect = 2.936e-38
Identity = 70/98 (71.43%), Postives = 83/98 (84.69%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLE 327
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLE 98          

HSP 3 Score: 87.0409 bits (214), Expect = 8.719e-17
Identity = 40/61 (65.57%), Postives = 46/61 (75.41%), Query Frame = 1
Query:  535 GQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:  120 GTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 180          
BLAST of V-type proton ATPase subunit a vs. Ensembl Human
Match: ATP6V0A1 (ATPase H+ transporting V0 subunit a1 [Source:HGNC Symbol;Acc:HGNC:865])

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 365/631 (57.84%), Postives = 461/631 (73.06%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLS-----VTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K+++E+++T F GRYIILLMG+FS+YTGLIYND FSKS+N+FGSSW     +   +   T+    ++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          +     Y GQ  IQ  LVV+A++C+PWML  KP +LR++ +  K    LN G I    G   E  ++   D LS       +  E E F+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGLS  +  G +VLF  F  +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PFSFE I E K+EE
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLNIFGSSWSVRPMFTYNWTEETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPE--------SGYSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDADEPSEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLVLFFFFTAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE 837          

HSP 2 Score: 246.899 bits (629), Expect = 0.000e+0
Identity = 146/228 (64.04%), Postives = 173/228 (75.88%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPSEMGR----GTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Human
Match: ATP6V0A1 (ATPase H+ transporting V0 subunit a1 [Source:HGNC Symbol;Acc:HGNC:865])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 365/631 (57.84%), Postives = 461/631 (73.06%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLS-----VTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K+++E+++T F GRYIILLMG+FS+YTGLIYND FSKS+N+FGSSW     +   +   T+    ++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          +     Y GQ  IQ  LVV+A++C+PWML  KP +LR++ +  K    LN G I    G   E  ++   D LS       +  E E F+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGLS  +  G +VLF  F  +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PFSFE I E K+EE
Sbjct:  174 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLNIFGSSWSVRPMFTYNWTEETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPE--------SGYSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDADEPSEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLVLFFFFTAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE 794          

HSP 2 Score: 155.221 bits (391), Expect = 3.331e-38
Identity = 70/98 (71.43%), Postives = 83/98 (84.69%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLE 327
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLE 98          

HSP 3 Score: 87.0409 bits (214), Expect = 8.928e-17
Identity = 40/61 (65.57%), Postives = 46/61 (75.41%), Query Frame = 1
Query:  535 GQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:  120 GTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 180          
BLAST of V-type proton ATPase subunit a vs. Ensembl Celegans
Match: unc-32 (Probable V-type proton ATPase 116 kDa subunit a [Source:UniProtKB/Swiss-Prot;Acc:P30628])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 340/637 (53.38%), Postives = 437/637 (68.60%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNI-------YKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAK-NKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTS----------KDSYCAPSLLIGLINMFMFNYNTPPTV--AGQCNPN---GTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXX------------XXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            K VF+IFFQGD LK +V KICEGF  ++YPCPD+  ERREM+IGVM+RIEDL+TVL QTQ+HRHRVL+AA+KN++ W  KVRKIK+IY+ LN+FN+DVT KC+I E WC + +L+RIK+AL+ G + S S V  ++N++ +N  + PPTYNK NKFT  FQ+IVDAYG+A YRE+NPAP+T+I+FPFLFAVMFGD GHG IML+ A++ +L EK+ E  +  DEI+ TFFGGRY+I LMG FSIYTG +YND+FSKSIN FGSSW   I       Y +      S + L P  T      YP G+DPVW  A+ NK++F NS+KMK+S+++G+ QM FGV+LS  N  +++  L I   FIPQMIFL SIF YL I+I  KW+ F +            S CAPSLLIGLINMFM        V  +G+  P     T+Y GQA I+ ILVV+A++ +P MLFAKP+ L +R+    R   L  + N    V R D+   D   V    +  +             E G+ +V+Q IHTIE+ LGC+S+TASYLRLWALSLAH QLS+VLW MV R       Y G++  +I+F  + SL+VF+L+LMEGLSAFLHALRLHWVEFQ+KFY G GY+
Sbjct:  242 KCVFIIFFQGDHLKTKVKKICEGFRATLYPCPDTPQERREMSIGVMTRIEDLKTVLGQTQDHRHRVLVAASKNVRMWLTKVRKIKSIYHTLNLFNIDVTQKCLIAEVWCPIAELDRIKMALKRGTDESGSQVPSILNRMETN--EAPPTYNKTNKFTKGFQNIVDAYGIATYREINPAPYTMISFPFLFAVMFGDMGHGAIMLLAALFFILKEKQLEAARIKDEIFQTFFGGRYVIFLMGAFSIYTGFMYNDVFSKSINTFGSSWQNTIPESVIDYYLDDEKRSESQLILPP-ETAFDGNPYPIGVDPVWNLAEGNKLSFLNSMKMKMSVLFGIAQMTFGVLLSYQNFIYFKSDLDIKYMFIPQMIFLSSIFIYLCIQILSKWLFFGAVGGTVLGYKYPGSNCAPSLLIGLINMFMMKSRNAGFVDDSGETYPQCYLSTWYPGQATIEIILVVLALVQVPIMLFAKPYFLYRRDKQQSRYSTLTAESNQHQSV-RADINQDDAEVVHAPEQTPKPSGHGHGHGDGPLEMGDVMVYQAIHTIEFVLGCVSHTASYLRLWALSLAHAQLSDVLWTMVFRNAFVLDGYTGAIATYILFFIFGSLSVFILVLMEGLSAFLHALRLHWVEFQSKFYGGLGYE 874          

HSP 2 Score: 229.565 bits (584), Expect = 0.000e+0
Identity = 132/233 (56.65%), Postives = 171/233 (73.39%), Query Frame = 1
Query:   43 LFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQ--------GLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            ++RS++M L QL+L ++ +Y C++ELGELG+VQF+D +PD S+F RK+VNEVRRCDEMERKLR+LE+EI+KD IP+LDTG+NP+AP PRE+IDLE+TFEKLE EL+EVN N E LKKN+ EL ELK ILRKTQ FF+E     + + ES  +          ++G+         L+L FVAGVI RERL AFER+LWRACRGNV+L+ +EID  L D ++G  V      IF
Sbjct:   16 IYRSEQMCLAQLYLQSDASYQCVAELGELGLVQFRDLNPDVSSFQRKYVNEVRRCDEMERKLRYLEREIKKDQIPMLDTGENPDAPLPREMIDLEATFEKLENELREVNKNEETLKKNFSELTELKHILRKTQTFFEEHEDMIASSAESSGIGEVLSADEEELSGRFSDAMSPLKLQLRFVAGVIQRERLPAFERLLWRACRGNVFLRTSEIDDVLNDTVTGDPVNKCVFIIF 248          
BLAST of V-type proton ATPase subunit a vs. Ensembl Celegans
Match: unc-32 (Probable V-type proton ATPase 116 kDa subunit a [Source:UniProtKB/Swiss-Prot;Acc:P30628])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 340/637 (53.38%), Postives = 437/637 (68.60%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNI-------YKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAK-NKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTS----------KDSYCAPSLLIGLINMFMFNYNTPPTV--AGQCNPN---GTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXX------------XXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            K VF+IFFQGD LK +V KICEGF  ++YPCPD+  ERREM+IGVM+RIEDL+TVL QTQ+HRHRVL+AA+KN++ W  KVRKIK+IY+ LN+FN+DVT KC+I E WC + +L+RIK+AL+ G + S S V  ++N++ +N  + PPTYNK NKFT  FQ+IVDAYG+A YRE+NPAP+T+I+FPFLFAVMFGD GHG IML+ A++ +L EK+ E  +  DEI+ TFFGGRY+I LMG FSIYTG +YND+FSKSIN FGSSW   I       Y +      S + L P  T      YP G+DPVW  A+ NK++F NS+KMK+S+++G+ QM FGV+LS  N  +++  L I   FIPQMIFL SIF YL I+I  KW+ F +            S CAPSLLIGLINMFM        V  +G+  P     T+Y GQA I+ ILVV+A++ +P MLFAKP+ L +R+    R   L  + N    V R D+   D   V    +  +             E G+ +V+Q IHTIE+ LGC+S+TASYLRLWALSLAH QLS+VLW MV R       Y G++  +I+F  + SL+VF+L+LMEGLSAFLHALRLHWVEFQ+KFY G GY+
Sbjct:  237 KCVFIIFFQGDHLKTKVKKICEGFRATLYPCPDTPQERREMSIGVMTRIEDLKTVLGQTQDHRHRVLVAASKNVRMWLTKVRKIKSIYHTLNLFNIDVTQKCLIAEVWCPIAELDRIKMALKRGTDESGSQVPSILNRMETN--EAPPTYNKTNKFTKGFQNIVDAYGIATYREINPAPYTMISFPFLFAVMFGDMGHGAIMLLAALFFILKEKQLEAARIKDEIFQTFFGGRYVIFLMGAFSIYTGFMYNDVFSKSINTFGSSWQNTIPESVIDYYLDDEKRSESQLILPP-ETAFDGNPYPIGVDPVWNLAEGNKLSFLNSMKMKMSVLFGIAQMTFGVLLSYQNFIYFKSDLDIKYMFIPQMIFLSSIFIYLCIQILSKWLFFGAVGGTVLGYKYPGSNCAPSLLIGLINMFMMKSRNAGFVDDSGETYPQCYLSTWYPGQATIEIILVVLALVQVPIMLFAKPYFLYRRDKQQSRYSTLTAESNQHQSV-RADINQDDAEVVHAPEQTPKPSGHGHGHGDGPLEMGDVMVYQAIHTIEFVLGCVSHTASYLRLWALSLAHAQLSDVLWTMVFRNAFVLDGYTGAIATYILFFIFGSLSVFILVLMEGLSAFLHALRLHWVEFQSKFYGGLGYE 869          

HSP 2 Score: 233.417 bits (594), Expect = 0.000e+0
Identity = 132/229 (57.64%), Postives = 167/229 (72.93%), Query Frame = 1
Query:   40 SLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL---RLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
             ++RS++M L QL+L ++ +Y C++ELGELG+VQF+D +PD S+F RK+VNEVRRCDEMERKLR+LE+EI+KD IP+LDTG+NP+AP PRE+IDLE+TFEKLE EL+EVN N E LKKN+ EL ELK ILRKTQ FF+E      +   ++E      L     AG        GFVAGVI RERL AFER+LWRACRGNV+L+ +EID  L D ++G  V      IF
Sbjct:   15 GIYRSEQMCLAQLYLQSDASYQCVAELGELGLVQFRDLNPDVSSFQRKYVNEVRRCDEMERKLRYLEREIKKDQIPMLDTGENPDAPLPREMIDLEATFEKLENELREVNKNEETLKKNFSELTELKHILRKTQTFFEEAGTGEMLPPAAVESEEGLELTQHAAAGGATMFANFGFVAGVIQRERLPAFERLLWRACRGNVFLRTSEIDDVLNDTVTGDPVNKCVFIIF 243          
BLAST of V-type proton ATPase subunit a vs. Ensembl Celegans
Match: unc-32 (Probable V-type proton ATPase 116 kDa subunit a [Source:UniProtKB/Swiss-Prot;Acc:P30628])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 340/637 (53.38%), Postives = 437/637 (68.60%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNI-------YKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAK-NKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTS----------KDSYCAPSLLIGLINMFMFNYNTPPTV--AGQCNPN---GTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXX------------XXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            K VF+IFFQGD LK +V KICEGF  ++YPCPD+  ERREM+IGVM+RIEDL+TVL QTQ+HRHRVL+AA+KN++ W  KVRKIK+IY+ LN+FN+DVT KC+I E WC + +L+RIK+AL+ G + S S V  ++N++ +N  + PPTYNK NKFT  FQ+IVDAYG+A YRE+NPAP+T+I+FPFLFAVMFGD GHG IML+ A++ +L EK+ E  +  DEI+ TFFGGRY+I LMG FSIYTG +YND+FSKSIN FGSSW   I       Y +      S + L P  T      YP G+DPVW  A+ NK++F NS+KMK+S+++G+ QM FGV+LS  N  +++  L I   FIPQMIFL SIF YL I+I  KW+ F +            S CAPSLLIGLINMFM        V  +G+  P     T+Y GQA I+ ILVV+A++ +P MLFAKP+ L +R+    R   L  + N    V R D+   D   V    +  +             E G+ +V+Q IHTIE+ LGC+S+TASYLRLWALSLAH QLS+VLW MV R       Y G++  +I+F  + SL+VF+L+LMEGLSAFLHALRLHWVEFQ+KFY G GY+
Sbjct:  253 KCVFIIFFQGDHLKTKVKKICEGFRATLYPCPDTPQERREMSIGVMTRIEDLKTVLGQTQDHRHRVLVAASKNVRMWLTKVRKIKSIYHTLNLFNIDVTQKCLIAEVWCPIAELDRIKMALKRGTDESGSQVPSILNRMETN--EAPPTYNKTNKFTKGFQNIVDAYGIATYREINPAPYTMISFPFLFAVMFGDMGHGAIMLLAALFFILKEKQLEAARIKDEIFQTFFGGRYVIFLMGAFSIYTGFMYNDVFSKSINTFGSSWQNTIPESVIDYYLDDEKRSESQLILPP-ETAFDGNPYPIGVDPVWNLAEGNKLSFLNSMKMKMSVLFGIAQMTFGVLLSYQNFIYFKSDLDIKYMFIPQMIFLSSIFIYLCIQILSKWLFFGAVGGTVLGYKYPGSNCAPSLLIGLINMFMMKSRNAGFVDDSGETYPQCYLSTWYPGQATIEIILVVLALVQVPIMLFAKPYFLYRRDKQQSRYSTLTAESNQHQSV-RADINQDDAEVVHAPEQTPKPSGHGHGHGDGPLEMGDVMVYQAIHTIEFVLGCVSHTASYLRLWALSLAHAQLSDVLWTMVFRNAFVLDGYTGAIATYILFFIFGSLSVFILVLMEGLSAFLHALRLHWVEFQSKFYGGLGYE 885          

HSP 2 Score: 232.261 bits (591), Expect = 0.000e+0
Identity = 136/244 (55.74%), Postives = 173/244 (70.90%), Query Frame = 1
Query:   43 LFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSM-----------------NXXXXXXXXXXXXXXXXMAGQG--LRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            ++RS++M L QL+L ++ +Y C++ELGELG+VQF+D +PD S+F RK+VNEVRRCDEMERKLR+LE+EI+KD IP+LDTG+NP+AP PRE+IDLE+TFEKLE EL+EVN N E LKKN+ EL ELK ILRKTQ FF+E  HD                        +++   +   A  M+ Q   LRLGFVAGVI RERL AFER+LWRACRGNV+L+ +EID  L D ++G  V      IF
Sbjct:   16 IYRSEQMCLAQLYLQSDASYQCVAELGELGLVQFRDLNPDVSSFQRKYVNEVRRCDEMERKLRYLEREIKKDQIPMLDTGENPDAPLPREMIDLEATFEKLENELREVNKNEETLKKNFSELTELKHILRKTQTFFEEVDHDRWRILEGGSGRRGRSTEREETRPLIDIGDMDDDSAARMSAQAAMLRLGFVAGVIQRERLPAFERLLWRACRGNVFLRTSEIDDVLNDTVTGDPVNKCVFIIF 259          
BLAST of V-type proton ATPase subunit a vs. Ensembl Celegans
Match: unc-32 (Probable V-type proton ATPase 116 kDa subunit a [Source:UniProtKB/Swiss-Prot;Acc:P30628])

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 334/630 (53.02%), Postives = 430/630 (68.25%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNI-------YKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAK-NKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTS----------KDSYCAPSLLIGLINMFMFNYNTPPTV--AGQCNPN---GTFYRGQAAIQSILVVMAIICIPWMLFAKPFIL----RKRNISSKRTENLNGKIN-DIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            K VF+IFFQGD LK +V KICEGF  ++YPCPD+  ERREM+IGVM+RIEDL+TVL QTQ+HRHRVL+AA+KN++ W  KVRKIK+IY+ LN+FN+DVT KC+I E WC + +L+RIK+AL+ G + S S V  ++N++ +N  + PPTYNK NKFT  FQ+IVDAYG+A YRE+NPAP+T+I+FPFLFAVMFGD GHG IML+ A++ +L EK+ E  +  DEI+ TFFGGRY+I LMG FSIYTG +YND+FSKSIN FGSSW   I       Y +      S + L P  T      YP G+DPVW  A+ NK++F NS+KMK+S+++G+ QM FGV+LS  N  +++  L I   FIPQMIFL SIF YL I+I  KW+ F +            S CAPSLLIGLINMFM        V  +G+  P     T+Y GQ+  ++I V++AI C+P MLF KP+ L    ++R     R  ++   IN D   V                      E G+ +V+Q IHTIE+ LGC+S+TASYLRLWALSLAH QLS+VLW MV R       Y G++  +I+F  + SL+VF+L+LMEGLSAFLHALRLHWVEFQ+KFY G GY+
Sbjct:  242 KCVFIIFFQGDHLKTKVKKICEGFRATLYPCPDTPQERREMSIGVMTRIEDLKTVLGQTQDHRHRVLVAASKNVRMWLTKVRKIKSIYHTLNLFNIDVTQKCLIAEVWCPIAELDRIKMALKRGTDESGSQVPSILNRMETN--EAPPTYNKTNKFTKGFQNIVDAYGIATYREINPAPYTMISFPFLFAVMFGDMGHGAIMLLAALFFILKEKQLEAARIKDEIFQTFFGGRYVIFLMGAFSIYTGFMYNDVFSKSINTFGSSWQNTIPESVIDYYLDDEKRSESQLILPP-ETAFDGNPYPIGVDPVWNLAEGNKLSFLNSMKMKMSVLFGIAQMTFGVLLSYQNFIYFKSDLDIKYMFIPQMIFLSSIFIYLCIQILSKWLFFGAVGGTVLGYKYPGSNCAPSLLIGLINMFMMKSRNAGFVDDSGETYPQCYLSTWYPGQSFFETIFVLVAIACVPVMLFGKPYFLWKEEKERREGGHRQLSVRADINQDDAEVVHAPEQTPKPSGHGHGHGDGPLEMGDVMVYQAIHTIEFVLGCVSHTASYLRLWALSLAHAQLSDVLWTMVFRNAFVLDGYTGAIATYILFFIFGSLSVFILVLMEGLSAFLHALRLHWVEFQSKFYGGLGYE 868          

HSP 2 Score: 228.794 bits (582), Expect = 0.000e+0
Identity = 132/234 (56.41%), Postives = 171/234 (73.08%), Query Frame = 1
Query:   40 SLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQ--------GLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
             ++RS++M L QL+L ++ +Y C++ELGELG+VQF+D +PD S+F RK+VNEVRRCDEMERKLR+LE+EI+KD IP+LDTG+NP+AP PRE+IDLE+TFEKLE EL+EVN N E LKKN+ EL ELK ILRKTQ FF+E     + + ES  +          ++G+         L+L FVAGVI RERL AFER+LWRACRGNV+L+ +EID  L D ++G  V      IF
Sbjct:   15 GIYRSEQMCLAQLYLQSDASYQCVAELGELGLVQFRDLNPDVSSFQRKYVNEVRRCDEMERKLRYLEREIKKDQIPMLDTGENPDAPLPREMIDLEATFEKLENELREVNKNEETLKKNFSELTELKHILRKTQTFFEEHEDMIASSAESSGIGEVLSADEEELSGRFSDAMSPLKLQLRFVAGVIQRERLPAFERLLWRACRGNVFLRTSEIDDVLNDTVTGDPVNKCVFIIF 248          
BLAST of V-type proton ATPase subunit a vs. Ensembl Celegans
Match: unc-32 (Probable V-type proton ATPase 116 kDa subunit a [Source:UniProtKB/Swiss-Prot;Acc:P30628])

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 334/630 (53.02%), Postives = 430/630 (68.25%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNI-------YKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAK-NKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTS----------KDSYCAPSLLIGLINMFMFNYNTPPTV--AGQCNPN---GTFYRGQAAIQSILVVMAIICIPWMLFAKPFIL----RKRNISSKRTENLNGKIN-DIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            K VF+IFFQGD LK +V KICEGF  ++YPCPD+  ERREM+IGVM+RIEDL+TVL QTQ+HRHRVL+AA+KN++ W  KVRKIK+IY+ LN+FN+DVT KC+I E WC + +L+RIK+AL+ G + S S V  ++N++ +N  + PPTYNK NKFT  FQ+IVDAYG+A YRE+NPAP+T+I+FPFLFAVMFGD GHG IML+ A++ +L EK+ E  +  DEI+ TFFGGRY+I LMG FSIYTG +YND+FSKSIN FGSSW   I       Y +      S + L P  T      YP G+DPVW  A+ NK++F NS+KMK+S+++G+ QM FGV+LS  N  +++  L I   FIPQMIFL SIF YL I+I  KW+ F +            S CAPSLLIGLINMFM        V  +G+  P     T+Y GQ+  ++I V++AI C+P MLF KP+ L    ++R     R  ++   IN D   V                      E G+ +V+Q IHTIE+ LGC+S+TASYLRLWALSLAH QLS+VLW MV R       Y G++  +I+F  + SL+VF+L+LMEGLSAFLHALRLHWVEFQ+KFY G GY+
Sbjct:  237 KCVFIIFFQGDHLKTKVKKICEGFRATLYPCPDTPQERREMSIGVMTRIEDLKTVLGQTQDHRHRVLVAASKNVRMWLTKVRKIKSIYHTLNLFNIDVTQKCLIAEVWCPIAELDRIKMALKRGTDESGSQVPSILNRMETN--EAPPTYNKTNKFTKGFQNIVDAYGIATYREINPAPYTMISFPFLFAVMFGDMGHGAIMLLAALFFILKEKQLEAARIKDEIFQTFFGGRYVIFLMGAFSIYTGFMYNDVFSKSINTFGSSWQNTIPESVIDYYLDDEKRSESQLILPP-ETAFDGNPYPIGVDPVWNLAEGNKLSFLNSMKMKMSVLFGIAQMTFGVLLSYQNFIYFKSDLDIKYMFIPQMIFLSSIFIYLCIQILSKWLFFGAVGGTVLGYKYPGSNCAPSLLIGLINMFMMKSRNAGFVDDSGETYPQCYLSTWYPGQSFFETIFVLVAIACVPVMLFGKPYFLWKEEKERREGGHRQLSVRADINQDDAEVVHAPEQTPKPSGHGHGHGDGPLEMGDVMVYQAIHTIEFVLGCVSHTASYLRLWALSLAHAQLSDVLWTMVFRNAFVLDGYTGAIATYILFFIFGSLSVFILVLMEGLSAFLHALRLHWVEFQSKFYGGLGYE 863          

HSP 2 Score: 233.032 bits (593), Expect = 0.000e+0
Identity = 132/229 (57.64%), Postives = 167/229 (72.93%), Query Frame = 1
Query:   40 SLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL---RLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
             ++RS++M L QL+L ++ +Y C++ELGELG+VQF+D +PD S+F RK+VNEVRRCDEMERKLR+LE+EI+KD IP+LDTG+NP+AP PRE+IDLE+TFEKLE EL+EVN N E LKKN+ EL ELK ILRKTQ FF+E      +   ++E      L     AG        GFVAGVI RERL AFER+LWRACRGNV+L+ +EID  L D ++G  V      IF
Sbjct:   15 GIYRSEQMCLAQLYLQSDASYQCVAELGELGLVQFRDLNPDVSSFQRKYVNEVRRCDEMERKLRYLEREIKKDQIPMLDTGENPDAPLPREMIDLEATFEKLENELREVNKNEETLKKNFSELTELKHILRKTQTFFEEAGTGEMLPPAAVESEEGLELTQHAAAGGATMFANFGFVAGVIQRERLPAFERLLWRACRGNVFLRTSEIDDVLNDTVTGDPVNKCVFIIF 243          
BLAST of V-type proton ATPase subunit a vs. Ensembl Fly
Match: Vha100-1 (gene:FBgn0028671 transcript:FBtr0301651)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 347/608 (57.07%), Postives = 436/608 (71.71%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNA-KNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKD-----SYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKP-FILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGY 2497
            KSVF+IFFQGDQLK RV KICEGF  ++YPCP++  +RREMA+GVM+RIEDL TVL QTQ+HRHRVL+AAAKNLKNWF KVRKIKAIY+ LN+FNLDVT KC+I ECW  L D+E I+LALR G ERS SSV P++N++ +   + PPTYN+ NKFT AFQ ++DAYGVA YRE+NPAP+TIITFPFLFAVMFGD GHG IM +F +WM+  EK    +K+D+EIWN FFGGRYII LMG+FS+YTGLIYNDIFSKS+N+FGS W+ + Y  +T+     +QL P         YPFG+DP+WQ A  NKI F N+ KMKISII+GV  M FGV++S  NH ++++++ +  EFIPQ++FLL +F Y+++ +F KWI F + +       CAPS+LI  I+M +FN   PP      N     + GQ  IQ + V++A+ CIP ML AKP  I++ R  +++  + + G  +D       +               EE E  E  +HQ IHTIEY LG +S+TASYLRLWALSLAH QL+EVLW MVL IGL Q    G +VL  VFAFW+ LTV +L+LMEGLSAFLH LRLHWVEFQ+KFY G GY
Sbjct:  237 KSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNRMQTF--ENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGSHWHLS-YNKSTVMENKFLQLSP-KGDYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPE----NCETYMFMGQHFIQVLFVLVAVGCIPVMLLAKPLLIMQARKQANEEVQPIAGATSDAEAGGVSNS----GSHGGGGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGY 832          

HSP 2 Score: 266.159 bits (679), Expect = 0.000e+0
Identity = 154/245 (62.86%), Postives = 184/245 (75.10%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL---RLG--------------FVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EMALCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLR+LEKEI+KD IP+LDTG++PEAP PRE+IDLE+TFEKLE EL+EVN NAE LK+N+LEL ELK ILRKTQ+FFDE   +  +N+ +  +           AG  +   +LG              FVAGVILRERL AFERMLWRACRGNV+L+QA I+T LEDP +G +V  S   IF
Sbjct:    1 MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKRNFLELTELKHILRKTQVFFDE--QEGGVNQTTESMTRALITDEARTAGASMGPVQLGYMEKSNEREDYLPCFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIF 243          
BLAST of V-type proton ATPase subunit a vs. Ensembl Fly
Match: Vha100-1 (gene:FBgn0028671 transcript:FBtr0301650)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 347/608 (57.07%), Postives = 436/608 (71.71%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNA-KNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKD-----SYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKP-FILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGY 2497
            KSVF+IFFQGDQLK RV KICEGF  ++YPCP++  +RREMA+GVM+RIEDL TVL QTQ+HRHRVL+AAAKNLKNWF KVRKIKAIY+ LN+FNLDVT KC+I ECW  L D+E I+LALR G ERS SSV P++N++ +   + PPTYN+ NKFT AFQ ++DAYGVA YRE+NPAP+TIITFPFLFAVMFGD GHG IM +F +WM+  EK    +K+D+EIWN FFGGRYII LMG+FS+YTGLIYNDIFSKS+N+FGS W+ + Y  +T+     +QL P         YPFG+DP+WQ A  NKI F N+ KMKISII+GV  M FGV++S  NH ++++++ +  EFIPQ++FLL +F Y+++ +F KWI F + +       CAPS+LI  I+M +FN   PP      N     + GQ  IQ + V++A+ CIP ML AKP  I++ R  +++  + + G  +D       +               EE E  E  +HQ IHTIEY LG +S+TASYLRLWALSLAH QL+EVLW MVL IGL Q    G +VL  VFAFW+ LTV +L+LMEGLSAFLH LRLHWVEFQ+KFY G GY
Sbjct:  237 KSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNRMQTF--ENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGSHWHLS-YNKSTVMENKFLQLSP-KGDYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPE----NCETYMFMGQHFIQVLFVLVAVGCIPVMLLAKPLLIMQARKQANEEVQPIAGATSDAEAGGVSNS----GSHGGGGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGY 832          

HSP 2 Score: 266.159 bits (679), Expect = 0.000e+0
Identity = 154/245 (62.86%), Postives = 184/245 (75.10%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL---RLG--------------FVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EMALCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLR+LEKEI+KD IP+LDTG++PEAP PRE+IDLE+TFEKLE EL+EVN NAE LK+N+LEL ELK ILRKTQ+FFDE   +  +N+ +  +           AG  +   +LG              FVAGVILRERL AFERMLWRACRGNV+L+QA I+T LEDP +G +V  S   IF
Sbjct:    1 MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKRNFLELTELKHILRKTQVFFDE--QEGGVNQTTESMTRALITDEARTAGASMGPVQLGYMEKSNEREDYLPCFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIF 243          
BLAST of V-type proton ATPase subunit a vs. Ensembl Fly
Match: Vha100-1 (gene:FBgn0028671 transcript:FBtr0335405)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 345/607 (56.84%), Postives = 434/607 (71.50%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNA-KNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKD-----SYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGY 2497
            KSVF+IFFQGDQLK RV KICEGF  ++YPCP++  +RREMA+GVM+RIEDL TVL QTQ+HRHRVL+AAAKNLKNWF KVRKIKAIY+ LN+FNLDVT KC+I ECW  L D+E I+LALR G ERS SSV P++N++ +   + PPTYN+ NKFT AFQ ++DAYGVA YRE+NPAP+TIITFPFLFAVMFGD GHG IM +F +WM+  EK    +K+D+EIWN FFGGRYII LMG+FS+YTGLIYNDIFSKS+N+FGS W+ + Y  +T+     +QL P         YPFG+DP+WQ A  NKI F N+ KMKISII+GV  M FGV++S  NH ++++++ +  EFIPQ++FLL +F Y+++ +F KWI F + +       CAPS+LI  I+M +FN   PP      N     + GQ  IQ + V++A+ CIP ML AKP ++    + +++  N+          E   + +            EE E  E  +HQ IHTIEY LG +S+TASYLRLWALSLAH QL+EVLW MVL IGL Q    G +VL  VFAFW+ LTV +L+LMEGLSAFLH LRLHWVEFQ+KFY G GY
Sbjct:  223 KSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNRMQTF--ENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGSHWHLS-YNKSTVMENKFLQLSP-KGDYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPE----NCETYMFMGQHFIQVLFVLVAVGCIPVMLLAKPLLI----MQARKQANVQPIAGATSDAEAGGV-SNSGSHGGGGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGY 816          

HSP 2 Score: 276.174 bits (705), Expect = 0.000e+0
Identity = 154/231 (66.67%), Postives = 184/231 (79.65%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL---RLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EMALCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLR+LEKEI+KD IP+LDTG++PEAP PRE+IDLE+TFEKLE EL+EVN NAE LK+N+LEL ELK ILRKTQ+FFDE   +  +N+ +  +           AG  +   +LGFVAGVILRERL AFERMLWRACRGNV+L+QA I+T LEDP +G +V  S   IF
Sbjct:    1 MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKRNFLELTELKHILRKTQVFFDE--QEGGVNQTTESMTRALITDEARTAGASMGPVQLGFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIF 229          
BLAST of V-type proton ATPase subunit a vs. Ensembl Fly
Match: Vha100-1 (gene:FBgn0028671 transcript:FBtr0085375)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 345/607 (56.84%), Postives = 434/607 (71.50%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNA-KNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKD-----SYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGY 2497
            KSVF+IFFQGDQLK RV KICEGF  ++YPCP++  +RREMA+GVM+RIEDL TVL QTQ+HRHRVL+AAAKNLKNWF KVRKIKAIY+ LN+FNLDVT KC+I ECW  L D+E I+LALR G ERS SSV P++N++ +   + PPTYN+ NKFT AFQ ++DAYGVA YRE+NPAP+TIITFPFLFAVMFGD GHG IM +F +WM+  EK    +K+D+EIWN FFGGRYII LMG+FS+YTGLIYNDIFSKS+N+FGS W+ + Y  +T+     +QL P         YPFG+DP+WQ A  NKI F N+ KMKISII+GV  M FGV++S  NH ++++++ +  EFIPQ++FLL +F Y+++ +F KWI F + +       CAPS+LI  I+M +FN   PP      N     + GQ  IQ + V++A+ CIP ML AKP ++    + +++  N+          E   + +            EE E  E  +HQ IHTIEY LG +S+TASYLRLWALSLAH QL+EVLW MVL IGL Q    G +VL  VFAFW+ LTV +L+LMEGLSAFLH LRLHWVEFQ+KFY G GY
Sbjct:  223 KSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNRMQTF--ENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGSHWHLS-YNKSTVMENKFLQLSP-KGDYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPE----NCETYMFMGQHFIQVLFVLVAVGCIPVMLLAKPLLI----MQARKQANVQPIAGATSDAEAGGV-SNSGSHGGGGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGY 816          

HSP 2 Score: 276.174 bits (705), Expect = 0.000e+0
Identity = 154/231 (66.67%), Postives = 184/231 (79.65%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL---RLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EMALCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLR+LEKEI+KD IP+LDTG++PEAP PRE+IDLE+TFEKLE EL+EVN NAE LK+N+LEL ELK ILRKTQ+FFDE   +  +N+ +  +           AG  +   +LGFVAGVILRERL AFERMLWRACRGNV+L+QA I+T LEDP +G +V  S   IF
Sbjct:    1 MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKRNFLELTELKHILRKTQVFFDE--QEGGVNQTTESMTRALITDEARTAGASMGPVQLGFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIF 229          
BLAST of V-type proton ATPase subunit a vs. Ensembl Fly
Match: Vha100-1 (gene:FBgn0028671 transcript:FBtr0085380)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 345/607 (56.84%), Postives = 434/607 (71.50%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNA-KNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKD-----SYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGY 2497
            KSVF+IFFQGDQLK RV KICEGF  ++YPCP++  +RREMA+GVM+RIEDL TVL QTQ+HRHRVL+AAAKNLKNWF KVRKIKAIY+ LN+FNLDVT KC+I ECW  L D+E I+LALR G ERS SSV P++N++ +   + PPTYN+ NKFT AFQ ++DAYGVA YRE+NPAP+TIITFPFLFAVMFGD GHG IM +F +WM+  EK    +K+D+EIWN FFGGRYII LMG+FS+YTGLIYNDIFSKS+N+FGS W+ + Y  +T+     +QL P         YPFG+DP+WQ A  NKI F N+ KMKISII+GV  M FGV++S  NH ++++++ +  EFIPQ++FLL +F Y+++ +F KWI F + +       CAPS+LI  I+M +FN   PP      N     + GQ  IQ + V++A+ CIP ML AKP ++    + +++  N+          E   + +            EE E  E  +HQ IHTIEY LG +S+TASYLRLWALSLAH QL+EVLW MVL IGL Q    G +VL  VFAFW+ LTV +L+LMEGLSAFLH LRLHWVEFQ+KFY G GY
Sbjct:  223 KSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNRMQTF--ENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGSHWHLS-YNKSTVMENKFLQLSP-KGDYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPE----NCETYMFMGQHFIQVLFVLVAVGCIPVMLLAKPLLI----MQARKQANVQPIAGATSDAEAGGV-SNSGSHGGGGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGY 816          

HSP 2 Score: 276.174 bits (705), Expect = 0.000e+0
Identity = 154/231 (66.67%), Postives = 184/231 (79.65%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL---RLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EMALCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLR+LEKEI+KD IP+LDTG++PEAP PRE+IDLE+TFEKLE EL+EVN NAE LK+N+LEL ELK ILRKTQ+FFDE   +  +N+ +  +           AG  +   +LGFVAGVILRERL AFERMLWRACRGNV+L+QA I+T LEDP +G +V  S   IF
Sbjct:    1 MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKRNFLELTELKHILRKTQVFFDE--QEGGVNQTTESMTRALITDEARTAGASMGPVQLGFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIF 229          
BLAST of V-type proton ATPase subunit a vs. Ensembl Zebrafish
Match: atp6v0a1b (ATPase H+ transporting V0 subunit a1b [Source:ZFIN;Acc:ZDB-GENE-050522-215])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 352/617 (57.05%), Postives = 446/617 (72.29%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW------YPN-IYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENL------NGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G ERS S+V  ++N++ +  K  PPTYNK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M   A+++VL E +   +KSD+E++N  F GRYIILLMG+FS+YTGLIYND FSKS+N+F S W       PN  + + T+   S++QL+P  +      YP GIDP+W  A NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L I+  FIP+++F+ S+FGYLI+ IFYKWIA+ +  S  APSLLI  INM +FNYN P         N   YRGQA IQS+LVV+A+ C+P ML  K  ILR++++  K   T+        NG   D   +   D  +  +    +  E E F FG+  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+R+GLS  +  G   L I+F+ +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+K
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKTMRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVSDLDSIQFALRRGTERSGSTVPSILNRMQT--KQTPPTYNKTNKFTSGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDMGHGVLMTSAALYLVLRETRLLAQKSDNEMFNMIFAGRYIILLMGMFSVYTGLIYNDCFSKSLNMFSSGWSVRPMFAPNGNWTDQTLESNSVLQLNPSVSGVFGGPYPLGIDPIWNIAANKLTFLNSFKMKMSVILGVIHMLFGVTLSLFNHLYFKKPLNIFLNFIPEIVFMSSLFGYLILLIFYKWIAYDAVTSKDAPSLLIAFINMCLFNYNDP--------TNKPLYRGQAGIQSLLVVIALACVPVMLVVKTMILRRQHLWKKHLGTQKFGGVRVGNGPTEDEAEIIDHDQLSQHSEEGDEHSEEEPFNFGDMAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWGMVMRLGLSSRSGGGFFGLSIIFSAFATLTVCILLIMEGLSAFLHALRLHWVEFQNKFYTGQGFK 823          

HSP 2 Score: 249.21 bits (635), Expect = 0.000e+0
Identity = 145/230 (63.04%), Postives = 173/230 (75.22%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQG--LRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELGMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  IP +DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D ++      L     L     AG+G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+Q EI+  LEDP +G +V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANIPTMDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPNL------LEESSSLLDPSEAGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQTEIEDPLEDPTTGDQVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Zebrafish
Match: atp6v0a1a (ATPase H+ transporting V0 subunit a1a [Source:ZFIN;Acc:ZDB-GENE-030131-3027])

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 343/613 (55.95%), Postives = 446/613 (72.76%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW--------YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G ERS S+V  ++N++ +  K  PPTYNK NKFT+ FQ IVDAYG++ YRE+NPAP+TIITFPFLFAVMFGD GHG++M   A+++VL E +   +K+D E+++  F GRYIILLMG+FS+YTG+IYND FSKS+N+FGS W          + +  A +  ++++QL+P      +  YP GIDP+W  A NK+TF NS KMK+SII GV  M FGV LSLFNH +++  L IY  FIP++IF++S+FGYL++ IFYKWIA+ +K S  APSLLI  INM +F+YN P         N  FY GQ  IQ +LV++A+ C+P ML  K  ++R++++  +   T+N  G  + +    +  ++   D LS   E E E     E  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  ++ G + L I+F F++ LTVF+LL+MEGLSAFLHAL+LHWVEFQNKFY+G G+K
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMAAGVNTRIDDLQMVLNQTEDHRQRVLQAAAKTVRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEIWCPVSDLDSIQFALRRGTERSGSTVPSILNRMQT--KQTPPTYNKTNKFTSGFQSIVDAYGISNYREMNPAPYTIITFPFLFAVMFGDLGHGVLMTCAALYLVLRESRLIAQKNDSEMFSMVFAGRYIILLMGLFSMYTGIIYNDCFSKSLNIFGSGWSVRPMFGEKGDNWTFAVLEKSNVLQLNPAVPNVFTGPYPVGIDPIWNIATNKLTFLNSFKMKMSIILGVIHMIFGVSLSLFNHLYFRKPLNIYLGFIPEIIFMVSLFGYLVLLIFYKWIAYDAKSSRVAPSLLITFINMCLFSYNDP--------TNKPFYTGQVVIQCLLVIIALSCVPCMLIVKTLVMRRQHLWRRHLGTQNFGGIHVGNGPTEDEAEIIQHDQLSQNTEEEPEFNFADEA-VHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMHMGLSSRSFGGFIFLSIIFCFFAVLTVFILLVMEGLSAFLHALKLHWVEFQNKFYTGQGFK 818          

HSP 2 Score: 249.595 bits (636), Expect = 0.000e+0
Identity = 144/228 (63.16%), Postives = 172/228 (75.44%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E+AY C+SELGE+GMVQF+D +PD +AF RKFVNEVRRC+EM+RKLRF+EKEI+K  IPI+DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D S+    LE                LRLGFVAGVI RER+  FERMLWR CRGNV+L+QA+I+  LEDP +G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSESAYCCVSELGEIGMVQFRDLNPDVNAFQRKFVNEVRRCEEMDRKLRFVEKEIKKANIPIVDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPSL----LEESSTLLDPNEVGRAAPLRLGFVAGVIGRERIPTFERMLWRVCRGNVFLRQADIEDPLEDPATGDNVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Zebrafish
Match: atp6v0a2b (ATPase H+ transporting V0 subunit a2b [Source:ZFIN;Acc:ZDB-GENE-060526-4])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 306/623 (49.12%), Postives = 416/623 (66.77%), Query Frame = 2
Query:  701 VFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-YPNIYKN-----ATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXX-----------------CLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            VFLI + G+Q+  +V KIC+ +H  +YP P+S  ER ++  G+ +RI+DL TVL++T+++  +VLI A++++  W  +V+K+KAIY+ILN+ + DVT KC+I E WC + DL  ++ AL  G  +S ++V   +N+I S+  D PPT  + NKFT+ FQ+IVDAYGV+ YREVNPAP+TIITFPFLFAVMFGD GHG+IM +FA+WMVL E   + KK+ +EIWN FF GRYIILLMG+FS+YTGLIYND FSKS+N+FGS W    +++N     +T+N   L+ LDP  T      YP GIDP+W  A N++TF NS KMK+S+I G+  M FGV+L +FNH  ++  + +Y  F+P+++FLL +FGYL+  I YKW+ FT +DS  APS+LI  INMF+             +     Y GQA  Q  LV++A+  +P +LF KP  +  ++    R       ++   G +R+   + + LS+    ++EE    +                   ++Q IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLWEMV+R+ L      G V+L  VF  ++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G K
Sbjct:  227 VFLISYWGEQIGQKVKKICDCYHCHLYPYPNSNEERTDVVEGLRTRIQDLHTVLHRTEDYLRQVLIKASESVYIWVIQVKKMKAIYHILNLCSFDVTNKCLIAEVWCPVNDLPALRRALEDGSRKSGATVPSFVNRIPSS--DTPPTLIRTNKFTSGFQNIVDAYGVSSYREVNPAPYTIITFPFLFAVMFGDLGHGIIMALFALWMVLYENDRKLKKTRNEIWNIFFEGRYIILLMGVFSVYTGLIYNDCFSKSLNIFGSGWNVSAMFENGDWTLSTVNSNKLLALDPNITGVFKGPYPLGIDPIWNLASNRLTFLNSYKMKMSVIVGIIHMTFGVVLGIFNHLHFRRTINVYLIFLPELLFLLCLFGYLVFMIIYKWLFFTVRDSQTAPSILIHFINMFLM----------MGDSGRPLYPGQAGFQVFLVIVAVFSVPVLLFGKPLYIYWQHKGRDR-------LSMYRGYQRVRRSSEEELSLLHTHDMEEGSSLDSHSSSSDSQSEEPDFPDLFLNQSIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWEMVMRVALHVDTSVGIVLLVPVFGLFAVLTVSILLVMEGLSAFLHALRLHWVEFQNKFYSGVGVK 830          

HSP 2 Score: 167.548 bits (423), Expect = 0.000e+0
Identity = 102/220 (46.36%), Postives = 142/220 (64.55%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXX---XXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISG 684
            MGSLFRS+EM L QLFL + +AY CISELGELG+V+F+D +P  ++F RKFVNE++RC+EMER L +L +EI+K+ IP+ +   NP AP P+ ++ +    ++LE EL EV  N E+L+KN LEL E   +LR T+ F   G    S   +      L  E  +    M   G +LGF++G+I   ++ AFERMLWR C+G   L  +E+D  L+DP SG
Sbjct:    1 MGSLFRSEEMCLAQLFLQSGSAYDCISELGELGLVEFRDLNPSVNSFQRKFVNEIKRCEEMERILGYLLREIKKEDIPLPEGEVNPAAPLPKHVMVIMEQLQRLELELGEVTRNKEKLQKNLLELTEYTHMLRITRNFVHRGTERESTQGQYEEFPFLEKEPMMDYTSMQRLGAKLGFISGLIQSVKIEAFERMLWRVCKGYTILSYSEVDELLDDPDSG 220          
BLAST of V-type proton ATPase subunit a vs. Ensembl Zebrafish
Match: atp6v0a2b (ATPase H+ transporting V0 subunit a2b [Source:ZFIN;Acc:ZDB-GENE-060526-4])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 306/623 (49.12%), Postives = 416/623 (66.77%), Query Frame = 2
Query:  701 VFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-YPNIYKN-----ATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXX-----------------CLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            VFLI + G+Q+  +V KIC+ +H  +YP P+S  ER ++  G+ +RI+DL TVL++T+++  +VLI A++++  W  +V+K+KAIY+ILN+ + DVT KC+I E WC + DL  ++ AL  G  +S ++V   +N+I S+  D PPT  + NKFT+ FQ+IVDAYGV+ YREVNPAP+TIITFPFLFAVMFGD GHG+IM +FA+WMVL E   + KK+ +EIWN FF GRYIILLMG+FS+YTGLIYND FSKS+N+FGS W    +++N     +T+N   L+ LDP  T      YP GIDP+W  A N++TF NS KMK+S+I G+  M FGV+L +FNH  ++  + +Y  F+P+++FLL +FGYL+  I YKW+ FT +DS  APS+LI  INMF+             +     Y GQA  Q  LV++A+  +P +LF KP  +  ++    R       ++   G +R+   + + LS+    ++EE    +                   ++Q IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLWEMV+R+ L      G V+L  VF  ++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G K
Sbjct:  227 VFLISYWGEQIGQKVKKICDCYHCHLYPYPNSNEERTDVVEGLRTRIQDLHTVLHRTEDYLRQVLIKASESVYIWVIQVKKMKAIYHILNLCSFDVTNKCLIAEVWCPVNDLPALRRALEDGSRKSGATVPSFVNRIPSS--DTPPTLIRTNKFTSGFQNIVDAYGVSSYREVNPAPYTIITFPFLFAVMFGDLGHGIIMALFALWMVLYENDRKLKKTRNEIWNIFFEGRYIILLMGVFSVYTGLIYNDCFSKSLNIFGSGWNVSAMFENGDWTLSTVNSNKLLALDPNITGVFKGPYPLGIDPIWNLASNRLTFLNSYKMKMSVIVGIIHMTFGVVLGIFNHLHFRRTINVYLIFLPELLFLLCLFGYLVFMIIYKWLFFTVRDSQTAPSILIHFINMFLM----------MGDSGRPLYPGQAGFQVFLVIVAVFSVPVLLFGKPLYIYWQHKGRDR-------LSMYRGYQRVRRSSEEELSLLHTHDLEEGSSLDSHSSSSDSQSEEPDFPDLFLNQSIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWEMVMRVALHVDTSVGIVLLVPVFGLFAVLTVSILLVMEGLSAFLHALRLHWVEFQNKFYSGVGVK 830          

HSP 2 Score: 167.548 bits (423), Expect = 0.000e+0
Identity = 102/220 (46.36%), Postives = 142/220 (64.55%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXX---XXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISG 684
            MGSLFRS+EM L QLFL + +AY CISELGELG+V+F+D +P  ++F RKFVNE++RC+EMER L +L +EI+K+ IP+ +   NP AP P+ ++ +    ++LE EL EV  N E+L+KN LEL E   +LR T+ F   G    S   +      L  E  +    M   G +LGF++G+I   ++ AFERMLWR C+G   L  +E+D  L+DP SG
Sbjct:    1 MGSLFRSEEMCLAQLFLQSGSAYDCISELGELGLVEFRDLNPSVNSFQRKFVNEIKRCEEMERILGYLLREIKKEDIPLPEGEVNPAAPLPKHVMVIMEQLQRLELELGEVTRNKEKLQKNLLELTEYTHMLRITRNFVHRGTERESTQGQYEEFPFLEKEPMMDYTSMQRLGAKLGFISGLIQSVKIEAFERMLWRVCKGYTILSYSEVDELLDDPDSG 220          
BLAST of V-type proton ATPase subunit a vs. Ensembl Zebrafish
Match: atp6v0a2a (ATPase H+ transporting V0 subunit a2a [Source:ZFIN;Acc:ZDB-GENE-091113-4])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 302/628 (48.09%), Postives = 408/628 (64.97%), Query Frame = 2
Query:  701 VFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW------YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFIL-----------------RKRNISSKR-----TENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            VFLI F GDQ+  +V KIC+ +H  IYP P++  ER ++   + +RI+DL  VL++T+++  +VL  A+++ ++W  +V+K+KAIY+ILN+ + DVT KC+I E WC + DL  ++ AL  G  + +++V   +N+I S+  D PPT  + NKFT+ FQ IV+AYGV  YREV+PAPFTIITFPFLFAVMFGD GHG ++ +FA+WMVL EK +  ++  +EI  T F GRYIIL+MG+FSIYTGLIYND FSKS+N+FGS+W          + N T+    L+ L+P  +   S  YP GIDP+W  A N++TF NS KMK+S+I GV  M FGV+LS+FNH  ++ K  IY  F+P+++FLL +FGYL   IFYKW+A+T++DS  APS+LI  INMF+           Q N     Y GQ  +Q  LVV+A++ +P +L  KP  L                 R R +S +        +    +++ GG +  D G                   +  +HQ IHTIEY LGCISNTASYLRLWALSLAH QLSEVLW MV+R+GL  S+  G + L  VF+ ++ LT+ +LL+MEGLSAFLHALRLHWVEFQNKFYSG G K
Sbjct:  227 VFLISFWGDQIGQKVQKICDCYHCHIYPHPETDEERADVMDSLRTRIQDLHNVLHRTEDYLKQVLHKASESAQSWVLQVKKMKAIYHILNLCSFDVTNKCLIAEVWCPVSDLANLRRALEEGSRKGDATVPSFVNRIPSS--DTPPTLLRSNKFTSGFQSIVEAYGVGDYREVSPAPFTIITFPFLFAVMFGDLGHGSVLTLFALWMVLTEKDHTRRRPGNEIRMTLFDGRYIILMMGLFSIYTGLIYNDCFSKSLNIFGSAWSVKAMFTEQEWTNETLRSNMLLTLNPNVSGVFSGPYPLGIDPIWNMAVNRLTFLNSYKMKMSVIIGVVHMSFGVVLSVFNHLHFRQKYKIYLLFLPELLFLLCLFGYLAFMIFYKWLAYTARDSQLAPSILIHFINMFLM----------QANATSPLYPGQMGLQVFLVVVALLSVPVLLLGKPLYLYWLHHGGKSLGIHRGYERVRRVSEEDLSPSVVHDEEEGLSESGGPQEFDFG-------------------DVFLHQAIHTIEYSLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRLGLRISSRLGVIFLVPVFSVFAVLTISILLVMEGLSAFLHALRLHWVEFQNKFYSGAGVK 823          

HSP 2 Score: 159.073 bits (401), Expect = 0.000e+0
Identity = 97/220 (44.09%), Postives = 139/220 (63.18%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXX---XXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISG 684
            MGS FRS+EM L QLFL + +AY CISELGE+G+V+F+D +P  S+F R+FV+E++RC+EMER L +L +EIRK  I + +    P APAP+ ++++    ++LE EL EV  N E+L++N LEL+E   +LR T+ F        ++  +      L  E       M   G +LGFV+G+I R ++ AFERMLWR C+G   L  AE+D  L D  +G
Sbjct:    1 MGSGFRSEEMCLAQLFLQSGSAYACISELGEMGLVEFRDLNPSVSSFQRRFVSEIKRCEEMERILGYLLREIRKANIAVPEAEVPPVAPAPKNVLEIMEQLQRLEVELSEVAKNKEKLQRNLLELMEYTHMLRITRSFVHSRSRHEALGPQYEEFPSLETESVTGCTSMQRLGAKLGFVSGLIQRVKVEAFERMLWRVCKGYTILSYAEVDESLADLDTG 220          
BLAST of V-type proton ATPase subunit a vs. Ensembl Xenopus
Match: gprc5cl1 (G protein-coupled receptor class C group 5 member C like 1 [Source:Xenbase;Acc:XB-GENE-990339])

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 360/626 (57.51%), Postives = 461/626 (73.64%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RIEDLQ VLNQT++HR RVL AAAK+L+ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ++VDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMV+ E +  ++K D+E++   F GRYIILLMG+FSIYTGLIYND FSK++N+FGSSW     + + +    +  TS++QL+P  T   +  YPFGIDP+W  A NK+TF NS KMK+S++ G+  M FGV LSL NH +++  L IY  FIP+MIF+ ++FGYL+I I YKW A+ +  S  APSLLI  INMF+F+Y        Q       Y+GQ  +Q  LVV AIIC+PWML  KP ILR++ +  K   T N  G ++ +    E  ++   D LS+    E EEF+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  +  G + L  VF+ +++LT+ +LL+MEGLSAFLHALRLHWVEFQNKFY G G+KF+PFSFE I E K++E
Sbjct:  243 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMATGVNTRIEDLQMVLNQTEDHRQRVLQAAAKSLRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVADLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNLVDAYGIGSYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVVRESRILSQKIDNELFTMMFSGRYIILLMGLFSIYTGLIYNDCFSKALNLFGSSWSVRPMFTDTWSEDLLKHTSVLQLNPNVTGVFNGPYPFGIDPIWSLATNKLTFLNSFKMKMSVVLGIIHMTFGVALSLLNHIYFKKPLNIYLGFIPEMIFMTTLFGYLVILIIYKWCAYDASTSMVAPSLLIHFINMFLFSY--------QDTSLPMLYKGQMGLQCFLVVCAIICVPWMLVVKPLILRRQYLRRKHLGTHNFGGIRVGNGPTEEDAEIIQHDQLSM-HSEEGEEFDFGDTVVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMHVGLSIRSLGGGIALVFVFSAFATLTIAILLIMEGLSAFLHALRLHWVEFQNKFYMGTGFKFLPFSFENIREGKFDE 857          

HSP 2 Score: 241.891 bits (616), Expect = 0.000e+0
Identity = 144/229 (62.88%), Postives = 173/229 (75.55%), Query Frame = 1
Query:   31 MMGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            +MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKE++K  I ILDTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:   26 IMGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEVKKANISILDTGENPEVPFPRDMIDLEANFEKIEIELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPSEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDSVHKSVFIIF 249          
BLAST of V-type proton ATPase subunit a vs. Ensembl Xenopus
Match: gprc5cl1 (G protein-coupled receptor class C group 5 member C like 1 [Source:Xenbase;Acc:XB-GENE-990339])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 356/631 (56.42%), Postives = 455/631 (72.11%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXX-----CLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RIEDLQ VLNQT++HR RVL AAAK+L+ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ++VDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMV+ E +  ++K D+E++   F GRYIILLMG+FSIYTGLIYND FSK++N+FGSSW     + + +    +  TS++QL+P  T   +  YPFGIDP+W  A NK+TF NS KMK+S++ G+  M FGV LSL NH +++  L IY  FIP+MIF+ ++FGYL+I I YKW A+ +  S  APSLLI  INMF+F+Y        Q       Y+GQ  +Q  LVV AIIC+PWML  KP ILR++ +  K   T N  G ++ +    E  ++   D LS+  E   E            +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  +  G + L  VF+ +++LT+ +LL+MEGLSAFLHALRLHWVEFQNKFY G G+KF+PFSFE I E K++E
Sbjct:  243 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMATGVNTRIEDLQMVLNQTEDHRQRVLQAAAKSLRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVADLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNLVDAYGIGSYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVVRESRILSQKIDNELFTMMFSGRYIILLMGLFSIYTGLIYNDCFSKALNLFGSSWSVRPMFTDTWSEDLLKHTSVLQLNPNVTGVFNGPYPFGIDPIWSLATNKLTFLNSFKMKMSVVLGIIHMTFGVALSLLNHIYFKKPLNIYLGFIPEMIFMTTLFGYLVILIIYKWCAYDASTSMVAPSLLIHFINMFLFSY--------QDTSLPMLYKGQMGLQCFLVVCAIICVPWMLVVKPLILRRQYLRRKHLGTHNFGGIRVGNGPTEEDAEIIQHDQLSMHSEEGEEPAMEEVFDFGDTVVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMHVGLSIRSLGGGIALVFVFSAFATLTIAILLIMEGLSAFLHALRLHWVEFQNKFYMGTGFKFLPFSFENIREGKFDE 863          

HSP 2 Score: 242.276 bits (617), Expect = 0.000e+0
Identity = 144/229 (62.88%), Postives = 173/229 (75.55%), Query Frame = 1
Query:   31 MMGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            +MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKE++K  I ILDTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:   26 IMGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEVKKANISILDTGENPEVPFPRDMIDLEANFEKIEIELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPSEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDSVHKSVFIIF 249          
BLAST of V-type proton ATPase subunit a vs. Ensembl Xenopus
Match: gprc5cl1 (G protein-coupled receptor class C group 5 member C like 1 [Source:Xenbase;Acc:XB-GENE-990339])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 357/632 (56.49%), Postives = 457/632 (72.31%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXX------XCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RIEDLQ VLNQT++HR RVL AAAK+L+ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ++VDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMV+ E +  ++K D+E++   F GRYIILLMG+FSIYTGLIYND FSK++N+FGSSW     + + +    +  TS++QL+P  T   +  YPFGIDP+W  A NK+TF NS KMK+S++ G+  M FGV LSL NH +++  L IY  FIP+MIF+ ++FGYL+I I YKW A+ +  S  APSLLI  INMF+F+Y        Q       Y+GQ  +Q  LVV AIIC+PWML  KP ILR++ +  K   T N  G ++ +    E  ++   D LS+  E   E   F       + +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  +  G + L  VF+ +++LT+ +LL+MEGLSAFLHALRLHWVEFQNKFY G G+KF+PFSFE I E K++E
Sbjct:  225 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMATGVNTRIEDLQMVLNQTEDHRQRVLQAAAKSLRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVADLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNLVDAYGIGSYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVVRESRILSQKIDNELFTMMFSGRYIILLMGLFSIYTGLIYNDCFSKALNLFGSSWSVRPMFTDTWSEDLLKHTSVLQLNPNVTGVFNGPYPFGIDPIWSLATNKLTFLNSFKMKMSVVLGIIHMTFGVALSLLNHIYFKKPLNIYLGFIPEMIFMTTLFGYLVILIIYKWCAYDASTSMVAPSLLIHFINMFLFSY--------QDTSLPMLYKGQMGLQCFLVVCAIICVPWMLVVKPLILRRQYLRRKHLGTHNFGGIRVGNGPTEEDAEIIQHDQLSMHSEEGEEVPTFDCSFDFGDTVVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMHVGLSIRSLGGGIALVFVFSAFATLTIAILLIMEGLSAFLHALRLHWVEFQNKFYMGTGFKFLPFSFENIREGKFDE 846          

HSP 2 Score: 244.973 bits (624), Expect = 0.000e+0
Identity = 142/231 (61.47%), Postives = 170/231 (73.59%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGM--HDSSMNXXXXXXXXXXXXXXXXMA-GQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKE++K  I ILDTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE    H   M +  L       L+   M  G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEVKKANISILDTGENPEVPFPRDMIDLEANFEKIEIELKEINTNQEALKRNFLELTELKFILRKTQQFFDEAQLHHHQQMADPDLLEESSSLLEPSEMGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDSVHKSVFIIF 231          
BLAST of V-type proton ATPase subunit a vs. Ensembl Xenopus
Match: gprc5cl1 (G protein-coupled receptor class C group 5 member C like 1 [Source:Xenbase;Acc:XB-GENE-990339])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 350/624 (56.09%), Postives = 447/624 (71.63%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIG-GVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RIEDLQ VLNQT++HR RVL AAAK+L+ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ++VDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMV+ E +  ++K D+E++   F GRYIILLMG+FSIYTGLIYND FSK++N+FGSSW     + + +    +  TS++QL+P  T   +  YPFGIDP+W  A NK+TF NS KMK+S++ G+  M FGV LSL NH +++  L IY  FIP+MIF+ ++FGYL+I I YKW A+ +  S  APSLLI  INMF+F+Y        Q       Y+GQ  +Q  LVV AIIC+PWML  KP ILR++ +  K   +    ++ +    E      GD +                 VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  +  G + L  VF+ +++LT+ +LL+MEGLSAFLHALRLHWVEFQNKFY G G+KF+PFSFE I E K++E
Sbjct:  212 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMATGVNTRIEDLQMVLNQTEDHRQRVLQAAAKSLRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVADLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNLVDAYGIGSYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVVRESRILSQKIDNELFTMMFSGRYIILLMGLFSIYTGLIYNDCFSKALNLFGSSWSVRPMFTDTWSEDLLKHTSVLQLNPNVTGVFNGPYPFGIDPIWSLATNKLTFLNSFKMKMSVVLGIIHMTFGVALSLLNHIYFKKPLNIYLGFIPEMIFMTTLFGYLVILIIYKWCAYDASTSMVAPSLLIHFINMFLFSY--------QDTSLPMLYKGQMGLQCFLVVCAIICVPWMLVVKPLILRRQYLRRKHLVSSCTVLSHVTYKHEHKYFDFGDTV-----------------VHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMHVGLSIRSLGGGIALVFVFSAFATLTIAILLIMEGLSAFLHALRLHWVEFQNKFYMGTGFKFLPFSFENIREGKFDE 808          

HSP 2 Score: 237.654 bits (605), Expect = 0.000e+0
Identity = 134/228 (58.77%), Postives = 164/228 (71.93%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKE++K  I ILDTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE  +D   + +                     +GFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEVKKANISILDTGENPEVPFPRDMIDLEANFEKIEIELKEINTNQEALKRNFLELTELKFILRKTQQFFDERRYDLGTSSQLTIRTISLYKA----------VGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDSVHKSVFIIF 218          
BLAST of V-type proton ATPase subunit a vs. Ensembl Xenopus
Match: gprc5cl1 (G protein-coupled receptor class C group 5 member C like 1 [Source:Xenbase;Acc:XB-GENE-990339])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 353/624 (56.57%), Postives = 449/624 (71.96%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLD---PLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RIEDLQ VLNQT++HR RVL AAAK+L+ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ++VDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMV+ E +  ++K D+E++   F GRYIILLMG+FSIYTGLIYND FSK++N+FGSSW              L+ L    P+ +  PS S       +W  A NK+TF NS KMK+S++ G+  M FGV LSL NH +++  L IY  FIP+MIF+ ++FGYL+I I YKW A+ +  S  APSLLI  INMF+F+Y        Q       Y+GQ  +Q  LVV AIIC+PWML  KP ILR++ +  K   T N  G ++ +    E  ++   D LS+    E EEF+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  +  G + L  VF+ +++LT+ +LL+MEGLSAFLHALRLHWVEFQNKFY G G+KF+PFSFE I E K++E
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMATGVNTRIEDLQMVLNQTEDHRQRVLQAAAKSLRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVADLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNLVDAYGIGSYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVVRESRILSQKIDNELFTMMFSGRYIILLMGLFSIYTGLIYNDCFSKALNLFGSSWI-------------LIHLSYRCPVTSVFPSVSAL----QIWSLATNKLTFLNSFKMKMSVVLGIIHMTFGVALSLLNHIYFKKPLNIYLGFIPEMIFMTTLFGYLVILIIYKWCAYDASTSMVAPSLLIHFINMFLFSY--------QDTSLPMLYKGQMGLQCFLVVCAIICVPWMLVVKPLILRRQYLRRKHLGTHNFGGIRVGNGPTEEDAEIIQHDQLSM-HSEEGEEFDFGDTVVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMHVGLSIRSLGGGIALVFVFSAFATLTIAILLIMEGLSAFLHALRLHWVEFQNKFYMGTGFKFLPFSFENIREGKFDE 812          

HSP 2 Score: 241.891 bits (616), Expect = 0.000e+0
Identity = 144/228 (63.16%), Postives = 172/228 (75.44%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKE++K  I ILDTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEVKKANISILDTGENPEVPFPRDMIDLEANFEKIEIELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPSEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDSVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Mouse
Match: Atp6v0a1 (ATPase, H+ transporting, lysosomal V0 subunit A1 [Source:MGI Symbol;Acc:MGI:103286])

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 364/627 (58.05%), Postives = 461/627 (73.52%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW------YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+T+ITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K ++E+++  F GRYIILLMG+FSIYTGLIYND FSKS+N+FGSSW          +   T+  +S++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          + N   Y GQ  IQ  L+V+A++C+PWML  KP ILR + +  K    LN G I    G   E  ++   D LS T   + EEF+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGL   +  G + LF +FA +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+KF+PFSFE I E K++E
Sbjct:  224 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKHENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTQGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPE--------SGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLS-THSEDAEEFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE 839          

HSP 2 Score: 251.521 bits (641), Expect = 0.000e+0
Identity = 144/230 (62.61%), Postives = 172/230 (74.78%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEG-MHDSSMNXXXXXXXXXXXXXXXXMA-GQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE  +H   M +  L       L+   M  G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEAELHHQQMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 230          
BLAST of V-type proton ATPase subunit a vs. Ensembl Mouse
Match: Atp6v0a1 (ATPase, H+ transporting, lysosomal V0 subunit A1 [Source:MGI Symbol;Acc:MGI:103286])

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 364/627 (58.05%), Postives = 461/627 (73.52%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW------YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+T+ITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K ++E+++  F GRYIILLMG+FSIYTGLIYND FSKS+N+FGSSW          +   T+  +S++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          + N   Y GQ  IQ  L+V+A++C+PWML  KP ILR + +  K    LN G I    G   E  ++   D LS T   + EEF+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGL   +  G + LF +FA +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+KF+PFSFE I E K++E
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKHENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTQGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPE--------SGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLS-THSEDAEEFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE 832          

HSP 2 Score: 246.128 bits (627), Expect = 0.000e+0
Identity = 146/228 (64.04%), Postives = 173/228 (75.88%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPNEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Mouse
Match: Atp6v0a1 (ATPase, H+ transporting, lysosomal V0 subunit A1 [Source:MGI Symbol;Acc:MGI:103286])

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 363/632 (57.44%), Postives = 460/632 (72.78%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW------YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLS-----VTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+T+ITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K ++E+++  F GRYIILLMG+FSIYTGLIYND FSKS+N+FGSSW          +   T+  +S++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          + N   Y GQ  IQ  L+V+A++C+PWML  KP ILR + +  K    LN G I    G   E  ++   D LS       +  E E F+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGL   +  G + LF +FA +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+KF+PFSFE I E K++E
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKHENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTQGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPE--------SGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE 838          

HSP 2 Score: 246.514 bits (628), Expect = 0.000e+0
Identity = 146/228 (64.04%), Postives = 173/228 (75.88%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPNEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Mouse
Match: Atp6v0a1 (ATPase, H+ transporting, lysosomal V0 subunit A1 [Source:MGI Symbol;Acc:MGI:103286])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 360/632 (56.96%), Postives = 456/632 (72.15%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW------YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLSVTQXXXXXXXXXX-----XCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+T+ITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K ++E+++  F GRYIILLMG+FSIYTGLIYND FSKS+N+FGSSW          +   T+  +S++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          + N   Y GQ  IQ  L+V+A++C+PWML  KP ILR + +  K    LN G I    G   E  ++   D LS   E   E  +       + +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGL   +  G + LF +FA +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+KF+PFSFE I E K++E
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKHENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTQGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPE--------SGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEARKDFWFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE 838          

HSP 2 Score: 245.743 bits (626), Expect = 0.000e+0
Identity = 146/228 (64.04%), Postives = 173/228 (75.88%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPNEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Mouse
Match: Atp6v0a4 (ATPase, H+ transporting, lysosomal V0 subunit A4 [Source:MGI Symbol;Acc:MGI:2153480])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 329/617 (53.32%), Postives = 428/617 (69.37%), Query Frame = 2
Query:  680 RERKLKSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPN-IYKNATINP-----TSLMQLDP-LNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR---TENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            +E   K++F+IF+QG+QL+ ++ KIC+GF  +IYPCP+   ERREM   V  R+EDL TV+ QT+ HR R+L  AA N  +W  KV+K+KA+Y++LNM N+DVT +C+I E W  + D   IK AL  GME S SS+ P+M ++    K +PPT+N+ NKFT  FQ+IVDAYGV  YRE+NPAP+TIITFPFLFAVMFGD GHG++ML+ A+WMVLNE+    +KS +E+WN FF GRY+ILLMGIFSIYTGLIYND FSKS N+FGSSW    +++N T N      +  +QLDP +        YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGVILSLFNH +++  L I  +FIP+MIF+LS+FGYL+  I +KW  + +  S  APS+LI  I MF+F+Y+         + N   Y  Q  +Q+  V++A++ +PWML  KPF+LR ++  S+    T + +    D  G           +   ++   EEF FG+  VHQ IHTIEYCLGCISNTASYLRLWALSLAH +LSEVLW MV+ IGL    + G V +FI+FA ++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFY G G K
Sbjct:  214 KEEIKKNIFIIFYQGEQLRLKIKKICDGFRATIYPCPEHAAERREMLTSVNVRLEDLITVITQTESHRQRLLQEAAANWHSWVIKVQKMKAVYHVLNMCNIDVTQQCIIAEIWFPVADTRHIKKALEQGMELSGSSMIPIMTEV--ETKTDPPTFNRTNKFTAGFQNIVDAYGVGSYREINPAPYTIITFPFLFAVMFGDCGHGMVMLMAALWMVLNERHLLAQKSTNEMWNIFFNGRYLILLMGIFSIYTGLIYNDCFSKSFNIFGSSWSVQPMFRNGTWNTHIVENSPYLQLDPAIPGVYSGNPYPFGIDPIWNLASNKLTFLNSYKMKMSVILGIAHMIFGVILSLFNHIYFRRTLNIILQFIPEMIFMLSLFGYLVFMIIFKWCRYDAHTSRKAPSILIHFIGMFLFDYDD--------SSNAPLYGHQQEVQTFFVIIALVSVPWMLLIKPFVLRAKHQKSQLQSFTIHEDAVEGDHSGHSSKKTAGAHGM---KDGHEEEFNFGDIFVHQAIHTIEYCLGCISNTASYLRLWALSLAHAELSEVLWTMVMSIGLRLQGWAGLVGVFIIFAVFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYEGAGSK 817          

HSP 2 Score: 188.734 bits (478), Expect = 4.133e-49
Identity = 119/229 (51.97%), Postives = 157/229 (68.56%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFD-EGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            M S+FRS+EM L Q+FL  E AY C++ELGELG+VQFKD + + ++F RKFVNEVRRC+ +ER LRFLE E++ + +  +   D  E P PRE+I LE+T EKLE ELQE N + + LKK++LEL ELK +L+KTQ FF+ E         E    L E       M G   +LGF AGVI RER+A+FER+LWR CRGNVYLK +E+DT LEDP++  +++ +   IF
Sbjct:    1 MASVFRSEEMCLSQVFLQVEAAYCCVAELGELGLVQFKDLNANVNSFQRKFVNEVRRCESLERILRFLEDEMQNEILIQVPEKD-AETPLPREMITLETTLEKLEGELQEANQSHQALKKSFLELTELKYLLKKTQDFFETETNLGEDFFVEDTSGLLELRTIPAFMTG---KLGFTAGVINRERMASFERLLWRVCRGNVYLKFSEMDTLLEDPVTKEEIKKNIFIIF 225          
BLAST of V-type proton ATPase subunit a vs. UniProt/SwissProt
Match: sp|Q9Z1G4|VPP1_MOUSE (V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3)

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 364/627 (58.05%), Postives = 461/627 (73.52%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW------YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+T+ITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K ++E+++  F GRYIILLMG+FSIYTGLIYND FSKS+N+FGSSW          +   T+  +S++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          + N   Y GQ  IQ  L+V+A++C+PWML  KP ILR + +  K    LN G I    G   E  ++   D LS T   + EEF+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGL   +  G + LF +FA +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+KF+PFSFE I E K++E
Sbjct:  224 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKHENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTQGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPE--------SGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLS-THSEDAEEFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE 839          

HSP 2 Score: 251.521 bits (641), Expect = 0.000e+0
Identity = 144/230 (62.61%), Postives = 172/230 (74.78%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEG-MHDSSMNXXXXXXXXXXXXXXXXMA-GQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE  +H   M +  L       L+   M  G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEAELHHQQMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 230          
BLAST of V-type proton ATPase subunit a vs. UniProt/SwissProt
Match: sp|A1A5G6|VPP1_XENTR (V-type proton ATPase 116 kDa subunit a isoform 1 OS=Xenopus tropicalis OX=8364 GN=atp6v0a1 PE=2 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 356/631 (56.42%), Postives = 455/631 (72.11%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXX-----CLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RIEDLQ VLNQT++HR RVL AAAK+L+ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ++VDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMV+ E +  ++K D+E++   F GRYIILLMG+FSIYTGLIYND FSK++N+FGSSW     + + +    +  TS++QL+P  T   +  YPFGIDP+W  A NK+TF NS KMK+S++ G+  M FGV LSL NH +++  L IY  FIP+MIF+ ++FGYL+I I YKW A+ +  S  APSLLI  INMF+F+Y        Q       Y+GQ  +Q  LVV AIIC+PWML  KP ILR++ +  K   T N  G ++ +    E  ++   D LS+  E   E            +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  +  G + L  VF+ +++LT+ +LL+MEGLSAFLHALRLHWVEFQNKFY G G+KF+PFSFE I E K++E
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMATGVNTRIEDLQMVLNQTEDHRQRVLQAAAKSLRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVADLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNLVDAYGIGSYREINPAPYTIITFPFLFAVMFGDFGHGILMTLFAVWMVVRESRILSQKIDNELFTMMFSGRYIILLMGLFSIYTGLIYNDCFSKALNLFGSSWSVRPMFTDTWSEDLLKHTSVLQLNPNVTGVFNGPYPFGIDPIWSLATNKLTFLNSFKMKMSVVLGIIHMTFGVALSLLNHIYFKKPLNIYLGFIPEMIFMTTLFGYLVILIIYKWCAYDASTSMVAPSLLIHFINMFLFSY--------QDTSLPMLYKGQMGLQCFLVVCAIICVPWMLVVKPLILRRQYLRRKHLGTHNFGGIRVGNGPTEEDAEIIQHDQLSMHSEEGEEPAMEEVFDFGDTVVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMHVGLSIRSLGGGIALVFVFSAFATLTIAILLIMEGLSAFLHALRLHWVEFQNKFYMGTGFKFLPFSFENIREGKFDE 837          

HSP 2 Score: 242.276 bits (617), Expect = 0.000e+0
Identity = 144/228 (63.16%), Postives = 172/228 (75.44%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKE++K  I ILDTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEVKKANISILDTGENPEVPFPRDMIDLEANFEKIEIELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPSEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDSVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. UniProt/SwissProt
Match: sp|P25286|VPP1_RAT (V-type proton ATPase 116 kDa subunit a isoform 1 OS=Rattus norvegicus OX=10116 GN=Atp6v0a1 PE=2 SV=1)

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 363/632 (57.44%), Postives = 461/632 (72.94%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNI------YKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGGV--ERIDLGAGDNLS-----VTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+T+ITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K+++E+++  F GRYIILLMG+FSIYTGLIYND FSKS+N+FGSSW          +   T+  +S++QL+P         YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +  S  APSLLI  INMF+F+Y          + N   Y GQ  IQ  L+V+A++C+PWML  KP ILR + +  K    LN G I    G   E  ++   D LS       +  E E F+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGL   +  G + LF +FA +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+KF+PFSFE I E K++E
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFTIGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDAHSSRNAPSLLIHFINMFLFSYPE--------SGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILRHQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE 838          

HSP 2 Score: 243.047 bits (619), Expect = 0.000e+0
Identity = 145/228 (63.60%), Postives = 172/228 (75.44%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SEL ELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELEELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPNEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. UniProt/SwissProt
Match: sp|Q29466|VPP1_BOVIN (V-type proton ATPase 116 kDa subunit a isoform 1 OS=Bos taurus OX=9913 GN=ATP6V0A1 PE=2 SV=1)

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 359/616 (58.28%), Postives = 452/616 (73.38%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYP----NIYK--NATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLN-GKINDIGG--VERIDLGAGDNLSV-----TQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M +FA+WMVL E +  ++K+++E+++T F GRYIILLMG+FSIYTGLIYND FSKS+N+FGSSW      +IY     T+    ++QL+P  T      YPFGIDP+W  A NK+TF NS KMK+S+I G+  M FGV LSLFNH +++  L IY  FIP++IF+ S+FGYL+I IFYKW A+ +K S  APSLLI  INMF+F+Y          + N   Y GQ  IQ  LVV+A++C+PWML  KP +LR++ +  K    LN G I    G   E  ++   D LS       +  E E F+FG+ +VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ IGL   +  G + LF +FA +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+K
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDLGHGILMTLFAVWMVLKESRILSQKNENEMFSTIFSGRYIILLMGVFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFDIYNWTEETLRGNPVLQLNPAVTGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHTYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYNAKTSEKAPSLLIHFINMFLFSYGD--------SGNSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLKVKSLAGGLALFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFK 822          

HSP 2 Score: 246.899 bits (629), Expect = 0.000e+0
Identity = 146/228 (64.04%), Postives = 173/228 (75.88%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEIRK  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPSEMGR----GTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. UniProt/SwissProt
Match: sp|Q9I8D0|VPP1_CHICK (V-type proton ATPase 116 kDa subunit a isoform 1 OS=Gallus gallus OX=9031 GN=ATP6V0A1 PE=1 SV=1)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 351/616 (56.98%), Postives = 440/616 (71.43%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW--YPNIYK----NATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXX-----XXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAKN++ WF KVRK+KAIY+ LN+ N+DVT KC+  E WC + DL+ I+ ALR G E S S+V  ++N++ +N+   PPTYNK NKFT  FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M + AIWMVL E +  ++KSD+E+++T F GRYIILLMG+FS YTGLIYND FSKS+N+FGSSW   P   K    +  +  T L+QLDP         YPFGIDP+W  A NK+ F NS KMK+S+I G+  M FGV+LSL NH +++  L IY  FIP+MIF+ S+FGYL+I IFYKW A+ +  S  APS LI  INMF+F+Y            N   YRGQ  IQ  LVV+A++C+PWML AKP +LR + +  K   T N  G ++ +    E  ++   D LS   E   E  E       + +V+Q IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+  GLS  +  G   L  +FA +++LTV +LL+MEGLSAFLHALRLHW+EFQNKFY+G G+K
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLSAEVWCPVADLDSIQFALRRGTEHSGSTVPSILNRMQTNQT--PPTYNKTNKFTCGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHGILMTLIAIWMVLRESRILSQKSDNEMFSTVFSGRYIILLMGLFSTYTGLIYNDCFSKSLNMFGSSWSVRPMFSKANWSDELLKTTPLLQLDPAEAGVFGGPYPFGIDPIWNIANNKLAFLNSFKMKMSVILGIIHMLFGVMLSLLNHIYFKKPLNIYLGFIPEMIFMSSLFGYLVILIFYKWTAYDAHTSKEAPSPLIHFINMFLFSYGD--------TSNKMLYRGQKGIQCFLVVVALLCVPWMLVAKPLVLRHQYLRRKHLGTHNFGGIRVGNGPTEEDAEIIQHDQLSTHSEEGEEPTEDEVFDFADTVVYQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHTGLSVRSLAGGFGLVFIFAAFATLTVAILLVMEGLSAFLHALRLHWIEFQNKFYTGTGFK 822          

HSP 2 Score: 245.358 bits (625), Expect = 0.000e+0
Identity = 145/228 (63.60%), Postives = 173/228 (75.88%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELG VQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  IPI+DTG+NPE P PR++IDLE+ FEK+E EL+E+N N E LK+N+LEL ELK ILRKTQ FFDE M D  + EES  LL    +      G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP++G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDE-MADPDLLEESSSLLEPSEMGR----GAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. TrEMBL
Match: A0A504YEN2 (V-type proton ATPase subunit a OS=Fasciola gigantica OX=46835 GN=FGIG_00170 PE=3 SV=1)

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 385/651 (59.14%), Postives = 484/651 (74.35%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTS-------YPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFIL--RKRNISSKRTENLNGKIND-------IGGVER---ID--LGAGD-----------------------------NLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGY 2497
            K+VFL+FFQGDQL+ RV +ICEGFH S+ PCPDSQT+RR M I VM +IEDL+TVLNQT++HR R+L AAAKNL+ WF KVRKIKAIY+ LN+FNLDVT KCM+GECWCA+ D+++I LALR GMERSNS++QP++N + +  ++ PPTY++ NKFT AFQ+I+DAYGVA+YREVNPA FT+ITFPFLFAVMFGDAGHGL+M +FA+WMV+ E+K   +KS +E+W TFFGGRYIILLMGIFS+YTGLIYND+FS+S+N+FGSSWYP  + +AT++    +QLDP  TT  ST        YPFG+DP+WQ A NKI  +NSIKMK+SI+ GV  M  GVIL  FNHRF++D L I+CE IPQ++FL SIF YLII IFYKWIA+T+++S  APSLLI LINM  F+Y           P  TFY GQ A+Q IL+++A++ +PWML AKP IL  R R I+       NG I+        +GG+     +D  LG+GD                             +++ T   E E+F+FG+ +++Q IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS +  +G V+LF +FAFW+ LT+ +LL+MEGLSAFLH LRLHWVEFQNKFY G+GY
Sbjct:  223 KAVFLVFFQGDQLRTRVKRICEGFHASVSPCPDSQTDRRNMTIDVMQKIEDLETVLNQTRQHRQRILEAAAKNLRVWFIKVRKIKAIYHTLNLFNLDVTTKCMVGECWCAVNDVDKIHLALRRGMERSNSTLQPILNGLTT--RESPPTYHRTNKFTAAFQNIIDAYGVARYREVNPAIFTVITFPFLFAVMFGDAGHGLLMFLFALWMVICERKLVAQKSTNEVWQTFFGGRYIILLMGIFSVYTGLIYNDVFSRSLNIFGSSWYPT-FDSATLSSAETVQLDP-RTTNRSTDRMYAGYPYPFGLDPIWQLATNKIMLTNSIKMKMSIVLGVLHMLMGVILGAFNHRFFKDPLAIWCELIPQVLFLSSIFLYLIILIFYKWIAYTAEESSVAPSLLINLINMVRFSYQN-----DGAPPTRTFYSGQQAVQIILMIVAVVSVPWMLLAKPLILLMRHRAIAKFAKHARNGIIHGLDSSGIPVGGLTNAGMVDEPLGSGDGNGVGYADTVPLHGSSSRLSKASTFTESSDVTSTTTEEHEKFDFGDMMIYQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMHMGLSVNGLYGGVILFAIFAFWALLTLSILLVMEGLSAFLHTLRLHWVEFQNKFYKGDGY 864          

HSP 2 Score: 248.825 bits (634), Expect = 0.000e+0
Identity = 145/229 (63.32%), Postives = 175/229 (76.42%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMA-GQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EM L Q+FLHT+ AYMCISELGELG+VQF+D++  TSAF RKFVNEVRRCDEMERKLR+LEKEI KD  PI+DTG+ PEAPAPREIIDLE  FEKLE EL+ VN +A++L K +++L E+K+ILRKTQ FF+E   +  +         E GL   G A  +  +L  +AGVI R+RL AFERMLWRACRGNV+LKQAEID  LEDP +GAKV  +   +F
Sbjct:    1 MGSLFRSEEMQLSQVFLHTDIAYMCISELGELGLVQFRDAAAGTSAFQRKFVNEVRRCDEMERKLRYLEKEIVKDNFPIMDTGEVPEAPAPREIIDLEGIFEKLENELRGVNASADELAKAHIKLCEVKQILRKTQGFFEESGAEPLLELHGDGHALEGGLPQQGRADDRRTQLDSLAGVIERDRLPAFERMLWRACRGNVFLKQAEIDEPLEDPTTGAKVHKAVFLVF 229          
BLAST of V-type proton ATPase subunit a vs. TrEMBL
Match: T1J3P7 (V-type proton ATPase subunit a OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 382/616 (62.01%), Postives = 474/616 (76.95%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTT-TPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIG---------GVERIDLGAGDNLSVTQXX-----XXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGY 2497
            KSVF+IFFQGDQLK RV KICEGF  ++YPCP++  ERREMAIGVM+RIEDL TVL+QTQ+HRHRVL+AAAKN+KNWF KVRKIKAIY+ LN+FNLDVT KC+I ECWC   DLE I+LALR G ERS S++ P++N++  + K++PPT+N+ NKFT A+Q IVDAYGVA YREVNP PF+++TFPFLFAVMFGDAGHG IM +FA+WMVL EK    KK +DEIWNTFFGGRYIIL+MG+FSIYTGLIYND+FSKSINVFGS+WYP+ Y  +TI   S +QL+  N++      YPFG+DP WQ A NK+ F NS KMK+SIIYGV QM FGV+L  +NH +++ ++ IYCEFIPQ++FL  IFGYL+I +F+KW+ +++ +  CAPSLLI LINMF+F Y  P T      P+   Y GQ A+QS L+++A++C+PWML  KP+IL K+N +   T N +   N++G         G  +     G+ +S T        E EEF F E +VHQ IHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLW+MV+ I L+  ++ G+++LF VFA W+ LT+ VLL+MEGLSAFLH LRLHWVEFQNKFY G GY
Sbjct:  261 KSVFIIFFQGDQLKIRVKKICEGFRATLYPCPETPAERREMAIGVMTRIEDLNTVLSQTQDHRHRVLVAAAKNIKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWCPSVDLETIQLALRRGTERSGSNLTPILNRM--DSKEQPPTFNRTNKFTKAYQAIVDAYGVAAYREVNPTPFSVVTFPFLFAVMFGDAGHGFIMFLFALWMVLCEKGLAAKKIEDEIWNTFFGGRYIILMMGLFSIYTGLIYNDVFSKSINVFGSAWYPD-YNASTIYENSALQLNATNSSFYYGAPYPFGVDPAWQLASNKLIFLNSYKMKMSIIYGVFQMSFGVVLGFWNHTYFRKRINIYCEFIPQLLFLNLIFGYLVILVFWKWVYYSAYNVQCAPSLLITLINMFLFKY--PETKVCSQQPS---YSGQPAVQSFLIILALLCVPWMLVVKPYILWKQNAAKHPTMN-SVHTNNVGTEPPPVDENGQTQQHQADGNAISETPTSYGGEPEEEEFNFTEIIVHQSIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWQMVMHIPLAMDSWVGAIMLFPVFAAWAVLTLSVLLVMEGLSAFLHGLRLHWVEFQNKFYGGTGY 867          

HSP 2 Score: 268.085 bits (684), Expect = 0.000e+0
Identity = 163/270 (60.37%), Postives = 188/270 (69.63%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDE-----GMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLG-------------------------------------FVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EMALCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLRFLEKEI++D IP+LDTG++PEAP PRE+IDLE+TFEKLE EL+EVN NAE LK+NYLEL ELK ILRKTQ+FFDE      MHD SM   + E     G +     GQ ++LG                                     FVAGVILRERL AFERMLWRACRGNV+L+QAEIDT LED +SG +V  S   IF
Sbjct:    1 MGSLFRSEEMALCQLFLQSEGAYACVSELGELGVVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRFLEKEIKRDEIPMLDTGESPEAPQPREMIDLEATFEKLENELKEVNTNAEALKRNYLELTELKHILRKTQVFFDEVEYHHQMHDPSM---AEESAALLGDEGLRAGGQAMKLGEQSANDLPMEGSRKALVTQDALQSQQTPVQLGYCIIRFVAGVILRERLPAFERMLWRACRGNVFLRQAEIDTPLEDAVSGDQVNKSVFIIF 267          
BLAST of V-type proton ATPase subunit a vs. TrEMBL
Match: A0A293N0F1 (V-type proton ATPase subunit a (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 381/603 (63.18%), Postives = 459/603 (76.12%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILR-KRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQG+QLK +V KICEGF  ++YPCP++  +RREM+IGVM+RIEDL TVL QTQ+HRHRVL+AAAKN+KNWF KVRKIKAIY+ LN+ NLDVT KC+I ECWCA+ DL++I+LALR G ERS SSV  ++N++ +  K+ PPTYN+ NKFT  FQ+IVDAYGVA YREVNPAPFT+ITFPFLFAVMFGDAGHG IM +FA+WMVL EK    +K+D+EIWNT FGGRYI+LLMG FSIYTGLIYND FSKS+N+FGSSW   + K    +     QLDP+N       YPFG+DPVWQ + NKI F+NS KMK+SI+ GV QM FGV LSL+NH+F+ + L I+CEFIPQ+IFL SIFGYL++ IF KW      D+YCAPSLLI LINMF+F+Y T P           FY GQ  +QS LVV+A+ICIPW+L  KP  LR K N   +R    + K N          GAG +          EF+FGE  +HQ IHTIEYCLG +S+TASYLRLWALSLAH QLSEVLW MVL+IGL  + ++GS+VL++ FAFW++LTV VLL+MEGLSAFLHALRLHWVEFQ+KFY G GYK
Sbjct:  219 KSVFIIFFQGEQLKTKVKKICEGFRATLYPCPETPADRREMSIGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNWFVKVRKIKAIYHTLNLLNLDVTQKCLIAECWCAVSDLDKIQLALRRGTERSGSSVPSILNRMET--KETPPTYNRTNKFTKGFQNIVDAYGVASYREVNPAPFTVITFPFLFAVMFGDAGHGTIMFLFALWMVLKEKGLMAQKTDNEIWNTIFGGRYIVLLMGAFSIYTGLIYNDTFSKSLNLFGSSWM--VPKKEMYHQHE--QLDPVNNYV-GVPYPFGLDPVWQLSGNKIPFTNSYKMKVSIVLGVMQMMFGVFLSLWNHKFFHNSLNIFCEFIPQLIFLCSIFGYLVVTIFVKWTINFGHDTYCAPSLLIMLINMFLFSYTTTPCY------QAPFYSGQKGLQSFLVVLALICIPWILLVKPLYLRHKHNKGQRRVAANSAKANADDSAAHGAGGAGTSHGGHGGHGSGEFDFGEAFIHQTIHTIEYCLGSVSHTASYLRLWALSLAHAQLSEVLWSMVLQIGLRNTQWWGSIVLYLTFAFWATLTVAVLLIMEGLSAFLHALRLHWVEFQSKFYVGEGYK 808          

HSP 2 Score: 275.018 bits (702), Expect = 0.000e+0
Identity = 154/229 (67.25%), Postives = 181/229 (79.04%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQG-LRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EM LCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLRFLEKEI+KD  P+LD GDNPEAP PRE+IDLE+TFEKLE EL+EVN NAE LKK YLEL ELK ILRKTQ FFDE  H  + +      L +  L A  ++G   ++LGFVAGV+LRERL +FERMLWR CRGNV+L+QA +DT LEDP++G +V  S   IF
Sbjct:    1 MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRFLEKEIKKDGTPMLDIGDNPEAPQPREMIDLEATFEKLENELKEVNTNAEALKKTYLELTELKHILRKTQAFFDEQEHARTAD----VELMQRQLVASDLSGPASMKLGFVAGVVLRERLPSFERMLWRVCRGNVFLRQAPVDTALEDPVTGDQVYKSVFIIF 225          
BLAST of V-type proton ATPase subunit a vs. TrEMBL
Match: A0A293N300 (V-type proton ATPase subunit a (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 381/603 (63.18%), Postives = 459/603 (76.12%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILR-KRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQG+QLK +V KICEGF  ++YPCP++  +RREM+IGVM+RIEDL TVL QTQ+HRHRVL+AAAKN+KNWF KVRKIKAIY+ LN+ NLDVT KC+I ECWCA+ DL++I+LALR G ERS SSV  ++N++ +  K+ PPTYN+ NKFT  FQ+IVDAYGVA YREVNPAPFT+ITFPFLFAVMFGDAGHG IM +FA+WMVL EK    +K+D+EIWNT FGGRYI+LLMG FSIYTGLIYND FSKS+N+FGSSW   + K    +     QLDP+N       YPFG+DPVWQ + NKI F+NS KMK+SI+ GV QM FGV LSL+NH+F+ + L I+CEFIPQ+IFL SIFGYL++ IF KW      D+YCAPSLLI LINMF+F+Y T P           FY GQ  +QS LVV+A+ICIPW+L  KP  LR K N   +R    + K N          GAG +          EF+FGE  +HQ IHTIEYCLG +S+TASYLRLWALSLAH QLSEVLW MVL+IGL  + ++GS+VL++ FAFW++LTV VLL+MEGLSAFLHALRLHWVEFQ+KFY G GYK
Sbjct:  242 KSVFIIFFQGEQLKTKVKKICEGFRATLYPCPETPADRREMSIGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNWFVKVRKIKAIYHTLNLLNLDVTQKCLIAECWCAVSDLDKIQLALRRGTERSGSSVPSILNRMET--KETPPTYNRTNKFTKGFQNIVDAYGVASYREVNPAPFTVITFPFLFAVMFGDAGHGTIMFLFALWMVLKEKGLMAQKTDNEIWNTIFGGRYIVLLMGAFSIYTGLIYNDTFSKSLNLFGSSWM--VPKKEMYHQHE--QLDPVNNYV-GVPYPFGLDPVWQLSGNKIPFTNSYKMKVSIVLGVMQMMFGVFLSLWNHKFFHNSLNIFCEFIPQLIFLCSIFGYLVVTIFVKWTINFGHDTYCAPSLLIMLINMFLFSYTTTPCY------QAPFYSGQKGLQSFLVVLALICIPWILLVKPLYLRHKHNKGQRRVAANSAKANADDSAAHGAGGAGTSHGGHGGHGSGEFDFGEAFIHQTIHTIEYCLGSVSHTASYLRLWALSLAHAQLSEVLWSMVLQIGLRNTQWWGSIVLYLTFAFWATLTVAVLLIMEGLSAFLHALRLHWVEFQSKFYVGEGYK 831          

HSP 2 Score: 274.633 bits (701), Expect = 0.000e+0
Identity = 158/248 (63.71%), Postives = 186/248 (75.00%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDE--GMHDS----------------SMNXXXXXXXXXXXXXXXXM--AGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EM LCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLRFLEKEI+KD  P+LD GDNPEAP PRE+IDLE+TFEKLE EL+EVN NAE LKK YLEL ELK ILRKTQ FFDE  G+H+S                 M++ + +      L   G+   GQ L+LGFVAGV+LRERL +FERMLWR CRGNV+L+QA +DT LEDP++G +V  S   IF
Sbjct:    1 MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRFLEKEIKKDGTPMLDIGDNPEAPQPREMIDLEATFEKLENELKEVNTNAEALKKTYLELTELKHILRKTQAFFDEVTGLHESLETRTAMARVGFHHRAQMHDPNAQEEHVMLLGEEGLRAGGQALKLGFVAGVVLRERLPSFERMLWRVCRGNVFLRQAPVDTALEDPVTGDQVYKSVFIIF 248          
BLAST of V-type proton ATPase subunit a vs. TrEMBL
Match: A0A293LWN8 (V-type proton ATPase subunit a (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 381/603 (63.18%), Postives = 459/603 (76.12%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILR-KRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQG+QLK +V KICEGF  ++YPCP++  +RREM+IGVM+RIEDL TVL QTQ+HRHRVL+AAAKN+KNWF KVRKIKAIY+ LN+ NLDVT KC+I ECWCA+ DL++I+LALR G ERS SSV  ++N++ +  K+ PPTYN+ NKFT  FQ+IVDAYGVA YREVNPAPFT+ITFPFLFAVMFGDAGHG IM +FA+WMVL EK    +K+D+EIWNT FGGRYI+LLMG FSIYTGLIYND FSKS+N+FGSSW   + K    +     QLDP+N       YPFG+DPVWQ + NKI F+NS KMK+SI+ GV QM FGV LSL+NH+F+ + L I+CEFIPQ+IFL SIFGYL++ IF KW      D+YCAPSLLI LINMF+F+Y T P           FY GQ  +QS LVV+A+ICIPW+L  KP  LR K N   +R    + K N          GAG +          EF+FGE  +HQ IHTIEYCLG +S+TASYLRLWALSLAH QLSEVLW MVL+IGL  + ++GS+VL++ FAFW++LTV VLL+MEGLSAFLHALRLHWVEFQ+KFY G GYK
Sbjct:  234 KSVFIIFFQGEQLKTKVKKICEGFRATLYPCPETPADRREMSIGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNWFVKVRKIKAIYHTLNLLNLDVTQKCLIAECWCAVSDLDKIQLALRRGTERSGSSVPSILNRMET--KETPPTYNRTNKFTKGFQNIVDAYGVASYREVNPAPFTVITFPFLFAVMFGDAGHGTIMFLFALWMVLKEKGLMAQKTDNEIWNTIFGGRYIVLLMGAFSIYTGLIYNDTFSKSLNLFGSSWM--VPKKEMYHQHE--QLDPVNNYV-GVPYPFGLDPVWQLSGNKIPFTNSYKMKVSIVLGVMQMMFGVFLSLWNHKFFHNSLNIFCEFIPQLIFLCSIFGYLVVTIFVKWTINFGHDTYCAPSLLIMLINMFLFSYTTTPCY------QAPFYSGQKGLQSFLVVLALICIPWILLVKPLYLRHKHNKGQRRVAANSAKANADDSAAHGAGGAGTSHGGHGGHGSGEFDFGEAFIHQTIHTIEYCLGSVSHTASYLRLWALSLAHAQLSEVLWSMVLQIGLRNTQWWGSIVLYLTFAFWATLTVAVLLIMEGLSAFLHALRLHWVEFQSKFYVGEGYK 823          

HSP 2 Score: 272.707 bits (696), Expect = 0.000e+0
Identity = 153/240 (63.75%), Postives = 182/240 (75.83%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDE--GMHDSSMNXXXXXXXXXXXXXXXXM----------AGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+EM LCQLFL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRCDEMERKLRFLEKEI+KD  P+LD GDNPEAP P E+IDLE+TFEKLE EL+EVN  AE LKK YLEL ELK ILRKTQ FFDE  G+H+S     ++  + +   +   +           GQ L+LGFVAGV+LRERL +FERMLWR CRGNV+L+QA +DT LEDP++G +V  S   IF
Sbjct:    1 MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRFLEKEIKKDGTPMLDIGDNPEAPQPSEMIDLEATFEKLENELKEVNTIAEALKKTYLELTELKHILRKTQAFFDEVTGLHESLETRTAMARMHDPNAQEEHVMLLGEEGLRAGGQALKLGFVAGVVLRERLPSFERMLWRVCRGNVFLRQAPVDTALEDPVTGDQVYKSVFIIF 240          
BLAST of V-type proton ATPase subunit a vs. Ensembl Cavefish
Match: atp6v0a1a (ATPase H+ transporting V0 subunit a1 [Source:NCBI gene;Acc:103046606])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 359/629 (57.07%), Postives = 461/629 (73.29%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNAT---INPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E+S S+V  ++N++ +  K  PPTYNK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M   A+++VL E +   +K+D+E+++  F GRYIILLMGIFS+YTG+IYND FSKS+N+FGSSW     + +   N T   +    ++QLDP         YP GIDP+W  A NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L I+  FIP+++F+ S+FGYL+I +FYKW A+ +K S  APSLLI  INMF+FNYN P         N   YRGQ AIQ +LVV+A++C+P ML  K  +LR++ +  K   T+N  G ++ +    +  ++   D L++  E E E        VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV++IG S +N   S VLFI+FAF+++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PF+F  I E K+E+
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMAAGVNTRIDDLQMVLNQTEDHRQRVLQAAAKTIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEIWCPVSDLDSIQFALRRGTEKSGSTVPSILNRMQT--KQTPPTYNKTNKFTSGFQNIVDAYGIGNYREMNPAPYTIITFPFLFAVMFGDLGHGVLMTCAALYLVLRESRLTAQKNDNEMFSMVFAGRYIILLMGIFSVYTGIIYNDCFSKSLNIFGSSWSVRPMFTDKDANWTFDVLKENRVLQLDPAVKGVFGGPYPIGIDPIWNLAVNKLTFLNSFKMKMSVILGVIHMLFGVTLSLFNHTYFKKPLNIWLGFIPEIVFMSSLFGYLVILVFYKWTAYNAKISRDAPSLLIAFINMFLFNYNDP--------TNKPLYRGQMAIQCLLVVIALLCVPCMLIVKTLVLRRQYLWRKHLGTQNFGGIRVGNGPTEDEAEIIQHDQLAMNSEEEPEFDFTDVA-VHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMKIGFS-ANIGFSFVLFIIFAFFATLTVCILLIMEGLSAFLHALRLHWVEFQNKFYSGQGFKFMPFTFNSILEGKFED 833          

HSP 2 Score: 244.202 bits (622), Expect = 0.000e+0
Identity = 145/228 (63.60%), Postives = 174/228 (76.32%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E+AY C+SELGE+GMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  I I+DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D S+ EES  LL    +         LRLGFVAGVI RER+  FERMLWR CRGNV+L+QA+I+  LEDP +G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSESAYCCVSELGEIGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANITIVDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPSLMEESSTLLDPNEVGRVA----PLRLGFVAGVIGRERIPTFERMLWRVCRGNVFLRQADIEDPLEDPTTGDHVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Cavefish
Match: atp6v0a1a (ATPase H+ transporting V0 subunit a1 [Source:NCBI gene;Acc:103046606])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 362/634 (57.10%), Postives = 464/634 (73.19%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNAT---INPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENL------NGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E+S S+V  ++N++ +  K  PPTYNK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M   A+++VL E +   +K+D+E+++  F GRYIILLMGIFS+YTG+IYND FSKS+N+FGSSW     + +   N T   +    ++QLDP         YP GIDP+W  A NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L I+  FIP+++F+ S+FGYL+I +FYKW A+ +K S  APSLLI  INMF+FNYN P         N   YRGQ AIQ +LVV+A++C+P ML  K  +LR++ +  K   T+N       NG   D   + + D  A ++    ++ E E F+F +  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV++IG S +N   S VLFI+FAF+++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PF+F  I E K+E+
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMAAGVNTRIDDLQMVLNQTEDHRQRVLQAAAKTIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEIWCPVSDLDSIQFALRRGTEKSGSTVPSILNRMQT--KQTPPTYNKTNKFTSGFQNIVDAYGIGNYREMNPAPYTIITFPFLFAVMFGDLGHGVLMTCAALYLVLRESRLTAQKNDNEMFSMVFAGRYIILLMGIFSVYTGIIYNDCFSKSLNIFGSSWSVRPMFTDKDANWTFDVLKENRVLQLDPAVKGVFGGPYPIGIDPIWNLAVNKLTFLNSFKMKMSVILGVIHMLFGVTLSLFNHTYFKKPLNIWLGFIPEIVFMSSLFGYLVILVFYKWTAYNAKISRDAPSLLIAFINMFLFNYNDP--------TNKPLYRGQMAIQCLLVVIALLCVPCMLIVKTLVLRRQYLWRKHLGTQNFGGIRVGNGPTEDEAEIIQHDQLAMNSEEEPEQSEEEVFDFTDVAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMKIGFS-ANIGFSFVLFIIFAFFATLTVCILLIMEGLSAFLHALRLHWVEFQNKFYSGQGFKFMPFTFNSILEGKFED 839          

HSP 2 Score: 244.202 bits (622), Expect = 0.000e+0
Identity = 145/228 (63.60%), Postives = 174/228 (76.32%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E+AY C+SELGE+GMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  I I+DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D S+ EES  LL    +         LRLGFVAGVI RER+  FERMLWR CRGNV+L+QA+I+  LEDP +G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSESAYCCVSELGEIGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANITIVDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPSLMEESSTLLDPNEVGRVA----PLRLGFVAGVIGRERIPTFERMLWRVCRGNVFLRQADIEDPLEDPTTGDHVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Cavefish
Match: atp6v0a1a (ATPase H+ transporting V0 subunit a1 [Source:NCBI gene;Acc:103046606])

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 359/632 (56.80%), Postives = 466/632 (73.73%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNAT---INPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVT---QXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E+S S+V  ++N++ +  K  PPTYNK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M   A+++VL E +   +K+D+E+++  F GRYIILLMGIFS+YTG+IYND FSKS+N+FGSSW     + +   N T   +    ++QLDP         YP GIDP+W  A NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L I+  FIP+++F+ S+FGYL+I +FYKW A+ +K S  APSLLI  INMF+FNYN P         N   YRGQ AIQ +LVV+A++C+P ML  K  +LR++ +  K   T+N  G ++ +    +  ++   D L++    +  E ++F+F +  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV++IG S +N   S VLFI+FAF+++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PF+F  I E K+E+
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMAAGVNTRIDDLQMVLNQTEDHRQRVLQAAAKTIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEIWCPVSDLDSIQFALRRGTEKSGSTVPSILNRMQT--KQTPPTYNKTNKFTSGFQNIVDAYGIGNYREMNPAPYTIITFPFLFAVMFGDLGHGVLMTCAALYLVLRESRLTAQKNDNEMFSMVFAGRYIILLMGIFSVYTGIIYNDCFSKSLNIFGSSWSVRPMFTDKDANWTFDVLKENRVLQLDPAVKGVFGGPYPIGIDPIWNLAVNKLTFLNSFKMKMSVILGVIHMLFGVTLSLFNHTYFKKPLNIWLGFIPEIVFMSSLFGYLVILVFYKWTAYNAKISRDAPSLLIAFINMFLFNYNDP--------TNKPLYRGQMAIQCLLVVIALLCVPCMLIVKTLVLRRQYLWRKHLGTQNFGGIRVGNGPTEDEAEIIQHDQLAMNSEEEPEEHQKFDFTDVAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMKIGFS-ANIGFSFVLFIIFAFFATLTVCILLIMEGLSAFLHALRLHWVEFQNKFYSGQGFKFMPFTFNSILEGKFED 837          

HSP 2 Score: 244.202 bits (622), Expect = 0.000e+0
Identity = 145/228 (63.60%), Postives = 174/228 (76.32%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E+AY C+SELGE+GMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  I I+DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D S+ EES  LL    +         LRLGFVAGVI RER+  FERMLWR CRGNV+L+QA+I+  LEDP +G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSESAYCCVSELGEIGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANITIVDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPSLMEESSTLLDPNEVGRVA----PLRLGFVAGVIGRERIPTFERMLWRVCRGNVFLRQADIEDPLEDPTTGDHVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Cavefish
Match: atp6v0a1a (ATPase H+ transporting V0 subunit a1 [Source:NCBI gene;Acc:103046606])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 360/638 (56.43%), Postives = 466/638 (73.04%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-----YPNIYKNAT---INPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVT---------QXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E+S S+V  ++N++ +  K  PPTYNK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG++M   A+++VL E +   +K+D+E+++  F GRYIILLMGIFS+YTG+IYND FSKS+N+FGSSW     + +   N T   +    ++QLDP         YP GIDP+W  A NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L I+  FIP+++F+ S+FGYL+I +FYKW A+ +K S  APSLLI  INMF+FNYN P         N   YRGQ AIQ +LVV+A++C+P ML  K  +LR++ +  K   T+N  G ++ +    +  ++   D L++          ++ E E F+F +  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV++IG S +N   S VLFI+FAF+++LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G+KF+PF+F  I E K+E+
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMAAGVNTRIDDLQMVLNQTEDHRQRVLQAAAKTIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEIWCPVSDLDSIQFALRRGTEKSGSTVPSILNRMQT--KQTPPTYNKTNKFTSGFQNIVDAYGIGNYREMNPAPYTIITFPFLFAVMFGDLGHGVLMTCAALYLVLRESRLTAQKNDNEMFSMVFAGRYIILLMGIFSVYTGIIYNDCFSKSLNIFGSSWSVRPMFTDKDANWTFDVLKENRVLQLDPAVKGVFGGPYPIGIDPIWNLAVNKLTFLNSFKMKMSVILGVIHMLFGVTLSLFNHTYFKKPLNIWLGFIPEIVFMSSLFGYLVILVFYKWTAYNAKISRDAPSLLIAFINMFLFNYNDP--------TNKPLYRGQMAIQCLLVVIALLCVPCMLIVKTLVLRRQYLWRKHLGTQNFGGIRVGNGPTEDEAEIIQHDQLAMNSEEEPEEHQKQSEEEVFDFTDVAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMKIGFS-ANIGFSFVLFIIFAFFATLTVCILLIMEGLSAFLHALRLHWVEFQNKFYSGQGFKFMPFTFNSILEGKFED 843          

HSP 2 Score: 244.202 bits (622), Expect = 0.000e+0
Identity = 145/228 (63.60%), Postives = 174/228 (76.32%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E+AY C+SELGE+GMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  I I+DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D S+ EES  LL    +         LRLGFVAGVI RER+  FERMLWR CRGNV+L+QA+I+  LEDP +G  V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSESAYCCVSELGEIGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANITIVDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPSLMEESSTLLDPNEVGRVA----PLRLGFVAGVIGRERIPTFERMLWRVCRGNVFLRQADIEDPLEDPTTGDHVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Cavefish
Match: atp6v0a1b (V-type proton ATPase 116 kDa subunit a [Source:NCBI gene;Acc:103028623])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 341/613 (55.63%), Postives = 441/613 (71.94%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNI--------YKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EMA GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G ERS S+V  ++N++ +  K  PPT+NK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHGL+M   A+++VL E +   +KSD+E++N  F GRYIILLMGIFS+YTG+IYND FSKS+N+FGS W            +   T++   ++QLDP         YP GIDP+W  A NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L I+  FIP+++F+  +FGYLI+ IFYKW A+ ++ S  APSLLI  INM +FNYN P         N   Y GQ  IQ +LV++A+ C+P ML  K  +LR++++  K   T+   G ++ +    +  ++   D LS     + +EF+FG+  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GL+  +  G   L I+F  +++LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+K
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMAAGVNTRIDDLQMVLNQTEDHRQRVLQAAAKTMRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVSDLDSIQFALRRGTERSGSTVPSILNRMQT--KQTPPTFNKTNKFTSGFQNIVDAYGIGTYREMNPAPYTIITFPFLFAVMFGDMGHGLLMTCAALYLVLRESRLLAQKSDNEMFNMVFAGRYIILLMGIFSVYTGVIYNDCFSKSLNMFGSGWSVKPMFGPKGGNWSFETLDGNGVLQLDPAVPGVFGGPYPLGIDPIWNIATNKLTFLNSFKMKMSVILGVIHMLFGVTLSLFNHLYFKKPLNIFLGFIPEIVFMSCLFGYLILLIFYKWTAYDAETSKDAPSLLIAFINMCLFNYNDP--------TNKPLYSGQTGIQCLLVIIALACVPCMLVVKTMVLRRQHLWKKHLGTQKFGGVRVGNGPTEDEAEIIEHDQLS-QHSEDGDEFDFGDVAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWGMVMHLGLASRSGGGFFGLCIIFPAFATLTVCILLVMEGLSAFLHALRLHWVEFQNKFYTGLGFK 818          

HSP 2 Score: 249.21 bits (635), Expect = 0.000e+0
Identity = 146/230 (63.48%), Postives = 174/230 (75.65%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQG--LRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELGMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  IP +DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D ++      L     L     AG+G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+QAEI+  LEDP +G +V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANIPTVDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPNL------LEESSSLLDPSEAGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIEDPLEDPTTGDQVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Sea Lamprey
Match: si:ch73-173p19.2 (si:ch73-173p19.2 [Source:ZFIN;Acc:ZDB-GENE-141212-282])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 340/626 (54.31%), Postives = 446/626 (71.25%), Query Frame = 2
Query:  683 ERKLKSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNA--------TINPTSLMQLDP-LNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNY--NTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSV---------TQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            E+  K++F++FFQGDQLK++V KIC+GF  +IYPCPDS  ER +M   V +RIEDL++VL QT+ HR + L +AA+ L  W  KV+K+KAIY+ LNM N+DVT KC I E WC + DL+ I+ AL  G E+S + + P++N++ +N+   PPT+N+ NKFT+ FQ+IVDAYGV+KY E+NPAP+TIITFPFLFAVMFGD GHGLIM + A++MV+ EK     KSD+EIWNTFFGGRYIILLMG FS+YTGLIYND FSK+ ++FGSSW  N   +         TI+ +S++QLDP +        YPFG+DP+W  A NK+TF NS KMK+S+I G+ QM FGV+L LFNH F+     +  +FIP+MIF+L++FGYL+I I YKW  F + +S  APS+LI  INMF+F+Y  ++PP +          Y  Q  +Q+ LVV+A+I +PWML  KPF+LR ++  S R         ++  V    +  GD + V         T+  + EEF F +  VHQ IHTIEYCLGCISNTASYLRLWALSLAH +LSEVLW MVL IGL ++++ G V +F++FA ++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFY G+GYK
Sbjct:  215 EQIYKNMFIVFFQGDQLKSKVNKICDGFRATIYPCPDSIQERTDMRANVNTRIEDLKSVLGQTEMHRQQALASAAETLYEWRTKVQKMKAIYHTLNMCNIDVTQKCHIAEIWCPVLDLQTIQAALVSGTEKSGAVMPPILNRMTTNQL--PPTFNRTNKFTSGFQNIVDAYGVSKYLEINPAPYTIITFPFLFAVMFGDFGHGLIMFLAALFMVIYEKSLTETKSDNEIWNTFFGGRYIILLMGAFSMYTGLIYNDCFSKAFDIFGSSWSVNAMFHPTGPWGTCHTIHHSSVLQLDPAIPGVYSGQPYPFGLDPIWNVAVNKLTFLNSYKMKMSVILGIIQMTFGVVLGLFNHTFFHQPENVVLQFIPEMIFMLALFGYLLIMIVYKWCVFGAANSQAAPSILIHFINMFLFSYGEDSPPFL----------YNSQQEVQTFLVVLAVITVPWMLLIKPFVLRAKHRKSNR---------NVRDVSYRTVANGDEVEVEVQMLPTKDTEHDDGEEFNFADEFVHQAIHTIEYCLGCISNTASYLRLWALSLAHAELSEVLWHMVLHIGLHKNSFKGCVGIFLIFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYQGSGYK 819          

HSP 2 Score: 194.897 bits (494), Expect = 5.424e-52
Identity = 115/228 (50.44%), Postives = 157/228 (68.86%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRS+ M L QLFL +E AY C+SELGELG+VQF+D +   + F RK+VN+VRRC+EMER LRFLEKEI K  + +       EAP PRE+IDLES  E+LE EL+EVN N E LK N+LEL EL+++L K   FF + M ++ + +E   L+           G  L+LGF+ GV++R+R++AFER+LWR C GNV  + +EI+T LEDP++G ++  +   +F
Sbjct:    1 MGSLFRSEAMCLAQLFLQSEAAYSCVSELGELGLVQFRDLNAGVNLFQRKYVNDVRRCEEMERILRFLEKEIAKSNMTVKIQHSKQEAPLPREMIDLESLLERLEMELKEVNSNQEMLKLNFLELTELQQLLDKINDFF-QAMFETGVTDEMQRLMDVPSAAGQL--GNILKLGFLTGVVMRDRVSAFERLLWRFCHGNVLFRHSEIETPLEDPVTGEQIYKNMFIVF 225          
BLAST of V-type proton ATPase subunit a vs. Ensembl Sea Lamprey
Match: atp6v0a1b (ATPase H+ transporting V0 subunit a1b [Source:ZFIN;Acc:ZDB-GENE-050522-215])

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 336/610 (55.08%), Postives = 427/610 (70.00%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIY---KNATI---NPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFIL-----RKRNISSKRTENLN-----------GKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHW 2458
            KSVF+IFFQGDQLK+RV KICEGF  ++YPCP++  ER+EM  GV +RI+DLQTVLNQT +HR RVL +AA+N++ W  +VRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G E+S S+V  ++N++ +  K  PPT+N+ NKFT  FQ+IVDAYGV  YRE+NPAP+TIITFPFLFAVMFGD GHG +M  FA+WMV+ E +   ++ + EIWNTFF GRYIILLMG+FSIYTGLIYND FSKS+++FGSSW P      KN TI      S++QLDP         YPFGIDP+W  A N++TF NS KMK+S+  G+  M FGV+LSLFNH ++Q K  IY +FIP+MIF+LS+FGYL+I IFYKW  +T  +S  APSLLI  INMF+F Y+          PN   Y+GQ  +QS LVV+A++C+P +L  KP +L     R+R++ ++   +++            + ND+      D G                   +  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+  GL Q++Y G   L  VFAF++ LTV VLL+MEGLSAFLHALRLHW
Sbjct:  224 KSVFIIFFQGDQLKHRVKKICEGFRATLYPCPETPLERKEMEAGVNNRIDDLQTVLNQTDDHRQRVLASAAQNIRIWSIRVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVGDLDSIQFALRRGTEQSGSTVPSILNRMQT--KQTPPTFNRTNKFTAGFQNIVDAYGVGNYREINPAPYTIITFPFLFAVMFGDWGHGTLMTAFALWMVIRESRLMAQRIESEIWNTFFAGRYIILLMGLFSIYTGLIYNDCFSKSLDLFGSSWSPRAMFASKNWTIADLKGNSILQLDPAVPNVFGGPYPFGIDPIWNVASNRLTFLNSYKMKMSVTLGIIHMVFGVVLSLFNHIYFQKKWNIYLQFIPEMIFMLSLFGYLVILIFYKWCNYTVHESKHAPSLLIAFINMFLFTYS-------DSGPN--IYKGQRGLQSFLVVLALLCVPVLLAGKPLVLWYEDRRRRHLQTEDWGSVHLRWPPCKPKIITQFNDLVKHSAFDFG-------------------DVFVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWGMVMHTGLRQNSYAGFFGLIFVFAFFAVLTVSVLLVMEGLSAFLHALRLHW 803          

HSP 2 Score: 241.506 bits (615), Expect = 0.000e+0
Identity = 141/230 (61.30%), Postives = 168/230 (73.04%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEG--MHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS EM L QLFL +E AY C+SELGELGMVQF+D +PD + F RKFVNEVRRC+EMERKLRF+EKEI++  I I+D G+NPE P PR++IDLE+TFEKLE EL+EVN N E LK+N+LEL ELK IL KTQ FF+E    H    + E LE        +    G  LRLGFVAGVI RER+  FERMLWR CRGNV+L+Q +ID+ LEDP +G +V  S   IF
Sbjct:    1 MGELFRSDEMTLAQLFLQSEAAYCCVSELGELGMVQFRDLNPDVNVFQRKFVNEVRRCEEMERKLRFVEKEIKRADIQIMDNGENPEVPFPRDMIDLEATFEKLENELKEVNTNQEALKRNFLELSELKHILDKTQQFFEEVELRHHQMADPELLEESATLLDPSEIGRGAPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQTDIDSPLEDPSTGDQVHKSVFIIF 230          
BLAST of V-type proton ATPase subunit a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007572.1 (pep scaffold:Pmarinus_7.0:GL476513:271628:314868:1 gene:ENSPMAG00000006825.1 transcript:ENSPMAT00000007572.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 280.411 bits (716), Expect = 3.867e-91
Identity = 122/225 (54.22%), Postives = 173/225 (76.89%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEI 1369
            KSVF++F+QG+QLK R IKICEGF  ++YPCP S  ER +M  GV +R++DL +V+ +T+ HR RVL A A +L +W  +V K+KAIY+ LN+ N+DVT KC+I E WC + D+++++LAL    ERS S+V  ++N+++S +   PPT+N+ NKFT+ FQ+IVDAYGV  YREVNPAP+T+ITFPFLFAVMFGD GHG+IM +FA+++V+ EKK    + ++E+
Sbjct:   53 KSVFILFYQGEQLKGRAIKICEGFRATLYPCPGSLEERSQMVAGVGTRLDDLNSVMGETEGHRRRVLEATAGSLPSWLVRVHKMKAIYHTLNLCNMDVTQKCLIAEIWCPISDVDKVRLALSRATERSGSTVPSILNRMVSEQN--PPTFNRTNKFTSGFQNIVDAYGVGDYREVNPAPYTLITFPFLFAVMFGDLGHGIIMTLFALYLVIFEKKLSASRINNEV 275          

HSP 2 Score: 73.559 bits (179), Expect = 3.867e-91
Identity = 32/58 (55.17%), Postives = 45/58 (77.59%), Query Frame = 1
Query:  544 LRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            LRL F+ GVI RE++  FERMLWR CRGNV+L+ A+ID +LEDP++G +++ S   +F
Sbjct:    2 LRLRFLTGVIGREKIPMFERMLWRVCRGNVFLRYADIDEQLEDPVTGDEMQKSVFILF 59          
BLAST of V-type proton ATPase subunit a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008240.1 (pep scaffold:Pmarinus_7.0:GL488770:2076:7376:-1 gene:ENSPMAG00000007458.1 transcript:ENSPMAT00000008240.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.276 bits (617), Expect = 1.890e-74
Identity = 119/234 (50.85%), Postives = 160/234 (68.38%), Query Frame = 2
Query: 1364 EIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNAT------INPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRN 2047
            +IW  FFGGRYIILLMGIFS+YTGLIYND FSKSIN+FGSSW  N   NA+      +    ++Q++P+     +  YPFGIDP+W  A NK+ F N  KMK+S+I G+  M  G+ILSLFNH ++Q    I C+F+P+MIF+L++ GYL++ IF+KWIA+ +K+S  APS+LI  INMF+F Y+               Y GQ  +Q  LVV+A++C+PWML  KPF+LR +N
Sbjct:    1 QIWTMFFGGRYIILLMGIFSMYTGLIYNDCFSKSINIFGSSWSVNAMFNASQWTKEDLEAHQVLQMNPVVPGVFNGPYPFGIDPIWNLAANKLNFLNPYKMKMSVIVGITHMVSGIILSLFNHIYFQKPWNIICDFVPEMIFILALLGYLVVLIFFKWIAYQAKESQHAPSILINFINMFLFTYDEKFV---------PMYNGQKEVQMFLVVLALLCVPWMLLIKPFVLRFQN 225          
BLAST of V-type proton ATPase subunit a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007554.1 (pep scaffold:Pmarinus_7.0:GL476513:170398:182587:1 gene:ENSPMAG00000006824.1 transcript:ENSPMAT00000007554.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 7.451e-27
Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLR 231
            MGSLFRS+ M L QLFL +E AY C+SELGELG+VQF+D +P  + F R+FVN+VRRCDEMERKLR
Sbjct:    1 MGSLFRSEAMCLAQLFLQSEAAYSCVSELGELGLVQFRDLNPGVNTFQRRFVNDVRRCDEMERKLR 66          
BLAST of V-type proton ATPase subunit a vs. Ensembl Yeast
Match: VPH1 (Subunit a of vacuolar-ATPase V0 domain; one of two isoforms (Vph1p and Stv1p); Vph1p is located in V-ATPase complexes of the vacuole while Stv1p is located in V-ATPase complexes of the Golgi and endosomes; relative distribution to the vacuolar membrane decreases upon DNA replication stress; human homolog ATP6V0A4 implicated in renal tubular acidosis, can complement yeast null mutant [Source:SGD;Acc:S000005796])

HSP 1 Score: 452.595 bits (1163), Expect = 4.432e-149
Identity = 251/612 (41.01%), Postives = 349/612 (57.03%), Query Frame = 2
Query:  680 RERKLKSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-YPNIYKNA-TINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKP----FILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXX-XXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNG 2494
            RE K K+ F++F  GD +  R+ KI E    ++Y    S   R +    V   + DL TVL  T       L A AK L +WF  V + KAI+ ILN  N D   K +I E W   ++L  ++  L   + R    V  ++  + +N    PPT+++ NKFT  FQ I D YG+A+YRE+N    TI+TFPF+FA+MFGD GHG +M + A+ +VLNEKK  NK    EI++  F GRYIILLMG+FS+YTG +YNDIFSK++ +F S W +P+ +K   +I  TS+             +YP G+D  W   +N + FSNS KMK+SI+ G   M +    SL NH ++   + I   FIP ++F+  IFGYL + I YKW     KD   AP LL  LINMF+    +P T+  +  P+      QA +Q  L++MA++CIPW+L  KP    F  +K++     +   +    D+   + I     D+    +       E  G+ ++HQ IHTIE+CL C+S+TASYLRLWALSLAH QLS VLW M ++I      + G  +   +FA W +LT  VL+LMEG SA LH+LRLHWVE  +KF+ G G
Sbjct:  228 REYKHKNAFIVFSHGDLIIKRIRKIAESLDANLYDVDSSNEGRSQQLAKVNKNLSDLYTVLKTTSTTLESELYAIAKELDSWFQDVTREKAIFEILNKSNYDTNRKILIAEGWIPRDELATLQARLGEMIARLGIDVPSIIQVLDTNHT--PPTFHRTNKFTAGFQSICDCYGIAQYREINAGLPTIVTFPFMFAIMFGDMGHGFLMTLAALSLVLNEKKI-NKMKRGEIFDMAFTGRYIILLMGVFSMYTGFLYNDIFSKTMTIFKSGWKWPDHWKKGESITATSV------------GTYPIGLDWAWHGTENALLFSNSYKMKLSILMGFIHMTYSYFFSLANHLYFNSMIDIIGNFIPGLLFMQGIFGYLSVCIVYKWAVDWVKDGKPAPGLLNMLINMFL----SPGTIDDELYPH------QAKVQVFLLLMALVCIPWLLLVKPLHFKFTHKKKSHEPLPSTEADASSEDLEAQQLISAMDADDAEEEEVGSGSHGEDFGDIMIHQVIHTIEFCLNCVSHTASYLRLWALSLAHAQLSSVLWTMTIQIAFGFRGFVGVFMTVALFAMWFALTCAVLVLMEGTSAMLHSLRLHWVESMSKFFVGEG 814          

HSP 2 Score: 94.3597 bits (233), Expect = 4.432e-149
Identity = 68/232 (29.31%), Postives = 107/232 (46.12%), Query Frame = 1
Query:   40 SLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRK--------DTIPILDTGDNPEAPAPREIID--------LESTFEKLEK-----ELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELED 672
            ++FRS EMAL Q ++  E +      LG+LG+VQF+D +    AF R FVNE+RR D +ER+ R+    ++K        DT   LD       P    +ID        LE    ++E      E+Q+ ++   +      +   LK     +  + DE M D++                   A  G  + +V GVI R+++A  E++LWR  RGN++ K  EI+  + D
Sbjct:    7 AIFRSAEMALVQFYIPQEISRDSAYTLGQLGLVQFRDLNSKVRAFQRTFVNEIRRLDNVERQYRYFYSLLKKHDIKLYEGDTDKYLDGSGELYVPPSGSVIDDYVRNASYLEERLIQMEDATDQIEVQKNDLEQYRFILQSGDEFFLKGDNTDSTSYMDEDMIDAN--------------GENIAAAIGASVNYVTGVIARDKVATLEQILWRVLRGNLFFKTVEIEQPVYD 224          
BLAST of V-type proton ATPase subunit a vs. Ensembl Yeast
Match: STV1 (Subunit a of the vacuolar-ATPase V0 domain; one of two isoforms (Stv1p and Vph1p); Stv1p is located in V-ATPase complexes of the Golgi and endosomes while Vph1p is located in V-ATPase complexes of the vacuole [Source:SGD;Acc:S000004658])

HSP 1 Score: 424.476 bits (1090), Expect = 3.268e-135
Identity = 251/646 (38.85%), Postives = 352/646 (54.49%), Query Frame = 2
Query:  680 RERKLKSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRN----------------------ISSKR--TENLNGKI------------NDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIV---FAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGY 2497
            +E+  K  F+IF  G+ L  +V ++ +  +G I       T   E+   +  +I+DLQ +L+ T++  H  L+     L  W    ++ K +Y  LN F  +  ++ +I E W    +L  ++ +L+  +E   S    V N I++NK   PPTY++ NKFT AFQ IVDAYG+A Y+E+N    T++TFPF+FA+MFGD GHG I+ + A+++VLNE+K+      DEI++  F GRY++LLMG FS+YTGL+YNDIFSKS+ +F S W +P+ ++           ++   T      YPFG+D  W    N + FSNS KMK+SI+ G   M +  + S  N+R    K+ I   FIP ++F+ SIFGYL   I YKW     KD   AP LL  LINMF+     P T+  Q       Y GQA +Q +L++ A++C+PW+L  KP  LR+ N                      I+ +R   E   G I              +GG E+     GD                  ++HQ IHTIE+CL CIS+TASYLRLWALSLAH QLS VLW+M +    S  N    + +  V   FA W  LTV +L+ MEG SA LHALRLHWVE  +KF+ G GY
Sbjct:  279 KEKVEKDCFIIFTHGETLLKKVKRVIDSLNGKIVSL---NTRSSELVDTLNRQIDDLQRILDTTEQTLHTELLVIHDQLPVWSAMTKREKYVYTTLNKFQQE--SQGLIAEGWVPSTELIHLQDSLKDYIETLGSEYSTVFNVILTNKL--PPTYHRTNKFTQAFQSIVDAYGIATYKEINAGLATVVTFPFMFAIMFGDMGHGFILFLMALFLVLNERKF-GAMHRDEIFDMAFTGRYVLLLMGAFSVYTGLLYNDIFSKSMTIFKSGWQWPSTFRKGE-------SIEAKKTGV----YPFGLDFAWHGTDNGLLFSNSYKMKLSILMGYAHMTYSFMFSYINYRAKNSKVDIIGNFIPGLVFMQSIFGYLSWAIVYKWSKDWIKDDKPAPGLLNMLINMFL----APGTIDDQ------LYSGQAKLQVVLLLAALVCVPWLLLYKPLTLRRLNKNGGGGRPHGYQSVGNIEHEEQIAQQRHSAEGFQGMIISDVASVADSINESVGGGEQGPFNFGD-----------------VMIHQVIHTIEFCLNCISHTASYLRLWALSLAHAQLSSVLWDMTISNAFSSKNSGSPLAVMKVVFLFAMWFVLTVCILVFMEGTSAMLHALRLHWVEAMSKFFEGEGY 878          

HSP 2 Score: 55.8398 bits (133), Expect = 2.486e-8
Identity = 37/114 (32.46%), Postives = 58/114 (50.88%), Query Frame = 1
Query:   40 SLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIP----ILDTGDNPEAPAPREIIDLESTFEKLEKELQEVN 369
            ++FRS +M   QL++  E        LG++ +    D + D +AF R +VN++RR DE+ER + FL + + K        IL   D     A  ++ DL +T E L   L+ VN
Sbjct:    6 AIFRSADMTYVQLYIPLEVIREVTFLLGKMSVFMVMDLNKDLTAFQRGYVNQLRRFDEVERMVGFLNEVVEKHAAETWKYILHIDDEGNDIAQPDMADLINTMEPL--SLENVN 117          
BLAST of V-type proton ATPase subunit a vs. Ensembl Nematostella
Match: EDO42481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1B9])

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 343/613 (55.95%), Postives = 437/613 (71.29%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW-YPN---IYKNATIN---PTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRT--ENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXX--XCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            K VF+IFFQGDQLK+RV KICEGF  S+YPCP++  ERRE+AIGV +RIEDLQ VL+QT++HR+R+L   A N+  WF KV+KIKAIY+ +NMFNLDVT KC+I ECWC + DL+RI+ ALR G E S +SV  ++N++++  +  PPT+N+ NKFT  FQ IVDAYGVA Y+EVNPA +TIITFPFLFAVMFGD GHG IM +FA+++VL E K +N K   E++ T F GRYI+LLMG+F++YTGLIYNDIFS+S+N+FG+ W +PN    Y +A +       ++ LDP         Y FG+DP+WQ AKNK+ F+NS+KMK+SI+ GV  M FGV LS FNHR ++  + I+CEFIPQ++FL  IFGYL+I IFYKWI F S +    PSLLI  INMF+         A    P    + GQA IQ +LVV+A++C+PWML  KPF LR ++   K    + L    N     +  ++   +  +  QE + EE EF   E  VHQ IHTIEYCLGCISNTASYLRLWALSLAH +LSEVLW MVL +GL++    G +V F+ F  W+ LT+ +LL+MEGLSAFLHALRLHWVEF +KFY G GYK
Sbjct:  226 KCVFIIFFQGDQLKSRVKKICEGFRASLYPCPETAAERREVAIGVETRIEDLQNVLSQTKDHRYRLLGTVANNISQWFIKVKKIKAIYHTMNMFNLDVTQKCLIAECWCPVADLDRIQAALRRGTEHSGASVPSILNRMVT--RQAPPTFNRTNKFTQGFQAIVDAYGVANYQEVNPALYTIITFPFLFAVMFGDCGHGFIMAMFALYLVLKEDKLKNFKGGGEMFETIFHGRYIVLLMGLFAVYTGLIYNDIFSRSLNIFGTGWAFPNNTGEYSSAAMKSYPKDKILMLDP-KVGYSGIPYYFGLDPIWQVAKNKLNFTNSLKMKLSIVLGVIHMMFGVCLSFFNHRHFKKPINIFCEFIPQVLFLGCIFGYLVILIFYKWI-FISIERPNPPSLLIATINMFL-------QFAKDIEPKDQVFSGQAVIQPLLVVIAVLCVPWMLLVKPFYLRHQHKKHKLEGFQRLGSPSNIQEEHQPQEVSHSEEFAKPQENDHEEEEFDFGEAFVHQAIHTIEYCLGCISNTASYLRLWALSLAHAELSEVLWSMVLHLGLNKEGAMGIIVTFLGFGLWAVLTIAILLIMEGLSAFLHALRLHWVEFNSKFYQGTGYK 827          

HSP 2 Score: 224.557 bits (571), Expect = 0.000e+0
Identity = 129/232 (55.60%), Postives = 167/232 (71.98%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEG---MHDSSMNXXXXX-XXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            M SLFRS+EM L Q+FL +E AY C+SELGELG+VQF+D +PD +AF RKFVNEVRRC+EMERKLRFL+KEI K  I ++DTG++ EAP PRE+IDLE+ FE+LE E+++ N N E L ++YLEL ELK IL+KTQ FF+E    +H   + E        +   +    A    +LGFV+GVI RE++ +FER+LWRACRGNV+ KQAEI+  LEDP +G +V      IF
Sbjct:    1 MSSLFRSEEMTLAQIFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCEEMERKLRFLQKEIEKAEIAMVDTGESSEAPHPREMIDLEAQFEQLENEMKDSNSNYEALMRSYLELTELKHILKKTQTFFEEAEQHVHQQQIQEPGRTDDTVQLLGEEPSAASAATQLGFVSGVISREKVPSFERLLWRACRGNVFFKQAEIEEALEDPSTGDQVHKCVFIIF 232          
BLAST of V-type proton ATPase subunit a vs. Ensembl Nematostella
Match: EDO28296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6V8])

HSP 1 Score: 153.68 bits (387), Expect = 6.732e-40
Identity = 85/199 (42.71%), Postives = 107/199 (53.77%), Query Frame = 2
Query: 1226 APFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWI 1822
            A +TIITFPFLFAVMFGD GHG IM +FA+++VL E K +N K   E                                                       ++ LDP         Y FG+DP+WQ AKNK+ F+NS+KMK+SI+ GV  M FGV LS FNHR ++  + I+CEFIPQ++FL  IFGYL+I IFYKWI
Sbjct:  218 ALYTIITFPFLFAVMFGDCGHGFIMAMFALYLVLKEDKLKNFKGGGE-----------------------------------------------------DKILMLDP-KVGYSGIPYYFGLDPIWQVAKNKLNFTNSLKMKLSIVLGVIHMMFGVCLSFFNHRHFKKPINIFCEFIPQVLFLGCIFGYLVILIFYKWI 362          

HSP 2 Score: 140.584 bits (353), Expect = 1.761e-35
Identity = 65/90 (72.22%), Postives = 75/90 (83.33%), Query Frame = 2
Query: 2189 VHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHW 2458
            VHQ IHTIEYCLGCISNTASYLRLWALSLAH +LSEVLW MVL +GL++    G +V F+ F  W+ LT+ +LL+MEGLSAFLHALRLHW
Sbjct:  378 VHQAIHTIEYCLGCISNTASYLRLWALSLAHAELSEVLWSMVLHLGLNKEGAMGIIVTFLGFGLWAVLTIAILLIMEGLSAFLHALRLHW 467          

HSP 3 Score: 78.1814 bits (191), Expect = 1.535e-22
Identity = 61/134 (45.52%), Postives = 84/134 (62.69%), Query Frame = 1
Query:  328 STFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEG---MHDSSMNXXXXXX-XXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            + FE+LE E+++ N N E L ++YLEL ELK IL+KTQ FF+E    +H   + E        +   +    A    +LGFV+GVI RE++ +FER+LWRACRGNV+ KQAEI+  LEDP +G +V      IF
Sbjct:    1 AQFEQLENEMKDSNSNYEALMRSYLELTELKHILKKTQTFFEEAEQHVHQQQIQEPGRTDDTVQLLGEEPSAASAATQLGFVSGVISREKVPSFERLLWRACRGNVFFKQAEIEEALEDPSTGDQVHKCVFIIF 134          

HSP 4 Score: 46.9802 bits (110), Expect = 1.535e-22
Identity = 21/29 (72.41%), Postives = 24/29 (82.76%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIY 781
            K VF+IFFQGDQLK+RV KICEGF   +Y
Sbjct:  128 KCVFIIFFQGDQLKSRVKKICEGFCARMY 156          
BLAST of V-type proton ATPase subunit a vs. Ensembl Medaka
Match: ATP6V0A1 (V-type proton ATPase 116 kDa subunit a [Source:NCBI gene;Acc:101163575])

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 346/629 (55.01%), Postives = 455/629 (72.34%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW--YPNIYKNA------TINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENLNG-KINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  ++YPCP++  ER+EM  GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + D++ I+ ALR G E+S S+V  ++N + +  K  PPTYNK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG +M   A+++VL E +   +K+D+EI+   F GRYIILLMGIFS+YTGLIYND FSK++N+FGS W   P   +        T++   ++QLDP         YP GIDP+W  + NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L IY  FIP+++F+  +FGYL+I IF+KW++F ++ S  APSLLI  INMF+F Y+ P         N   YRGQ  +Q  LV++A+ C+P ML  K  +LR++ +  K   T+N  G ++++    +   +   D+L+   E + E+F F +  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+RIGLS  ++ G ++L ++F F++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFY G G+KF+PF+FE I + ++EE
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRATLYPCPETPQERKEMLAGVNARIDDLQMVLNQTEDHRQRVLQAAAKTVRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVSDMDSIQFALRRGTEKSGSTVPSILNSMQT--KQTPPTYNKTNKFTSGFQNIVDAYGIGSYREINPAPYTIITFPFLFAVMFGDLGHGALMTAAALYLVLRESRLMAQKNDNEIFTMVFAGRYIILLMGIFSMYTGLIYNDCFSKALNIFGSGWSVRPMFGERGANWSFTTLSENHVLQLDPAVDGVFKGPYPIGIDPIWSISINKLTFLNSFKMKMSVILGVIHMLFGVSLSLFNHLYFKKPLNIYLGFIPEIVFMSCLFGYLVILIFFKWVSFDARTSKDAPSLLIAFINMFLFQYSDP--------SNKPLYRGQMGLQIFLVIIALACVPCMLIVKTLVLRRQYLWQKHLGTQNFGGIRVSNGPTEDEAGIIQHDHLAPQTEDDPEQFNFTDVAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMRIGLSSRSFGGFILLALIFFFFAVLTVAILLIMEGLSAFLHALRLHWVEFQNKFYGGQGFKFLPFTFESILDGRFEE 835          

HSP 2 Score: 243.047 bits (619), Expect = 0.000e+0
Identity = 141/228 (61.84%), Postives = 170/228 (74.56%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGE+GMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  + ILDTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D S+    LE           +     RLGFVAGVI RER+  FERMLWR CRGNV+L+QA+I+  LEDP +G +V  S   IF
Sbjct:    1 MGQLFRSEEMTLAQLFLQSEAAYCCVSELGEIGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANLAILDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPSL----LEESSTFLDPNEPIRAAPQRLGFVAGVIGRERIPTFERMLWRVCRGNVFLRQADIEDPLEDPTTGDQVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Medaka
Match: ATP6V0A1 (V-type proton ATPase 116 kDa subunit a [Source:NCBI gene;Acc:101163575])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 349/644 (54.19%), Postives = 454/644 (70.50%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW--YPNIYKNA------TINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKR--TENL------NGKINDIGGVERIDLGAGD----------NLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVF+IFFQGDQLKNRV KICEGF  ++YPCP++  ER+EM  GV +RI+DLQ VLNQT++HR RVL AAAK ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + D++ I+ ALR G E+S S+V  ++N + +  K  PPTYNK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHG +M   A+++VL E +   +K+D+EI+   F GRYIILLMGIFS+YTGLIYND FSK++N+FGS W   P   +        T++   ++QLDP         YP GIDP+W  + NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L IY  FIP+++F+  +FGYL+I IF+KW++F ++ S  APSLLI  INMF+F Y+ P         N   YRGQ  +Q  LV++A+ C+P ML  K  +LR++ +  K   T+N       NG   D  G+ + D  A            + +  +  E E+F F +  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+RIGLS  ++ G ++L ++F F++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFY G G+KF+PF+FE I + ++EE
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRATLYPCPETPQERKEMLAGVNARIDDLQMVLNQTEDHRQRVLQAAAKTVRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVSDMDSIQFALRRGTEKSGSTVPSILNSMQT--KQTPPTYNKTNKFTSGFQNIVDAYGIGSYREINPAPYTIITFPFLFAVMFGDLGHGALMTAAALYLVLRESRLMAQKNDNEIFTMVFAGRYIILLMGIFSMYTGLIYNDCFSKALNIFGSGWSVRPMFGERGANWSFTTLSENHVLQLDPAVDGVFKGPYPIGIDPIWSISINKLTFLNSFKMKMSVILGVIHMLFGVSLSLFNHLYFKKPLNIYLGFIPEIVFMSCLFGYLVILIFFKWVSFDARTSKDAPSLLIAFINMFLFQYSDP--------SNKPLYRGQMGLQIFLVIIALACVPCMLIVKTLVLRRQYLWQKHLGTQNFGGIRVSNGPTEDEAGIIQHDHLAPQTEDDPETCLLSPAFKEHEEEEQFNFTDVAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMRIGLSSRSFGGFILLALIFFFFAVLTVAILLIMEGLSAFLHALRLHWVEFQNKFYGGQGFKFLPFTFESILDGRFEE 850          

HSP 2 Score: 243.432 bits (620), Expect = 0.000e+0
Identity = 141/228 (61.84%), Postives = 170/228 (74.56%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGE+GMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  + ILDTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK ILR+TQ FFDE M D S+    LE           +     RLGFVAGVI RER+  FERMLWR CRGNV+L+QA+I+  LEDP +G +V  S   IF
Sbjct:    1 MGQLFRSEEMTLAQLFLQSEAAYCCVSELGEIGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKANLAILDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILRRTQQFFDE-MEDPSL----LEESSTFLDPNEPIRAAPQRLGFVAGVIGRERIPTFERMLWRVCRGNVFLRQADIEDPLEDPTTGDQVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Medaka
Match: atp6v0a1b (V-type proton ATPase 116 kDa subunit a [Source:NCBI gene;Acc:101156445])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 348/643 (54.12%), Postives = 444/643 (69.05%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNA--------TINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILR-----KRNISSKR----TENLNGKINDIG-----------------------GVERIDLGAGDNLSVTQXXXXXXX-XXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EM  GV SRI+DLQ VLNQT++HR RVL AA+K ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G ERS S+V  ++N++ +  K  PPT+NK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHGL+ML  A+++VL E +   +K D+E++N  F GRYIILLMG+FS+YTG+IYND FSKS+N+FGS W      +A        T+   +++QLDP      +  YP GIDPVW  A NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L I+  FIP+++F+ S+FGYL++ +FYKW A+ +  S  APSLLI  INM +FNYN P         N   YRGQ  IQ +LV++A+ C+P ML  K  +LR     K+++S KR     ENL   +   G                       G    + G  D+  ++Q  E  +  +FG+  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  +  G   L I+FA ++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+K
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMLAGVNSRIDDLQMVLNQTEDHRQRVLQAASKTMRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVSDLDSIQFALRRGTERSGSTVPSILNRMQT--KQTPPTFNKTNKFTSGFQNIVDAYGIGNYREINPAPYTIITFPFLFAVMFGDMGHGLLMLCAALYLVLRESRILAQKIDNEMFNMVFAGRYIILLMGVFSVYTGVIYNDCFSKSLNMFGSGWSVRPMFSAKGANWTFTTLKENTVLQLDPAVPGVFNGPYPLGIDPVWNIATNKLTFLNSFKMKMSVILGVIHMLFGVSLSLFNHLYFKKPLNIFLGFIPEIVFMFSLFGYLVLLVFYKWTAYDAFTSKDAPSLLIHFINMCLFNYNDP--------TNKPLYRGQMGIQILLVLIALACVPCMLIVKTMVLRRQHLWKKHLSQKREETPAENLEQSLEQTGVSSSCTGLTQQGTQKFGGVRVGNGPTEDEAGIMDHDQLSQHSEEGDEFDFGDVAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMHLGLSSRSGGGFFGLSIIFAAFAMLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGQGFK 849          

HSP 2 Score: 248.054 bits (632), Expect = 0.000e+0
Identity = 142/228 (62.28%), Postives = 172/228 (75.44%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELGMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  IP++DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK IL +TQ FFDE M D ++    LE        +    G  LRLGFVAGVI RER+  FERMLWR CRGNV+L++AEI+  LEDP +G +V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKVGIPMVDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILHRTQQFFDE-MEDPNL----LEESSALMEGSERGRGAPLRLGFVAGVISRERIPTFERMLWRVCRGNVFLRKAEIEDPLEDPTTGDQVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Medaka
Match: atp6v0a1b (V-type proton ATPase 116 kDa subunit a [Source:NCBI gene;Acc:101156445])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 350/649 (53.93%), Postives = 444/649 (68.41%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNA--------TINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILR-----KRNISSKR----TENL------------------------------NGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            KSVF+IFFQGDQLKNRV KICEGF  S+YPCP++  ER+EM  GV SRI+DLQ VLNQT++HR RVL AA+K ++ WF KVRK+KAIY+ LN+ N+DVT KC+I E WC + DL+ I+ ALR G ERS S+V  ++N++ +  K  PPT+NK NKFT+ FQ+IVDAYG+  YRE+NPAP+TIITFPFLFAVMFGD GHGL+ML  A+++VL E +   +K D+E++N  F GRYIILLMG+FS+YTG+IYND FSKS+N+FGS W      +A        T+   +++QLDP      +  YP GIDPVW  A NK+TF NS KMK+S+I GV  M FGV LSLFNH +++  L I+  FIP+++F+ S+FGYL++ +FYKW A+ +  S  APSLLI  INM +FNYN P         N   YRGQ  IQ +LV++A+ C+P ML  K  +LR     K+++S KR     ENL                              NG   D  G+   D  +  +    +  E E F+FG+  VHQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+ +GLS  +  G   L I+FA ++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFY+G G+K
Sbjct:  217 KSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMLAGVNSRIDDLQMVLNQTEDHRQRVLQAASKTMRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVSDLDSIQFALRRGTERSGSTVPSILNRMQT--KQTPPTFNKTNKFTSGFQNIVDAYGIGNYREINPAPYTIITFPFLFAVMFGDMGHGLLMLCAALYLVLRESRILAQKIDNEMFNMVFAGRYIILLMGVFSVYTGVIYNDCFSKSLNMFGSGWSVRPMFSAKGANWTFTTLKENTVLQLDPAVPGVFNGPYPLGIDPVWNIATNKLTFLNSFKMKMSVILGVIHMLFGVSLSLFNHLYFKKPLNIFLGFIPEIVFMFSLFGYLVLLVFYKWTAYDAFTSKDAPSLLIHFINMCLFNYNDP--------TNKPLYRGQMGIQILLVLIALACVPCMLIVKTMVLRRQHLWKKHLSQKREETPAENLEQSLEQTGVSSSCTGLTQQGTQKFGGVRVGNGPTEDEAGIMDHDQLSQHSEEGDEHSEEEPFDFGDVAVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWSMVMHLGLSSRSGGGFFGLSIIFAAFAMLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGQGFK 855          

HSP 2 Score: 247.669 bits (631), Expect = 0.000e+0
Identity = 142/228 (62.28%), Postives = 172/228 (75.44%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MG LFRS+EM L QLFL +E AY C+SELGELGMVQF+D +PD + F RKFVNEVRRC+EM+RKLRF+EKEI+K  IP++DTG+NPE P PR++IDLE+TFEKLE EL+E+N N E LKKN+LEL ELK IL +TQ FFDE M D ++    LE        +    G  LRLGFVAGVI RER+  FERMLWR CRGNV+L++AEI+  LEDP +G +V  S   IF
Sbjct:    1 MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGMVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIKKVGIPMVDTGENPEVPFPRDMIDLEATFEKLENELKEINTNQEALKKNFLELTELKHILHRTQQFFDE-MEDPNL----LEESSALMEGSERGRGAPLRLGFVAGVISRERIPTFERMLWRVCRGNVFLRKAEIEDPLEDPTTGDQVHKSVFIIF 223          
BLAST of V-type proton ATPase subunit a vs. Ensembl Medaka
Match: atp6v0a2b (ATPase H+ transporting V0 subunit a2 [Source:NCBI gene;Acc:101164234])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 306/623 (49.12%), Postives = 405/623 (65.01%), Query Frame = 2
Query:  701 VFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSW------YPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFIL-----------------RKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            VFLI + GDQ+  +V KIC+ +H  +YP P+S  ER ++  G+ +RI+DL TVL++T+++  +VL+ A++++ +W  +V+K+KAIYYILN+ + DVT KC+I E WC + D+  ++ +L  G ++S S++   +N+I +   D PPT  + NKFT+ FQ+IVDAYGV  YREVNPAPFT+ITFPFLFAVMFGD GHG IM +FA WMV  E   + K + +EIWNTFF GRYIIL+MGIFSIYTGLIYND FSKS+N+FGS W          + N  +     + L+P      +  YP GIDP+W  A N++TF NS KMK+S+I GV  M FGVILS +NH +++ K  +Y  F+P+++FLL +FGYL+  IFYKW+AF+++DS  APS+LI  INMF+           +  P    Y GQ  +Q  LVV+A+  +P +L  KP  L                 R R  S +    L    ++  G    DL      +  Q    +E       +HQ IHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW MV+R+GL      G + L  VF  ++ LTV +LL+MEGLSAFLHALRLHWVEFQNKFYSG G K
Sbjct:  227 VFLISYWGDQIGQKVKKICDCYHCHLYPYPNSNEERIDVMEGLKTRIQDLHTVLHRTEDYLKQVLVKASESVHSWVVQVKKMKAIYYILNLCSFDVTNKCLIAEVWCPVSDIPTLRRSLEDGSKKSGSNISSFVNRIPTT--DTPPTLIRTNKFTSGFQNIVDAYGVGTYREVNPAPFTVITFPFLFAVMFGDLGHGAIMALFAGWMVFYENNRKLKNTRNEIWNTFFEGRYIILMMGIFSIYTGLIYNDCFSKSLNIFGSGWSVRPMFQTGEWTNDVLRGNHFLTLNPNIAGVFTGPYPLGIDPIWNLASNRLTFLNSYKMKMSVIVGVIHMSFGVILSTYNHVYFKKKYNLYLVFLPELLFLLCLFGYLVFMIFYKWLAFSAEDSSNAPSILIHFINMFLMQ-------GEEVQP---LYTGQHGLQVFLVVIAVFSVPVLLLGKPLYLYWLQHGRQHLGMYRGYERVRRSSDEELYLLRTH-DEEEGSSYSDLSGSGEKTTEQFNLADE------FLHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMRVGLRMDTALGVLFLVPVFGLFAVLTVSILLVMEGLSAFLHALRLHWVEFQNKFYSGTGVK 830          

HSP 2 Score: 155.606 bits (392), Expect = 0.000e+0
Identity = 94/224 (41.96%), Postives = 138/224 (61.61%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXX---XXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVE 696
            MGS  R  EM L QLFL + +AY CISELGELG+V+F+D +P+ +AF RK+VNE+++C+EMER L +L +EI+K  I + D   NP AP+P+ ++ +    ++ E EL EV  N E+L+KN LEL E   +LR ++ F    +    +  +      L  +  +    M   G +LGF +G+I R ++ AFERMLWR C+G   L  AE++  L+DP  G  V+
Sbjct:    1 MGSFLRGDEMCLAQLFLQSGSAYDCISELGELGLVEFRDLNPNVNAFQRKYVNEIKKCEEMERILGYLLREIKKADISLPDRDVNPVAPSPKNVMSIMEQLQRFELELGEVTRNKERLQKNLLELTEYTHMLRISRDFVQRPIEREPLQTQYEEFPFLEKDTVMDYSSMQRLGAKLGFFSGLIQRAKIEAFERMLWRVCKGYTILSYAEVEEYLQDPDKGEAVK 224          
BLAST of V-type proton ATPase subunit a vs. Planmine SMEST
Match: SMESG000006351.1 (SMESG000006351.1)

HSP 1 Score: 1228 bits (3176), Expect = 0.000e+0
Identity = 617/618 (99.84%), Postives = 617/618 (99.84%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLG GDNLSVTQEVEVEEFEFGECLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKFIPFSFEFISESKYEE
Sbjct:  213 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGVGDNLSVTQEVEVEEFEFGECLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKFIPFSFEFISESKYEE 830          

HSP 2 Score: 358.221 bits (918), Expect = 4.048e-110
Identity = 215/219 (98.17%), Postives = 215/219 (98.17%), Query Frame = 1
Query:   61 MALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAEQLKKNYLELLELKEILRKTQIFFDEGMHDSSMNEESLELLGEEGLKAGGMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVE S   IF
Sbjct:    1 MALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAEQLKKNYLELLELKEILRKTQIFFDEGMHDSSMNEESLELLGEEGLKAGGMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEKSVFLIF 219          
BLAST of V-type proton ATPase subunit a vs. Planmine SMEST
Match: SMESG000006351.1 (SMESG000006351.1)

HSP 1 Score: 1228 bits (3176), Expect = 0.000e+0
Identity = 617/618 (99.84%), Postives = 617/618 (99.84%), Query Frame = 2
Query:  695 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKXXXXXXXXXXXXKYEE 2548
            KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLG GDNLSVTQEVEVEEFEFGECLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKFIPFSFEFISESKYEE
Sbjct:  222 KSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGVGDNLSVTQEVEVEEFEFGECLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYKFIPFSFEFISESKYEE 839          

HSP 2 Score: 375.555 bits (963), Expect = 1.580e-116
Identity = 224/228 (98.25%), Postives = 224/228 (98.25%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIF 717
            MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAEQLKKNYLELLELKEILRKTQIFFDEGMHDSSMNEESLELLGEEGLKAGGMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVE S   IF
Sbjct:    1 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAEQLKKNYLELLELKEILRKTQIFFDEGMHDSSMNEESLELLGEEGLKAGGMAGQGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELEDPISGAKVEKSVFLIF 228          
BLAST of V-type proton ATPase subunit a vs. Planmine SMEST
Match: SMESG000044136.1 (SMESG000044136.1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 385/628 (61.31%), Postives = 486/628 (77.39%), Query Frame = 2
Query:  671 TLFRERKLKSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSN-KKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDP-LNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFI--LRKRNISSKRTENL----NGKINDIGGVER-----IDLGAGD-----NLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            T   ++  KSVF++FFQG+QL  RV +ICE +H +IYPC D+ TER+EM   VM+R+E+L+ VL+QTQ HRH VLI AAK+++ WF K+RKIK+IY+ILN+FN++VT KCMIGECWC + D+E I  ALR GMERSN ++QP++N++  + KK +PPT+N+VNKFT+ FQ+IVDAYGVA YREVNPAP+T+ITFPFLFAVMFGD GHGL+M +FA+ +VL E++   +KSD+EIWN FFGGRYIILLMGIFS+YTGLIYND+FSKS N+FGSSWYP  Y N+TI     +QL+P +++   + +YPFG+DPVWQ AKNKITF+NS+KMK+SII+G+ QM FGV+LS  N  + +D L I+ EFIPQ+IFL++IFGYL++EIF KWI F++  S CAPSLLIGLINMFMF+ + PP    +C P       Q  +Q  LVV+A++CIPWML  KP I  LR R     ++ +L     G +ND   V+      +D GA +     ++S     E EEFEFGE +VHQCIHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW+MV +IGL+Q   +GSVVLF +FA W++LTV VLL+MEGLSAFLHALRLHWVEFQNKFY G GYK
Sbjct:  249 TTTNKKVTKSVFVVFFQGEQLHLRVKRICEAYHATIYPCTDNPTERKEMIRNVMTRMEELKKVLDQTQNHRHNVLITAAKHIRVWFIKIRKIKSIYHILNLFNVNVTDKCMIGECWCPVNDIEAIYAALRLGMERSNGTIQPILNRLGDDIKKSKPPTFNRVNKFTSGFQNIVDAYGVANYREVNPAPYTVITFPFLFAVMFGDFGHGLLMFLFALAIVLRERQLSKQKSDNEIWNIFFGGRYIILLMGIFSMYTGLIYNDVFSKSFNIFGSSWYPGEYDNSTIQSNPELQLNPNVSSVYTNFTYPFGVDPVWQMAKNKITFTNSLKMKMSIIFGILQMLFGVVLSFINQWYNRDFLSIFAEFIPQVIFLMAIFGYLVVEIFIKWITFSAYTSPCAPSLLIGLINMFMFDSSPPP---AKCFP---LINDQFNLQKALVVIAVLCIPWMLIIKPLIIYLRHRQSHKNKSHSLLLLDPGHVNDAADVDHSLKSPVD-GANNTVVKMDISEDIVEEHEEFEFGEVVVHQCIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWQMVFKIGLAQPAMWGSVVLFFIFAAWAALTVAVLLMMEGLSAFLHALRLHWVEFQNKFYKGEGYK 869          

HSP 2 Score: 188.348 bits (477), Expect = 3.433e-49
Identity = 102/143 (71.33%), Postives = 125/143 (87.41%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGM 462
            MGSLFRS+EM LCQLFLHT++AY CIS+LGE+G ++F D+SPDT+AF RKFVNEVRRCDEMERKLR+LEKEI  D IPILDTGDNP AP PREIIDLE+  E +E++L+E+N N EQLK+NYLEL+EL  +L+KT+IFF+ G+
Sbjct:    1 MGSLFRSEEMTLCQLFLHTDSAYSCISQLGEIGAMEFIDTSPDTNAFQRKFVNEVRRCDEMERKLRYLEKEINLDVIPILDTGDNPPAPEPREIIDLETNLEGIEEDLKEINHNFEQLKRNYLELIELHYLLQKTKIFFEGGV 143          

HSP 3 Score: 63.929 bits (154), Expect = 5.167e-10
Identity = 30/61 (49.18%), Postives = 42/61 (68.85%), Query Frame = 1
Query:  538 QGLRLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELED-PISGAKVEISFLNIF 717
            +  ++ F++GVILRE++  FERMLWRACRGNV +K  EI+ +LED   +  KV  S   +F
Sbjct:  203 ENYKVEFISGVILREKIQGFERMLWRACRGNVLIKFNEIEVDLEDLTTTNKKVTKSVFVVF 263          
BLAST of V-type proton ATPase subunit a vs. Planmine SMEST
Match: SMESG000044136.1 (SMESG000044136.1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 385/628 (61.31%), Postives = 486/628 (77.39%), Query Frame = 2
Query:  671 TLFRERKLKSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSN-KKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDP-LNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFI--LRKRNISSKRTENL----NGKINDIGGVER-----IDLGAGD-----NLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            T   ++  KSVF++FFQG+QL  RV +ICE +H +IYPC D+ TER+EM   VM+R+E+L+ VL+QTQ HRH VLI AAK+++ WF K+RKIK+IY+ILN+FN++VT KCMIGECWC + D+E I  ALR GMERSN ++QP++N++  + KK +PPT+N+VNKFT+ FQ+IVDAYGVA YREVNPAP+T+ITFPFLFAVMFGD GHGL+M +FA+ +VL E++   +KSD+EIWN FFGGRYIILLMGIFS+YTGLIYND+FSKS N+FGSSWYP  Y N+TI     +QL+P +++   + +YPFG+DPVWQ AKNKITF+NS+KMK+SII+G+ QM FGV+LS  N  + +D L I+ EFIPQ+IFL++IFGYL++EIF KWI F++  S CAPSLLIGLINMFMF+ + PP    +C P       Q  +Q  LVV+A++CIPWML  KP I  LR R     ++ +L     G +ND   V+      +D GA +     ++S     E EEFEFGE +VHQCIHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW+MV +IGL+Q   +GSVVLF +FA W++LTV VLL+MEGLSAFLHALRLHWVEFQNKFY G GYK
Sbjct:  223 TTTNKKVTKSVFVVFFQGEQLHLRVKRICEAYHATIYPCTDNPTERKEMIRNVMTRMEELKKVLDQTQNHRHNVLITAAKHIRVWFIKIRKIKSIYHILNLFNVNVTDKCMIGECWCPVNDIEAIYAALRLGMERSNGTIQPILNRLGDDIKKSKPPTFNRVNKFTSGFQNIVDAYGVANYREVNPAPYTVITFPFLFAVMFGDFGHGLLMFLFALAIVLRERQLSKQKSDNEIWNIFFGGRYIILLMGIFSMYTGLIYNDVFSKSFNIFGSSWYPGEYDNSTIQSNPELQLNPNVSSVYTNFTYPFGVDPVWQMAKNKITFTNSLKMKMSIIFGILQMLFGVVLSFINQWYNRDFLSIFAEFIPQVIFLMAIFGYLVVEIFIKWITFSAYTSPCAPSLLIGLINMFMFDSSPPP---AKCFP---LINDQFNLQKALVVIAVLCIPWMLIIKPLIIYLRHRQSHKNKSHSLLLLDPGHVNDAADVDHSLKSPVD-GANNTVVKMDISEDIVEEHEEFEFGEVVVHQCIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWQMVFKIGLAQPAMWGSVVLFFIFAAWAALTVAVLLMMEGLSAFLHALRLHWVEFQNKFYKGEGYK 843          

HSP 2 Score: 229.565 bits (584), Expect = 4.296e-63
Identity = 135/237 (56.96%), Postives = 172/237 (72.57%), Query Frame = 1
Query:   34 MGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL--------RLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELED-PISGAKVEISFLNIF 717
            MGSLFRS+EM LCQLFLHT++AY CIS+LGE+G ++F D+SPDT+AF RKFVNEVRRCDEMERKLR+LEKEI  D IPILDTGDNP AP PREIIDLE+  E +E++L+E+N N EQLK+NYLEL+EL  +L+KT+IFF+      +++  S+    E          Q L        ++ F++GVILRE++  FERMLWRACRGNV +K  EI+ +LED   +  KV  S   +F
Sbjct:    1 MGSLFRSEEMTLCQLFLHTDSAYSCISQLGEIGAMEFIDTSPDTNAFQRKFVNEVRRCDEMERKLRYLEKEINLDVIPILDTGDNPPAPEPREIIDLETNLEGIEEDLKEINHNFEQLKRNYLELIELHYLLQKTKIFFEGDSESLTISVGSITENVEIFRMEDKSIEQKLVDNNKENYKVEFISGVILREKIQGFERMLWRACRGNVLIKFNEIEVDLEDLTTTNKKVTKSVFVVF 237          
BLAST of V-type proton ATPase subunit a vs. Planmine SMEST
Match: SMESG000044136.1 (SMESG000044136.1)

HSP 1 Score: 773.852 bits (1997), Expect = 0.000e+0
Identity = 385/628 (61.31%), Postives = 486/628 (77.39%), Query Frame = 2
Query:  671 TLFRERKLKSVFLIFFQGDQLKNRVIKICEGFHGSIYPCPDSQTERREMAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYILNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIMSN-KKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFAVMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMGIFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDP-LNTTTPSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNHRFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLLIGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWMLFAKPFI--LRKRNISSKRTENL----NGKINDIGGVER-----IDLGAGD-----NLSVTQXXXXXXXXXXXCLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMVLRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVEFQNKFYSGNGYK 2500
            T   ++  KSVF++FFQG+QL  RV +ICE +H +IYPC D+ TER+EM   VM+R+E+L+ VL+QTQ HRH VLI AAK+++ WF K+RKIK+IY+ILN+FN++VT KCMIGECWC + D+E I  ALR GMERSN ++QP++N++  + KK +PPT+N+VNKFT+ FQ+IVDAYGVA YREVNPAP+T+ITFPFLFAVMFGD GHGL+M +FA+ +VL E++   +KSD+EIWN FFGGRYIILLMGIFS+YTGLIYND+FSKS N+FGSSWYP  Y N+TI     +QL+P +++   + +YPFG+DPVWQ AKNKITF+NS+KMK+SII+G+ QM FGV+LS  N  + +D L I+ EFIPQ+IFL++IFGYL++EIF KWI F++  S CAPSLLIGLINMFMF+ + PP    +C P       Q  +Q  LVV+A++CIPWML  KP I  LR R     ++ +L     G +ND   V+      +D GA +     ++S     E EEFEFGE +VHQCIHTIEYCLGCISNTASYLRLWALSLAH QLSEVLW+MV +IGL+Q   +GSVVLF +FA W++LTV VLL+MEGLSAFLHALRLHWVEFQNKFY G GYK
Sbjct:  214 TTTNKKVTKSVFVVFFQGEQLHLRVKRICEAYHATIYPCTDNPTERKEMIRNVMTRMEELKKVLDQTQNHRHNVLITAAKHIRVWFIKIRKIKSIYHILNLFNVNVTDKCMIGECWCPVNDIEAIYAALRLGMERSNGTIQPILNRLGDDIKKSKPPTFNRVNKFTSGFQNIVDAYGVANYREVNPAPYTVITFPFLFAVMFGDFGHGLLMFLFALAIVLRERQLSKQKSDNEIWNIFFGGRYIILLMGIFSMYTGLIYNDVFSKSFNIFGSSWYPGEYDNSTIQSNPELQLNPNVSSVYTNFTYPFGVDPVWQMAKNKITFTNSLKMKMSIIFGILQMLFGVVLSFINQWYNRDFLSIFAEFIPQVIFLMAIFGYLVVEIFIKWITFSAYTSPCAPSLLIGLINMFMFDSSPPP---AKCFP---LINDQFNLQKALVVIAVLCIPWMLIIKPLIIYLRHRQSHKNKSHSLLLLDPGHVNDAADVDHSLKSPVD-GANNTVVKMDISEDIVEEHEEFEFGEVVVHQCIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWQMVFKIGLAQPAMWGSVVLFFIFAAWAALTVAVLLMMEGLSAFLHALRLHWVEFQNKFYKGEGYK 834          

HSP 2 Score: 213.386 bits (542), Expect = 1.313e-57
Identity = 127/228 (55.70%), Postives = 163/228 (71.49%), Query Frame = 1
Query:   61 MALCQLFLHTETAYMCISELGELGMVQFKDSSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAPAPREIIDLESTFEKLEKELQEVNINAXXXXXXXXXXXXXXXXXXXTQIFFDEGMHDSSMNXXXXXXXXXXXXXXXXMAGQGL--------RLGFVAGVILRERLAAFERMLWRACRGNVYLKQAEIDTELED-PISGAKVEISFLNIF 717
            M LCQLFLHT++AY CIS+LGE+G ++F D+SPDT+AF RKFVNEVRRCDEMERKLR+LEKEI  D IPILDTGDNP AP PREIIDLE+  E +E++L+E+N N EQLK+NYLEL+EL  +L+KT+IFF+      +++  S+    E          Q L        ++ F++GVILRE++  FERMLWRACRGNV +K  EI+ +LED   +  KV  S   +F
Sbjct:    1 MTLCQLFLHTDSAYSCISQLGEIGAMEFIDTSPDTNAFQRKFVNEVRRCDEMERKLRYLEKEINLDVIPILDTGDNPPAPEPREIIDLETNLEGIEEDLKEINHNFEQLKRNYLELIELHYLLQKTKIFFEGDSESLTISVGSITENVEIFRMEDKSIEQKLVDNNKENYKVEFISGVILREKIQGFERMLWRACRGNVLIKFNEIEVDLEDLTTTNKKVTKSVFVVF 228          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase subunit a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V0A10.000e+058.31ATPase H+ transporting V0 subunit a1 [Source:HGNC ... [more]
ATP6V0A10.000e+058.31ATPase H+ transporting V0 subunit a1 [Source:HGNC ... [more]
ATP6V0A12.936e-3858.31ATPase H+ transporting V0 subunit a1 [Source:HGNC ... [more]
ATP6V0A10.000e+057.84ATPase H+ transporting V0 subunit a1 [Source:HGNC ... [more]
ATP6V0A13.331e-3857.84ATPase H+ transporting V0 subunit a1 [Source:HGNC ... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-320.000e+053.38Probable V-type proton ATPase 116 kDa subunit a [... [more]
unc-320.000e+053.38Probable V-type proton ATPase 116 kDa subunit a [... [more]
unc-320.000e+053.38Probable V-type proton ATPase 116 kDa subunit a [... [more]
unc-320.000e+053.02Probable V-type proton ATPase 116 kDa subunit a [... [more]
unc-320.000e+053.02Probable V-type proton ATPase 116 kDa subunit a [... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vha100-10.000e+057.07gene:FBgn0028671 transcript:FBtr0301651[more]
Vha100-10.000e+057.07gene:FBgn0028671 transcript:FBtr0301650[more]
Vha100-10.000e+056.84gene:FBgn0028671 transcript:FBtr0335405[more]
Vha100-10.000e+056.84gene:FBgn0028671 transcript:FBtr0085375[more]
Vha100-10.000e+056.84gene:FBgn0028671 transcript:FBtr0085380[more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v0a1b0.000e+057.05ATPase H+ transporting V0 subunit a1b [Source:ZFIN... [more]
atp6v0a1a0.000e+055.95ATPase H+ transporting V0 subunit a1a [Source:ZFIN... [more]
atp6v0a2b0.000e+049.12ATPase H+ transporting V0 subunit a2b [Source:ZFIN... [more]
atp6v0a2b0.000e+049.12ATPase H+ transporting V0 subunit a2b [Source:ZFIN... [more]
atp6v0a2a0.000e+048.09ATPase H+ transporting V0 subunit a2a [Source:ZFIN... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gprc5cl10.000e+057.51G protein-coupled receptor class C group 5 member ... [more]
gprc5cl10.000e+056.42G protein-coupled receptor class C group 5 member ... [more]
gprc5cl10.000e+056.49G protein-coupled receptor class C group 5 member ... [more]
gprc5cl10.000e+056.09G protein-coupled receptor class C group 5 member ... [more]
gprc5cl10.000e+056.57G protein-coupled receptor class C group 5 member ... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp6v0a10.000e+058.05ATPase, H+ transporting, lysosomal V0 subunit A1 [... [more]
Atp6v0a10.000e+058.05ATPase, H+ transporting, lysosomal V0 subunit A1 [... [more]
Atp6v0a10.000e+057.44ATPase, H+ transporting, lysosomal V0 subunit A1 [... [more]
Atp6v0a10.000e+056.96ATPase, H+ transporting, lysosomal V0 subunit A1 [... [more]
Atp6v0a44.133e-4953.32ATPase, H+ transporting, lysosomal V0 subunit A4 [... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1G4|VPP1_MOUSE0.000e+058.05V-type proton ATPase 116 kDa subunit a isoform 1 O... [more]
sp|A1A5G6|VPP1_XENTR0.000e+056.42V-type proton ATPase 116 kDa subunit a isoform 1 O... [more]
sp|P25286|VPP1_RAT0.000e+057.44V-type proton ATPase 116 kDa subunit a isoform 1 O... [more]
sp|Q29466|VPP1_BOVIN0.000e+058.28V-type proton ATPase 116 kDa subunit a isoform 1 O... [more]
sp|Q9I8D0|VPP1_CHICK0.000e+056.98V-type proton ATPase 116 kDa subunit a isoform 1 O... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YEN20.000e+059.14V-type proton ATPase subunit a OS=Fasciola giganti... [more]
T1J3P70.000e+062.01V-type proton ATPase subunit a OS=Strigamia mariti... [more]
A0A293N0F10.000e+063.18V-type proton ATPase subunit a (Fragment) OS=Ornit... [more]
A0A293N3000.000e+063.18V-type proton ATPase subunit a (Fragment) OS=Ornit... [more]
A0A293LWN80.000e+063.18V-type proton ATPase subunit a (Fragment) OS=Ornit... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp6v0a1a0.000e+057.07ATPase H+ transporting V0 subunit a1 [Source:NCBI ... [more]
atp6v0a1a0.000e+057.10ATPase H+ transporting V0 subunit a1 [Source:NCBI ... [more]
atp6v0a1a0.000e+056.80ATPase H+ transporting V0 subunit a1 [Source:NCBI ... [more]
atp6v0a1a0.000e+056.43ATPase H+ transporting V0 subunit a1 [Source:NCBI ... [more]
atp6v0a1b0.000e+055.63V-type proton ATPase 116 kDa subunit a [Source:NCB... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-173p19.25.424e-5254.31si:ch73-173p19.2 [Source:ZFIN;Acc:ZDB-GENE-141212-... [more]
atp6v0a1b0.000e+055.08ATPase H+ transporting V0 subunit a1b [Source:ZFIN... [more]
ENSPMAT00000007572.13.867e-9154.22pep scaffold:Pmarinus_7.0:GL476513:271628:314868:1... [more]
ENSPMAT00000008240.11.890e-7450.85pep scaffold:Pmarinus_7.0:GL488770:2076:7376:-1 ge... [more]
ENSPMAT00000007554.17.451e-2769.70pep scaffold:Pmarinus_7.0:GL476513:170398:182587:1... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
VPH14.432e-14941.01Subunit a of vacuolar-ATPase V0 domain; one of two... [more]
STV13.268e-13538.85Subunit a of the vacuolar-ATPase V0 domain; one of... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO424810.000e+055.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282966.732e-4042.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V0A10.000e+055.01V-type proton ATPase 116 kDa subunit a [Source:NCB... [more]
ATP6V0A10.000e+054.19V-type proton ATPase 116 kDa subunit a [Source:NCB... [more]
atp6v0a1b0.000e+054.12V-type proton ATPase 116 kDa subunit a [Source:NCB... [more]
atp6v0a1b0.000e+053.93V-type proton ATPase 116 kDa subunit a [Source:NCB... [more]
atp6v0a2b0.000e+049.12ATPase H+ transporting V0 subunit a2 [Source:NCBI ... [more]
back to top
BLAST of V-type proton ATPase subunit a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006351.14.048e-11099.84SMESG000006351.1[more]
SMESG000006351.11.580e-11699.84SMESG000006351.1[more]
SMESG000044136.13.433e-4961.31SMESG000044136.1[more]
SMESG000044136.14.296e-6361.31SMESG000044136.1[more]
SMESG000044136.11.313e-5761.31SMESG000044136.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015427 ID=SMED30015427|Name=V-type proton ATPase subunit a|organism=Schmidtea mediterranea sexual|type=transcript|length=2683bp
CGGTCTGATCGAAATTTATATAAATCTTATATGATGGGTAGTTTATTTAG
AAGTCAAGAAATGGCTCTATGTCAATTATTTTTGCACACTGAAACTGCTT
ATATGTGCATTTCAGAATTGGGAGAACTTGGAATGGTCCAGTTCAAAGAT
AGTTCTCCTGATACAAGTGCTTTTCATCGCAAATTTGTCAACGAAGTTCG
TAGATGTGATGAAATGGAAAGGAAATTAAGATTTTTGGAGAAAGAGATTC
GCAAGGATACTATTCCAATCTTGGACACAGGTGATAATCCAGAAGCTCCG
GCTCCAAGGGAAATTATTGATTTGGAATCAACCTTTGAGAAATTAGAAAA
GGAACTCCAGGAAGTAAATATTAATGCTGAACAACTAAAAAAGAATTATC
TGGAATTGTTGGAGTTGAAGGAAATTTTAAGGAAAACGCAAATATTTTTT
GATGAGGGAATGCATGACAGCTCAATGAATGAGGAGTCGTTGGAATTGCT
GGGCGAGGAAGGTCTCAAGGCCGGGGGCATGGCAGGTCAAGGACTTAGAC
TTGGATTTGTTGCTGGTGTAATTTTGAGAGAAAGATTAGCAGCTTTTGAA
AGAATGCTTTGGCGAGCCTGCCGTGGTAATGTTTATTTGAAACAAGCAGA
AATCGACACGGAATTGGAAGACCCTATTTCGGGAGCGAAAGTTGAAATCA
GTTTTCTTAATATTTTTCCAAGGAGATCAGTTGAAGAATCGAGTTATTAA
AATTTGCGAAGGATTTCATGGTTCAATTTATCCGTGCCCAGATTCGCAAA
CTGAACGTCGAGAAATGGCAATTGGCGTTATGTCTAGAATTGAGGATTTG
CAAACGGTTCTAAATCAAACACAAGAACATAGGCACAGAGTTTTAATAGC
AGCCGCAAAAAATCTAAAAAATTGGTTTTGTAAAGTTCGCAAAATTAAAG
CCATCTATTATATATTAAATATGTTTAATCTTGATGTCACTGCTAAATGC
ATGATCGGTGAATGCTGGTGTGCTTTGGAGGATTTAGAACGAATAAAATT
GGCTTTAAGACATGGGATGGAGAGAAGTAATAGCTCTGTTCAACCAGTAA
TGAATCAAATCATGAGTAACAAAAAGGATGAACCTCCTACTTATAATAAA
GTGAATAAGTTTACAACTGCATTTCAAGATATAGTTGATGCATATGGAGT
GGCAAAGTATCGTGAGGTTAATCCAGCTCCTTTCACGATTATAACATTTC
CATTTTTATTTGCCGTTATGTTTGGTGATGCTGGTCATGGACTTATAATG
CTAATTTTCGCTATTTGGATGGTTTTGAATGAAAAAAAATATGAAAATAA
AAAGTCAGATGATGAAATTTGGAACACGTTTTTCGGAGGTCGATATATAA
TTCTTCTTATGGGAATATTTTCGATTTATACTGGACTGATATATAATGAT
ATATTTTCAAAGTCGATAAATGTTTTTGGATCATCTTGGTATCCAAATAT
CTATAAAAACGCAACAATAAATCCAACCTCTTTGATGCAATTAGACCCGT
TGAATACAACAACACCTAGTACTTCGTATCCATTTGGAATTGATCCAGTT
TGGCAAAATGCCAAAAATAAAATAACTTTTAGCAACTCAATAAAAATGAA
AATCTCTATTATATATGGTGTTGGGCAAATGTGTTTTGGAGTTATTTTAA
GTCTTTTCAATCACAGATTTTATCAAGACAAATTAGGCATTTATTGTGAA
TTTATACCTCAAATGATTTTCCTATTATCTATTTTTGGTTATTTAATAAT
TGAAATATTTTACAAATGGATTGCTTTTACATCCAAAGATTCTTATTGTG
CTCCGAGTTTATTAATTGGTCTCATAAATATGTTCATGTTTAACTATAAT
ACTCCGCCAACAGTGGCAGGCCAGTGTAATCCTAATGGCACATTTTATCG
GGGTCAAGCGGCCATTCAATCAATATTAGTGGTAATGGCTATCATTTGCA
TTCCTTGGATGCTTTTTGCAAAACCATTTATATTGAGAAAAAGGAATATC
AGCTCAAAAAGAACTGAAAATTTGAATGGGAAGATTAATGATATTGGAGG
TGTTGAACGAATTGATTTGGGAGCCGGAGATAATTTATCTGTAACTCAAG
AAGTGGAAGTAGAAGAATTTGAGTTCGGTGAGTGCTTAGTGCACCAATGT
ATCCACACAATTGAATATTGTCTCGGCTGTATATCTAATACAGCTTCATA
TTTGAGATTGTGGGCATTAAGTTTAGCTCATGGACAATTATCCGAGGTGC
TGTGGGAAATGGTTCTGAGAATAGGTCTATCGCAATCCAACTATTTCGGT
TCAGTTGTGCTTTTTATCGTTTTTGCGTTTTGGTCATCATTAACCGTTTT
TGTGCTTCTTTTAATGGAAGGTTTATCGGCCTTTCTTCATGCGCTTCGAT
TACATTGGGTTGAATTCCAAAACAAGTTCTACTCCGGCAATGGCTACAAA
TTTATTCCATTTTCATTTGAATTTATTAGCGAATCAAAATATGAAGAATA
GCTGTAATTGTTTTAGTTATCTCTTTTTAATTTCCTCTTAATCTCATTTG
GTTTTGATTTTATTTTATATATTTATAAATAGATAGATATTTTGTCTCAT
TGTCGTGACGTGTGTGTATGTATTAGTATAGGT
back to top

protein sequence of SMED30015427-orf-1

>SMED30015427-orf-1 ID=SMED30015427-orf-1|Name=SMED30015427-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MAIGVMSRIEDLQTVLNQTQEHRHRVLIAAAKNLKNWFCKVRKIKAIYYI
LNMFNLDVTAKCMIGECWCALEDLERIKLALRHGMERSNSSVQPVMNQIM
SNKKDEPPTYNKVNKFTTAFQDIVDAYGVAKYREVNPAPFTIITFPFLFA
VMFGDAGHGLIMLIFAIWMVLNEKKYENKKSDDEIWNTFFGGRYIILLMG
IFSIYTGLIYNDIFSKSINVFGSSWYPNIYKNATINPTSLMQLDPLNTTT
PSTSYPFGIDPVWQNAKNKITFSNSIKMKISIIYGVGQMCFGVILSLFNH
RFYQDKLGIYCEFIPQMIFLLSIFGYLIIEIFYKWIAFTSKDSYCAPSLL
IGLINMFMFNYNTPPTVAGQCNPNGTFYRGQAAIQSILVVMAIICIPWML
FAKPFILRKRNISSKRTENLNGKINDIGGVERIDLGAGDNLSVTQEVEVE
EFEFGECLVHQCIHTIEYCLGCISNTASYLRLWALSLAHGQLSEVLWEMV
LRIGLSQSNYFGSVVLFIVFAFWSSLTVFVLLLMEGLSAFLHALRLHWVE
FQNKFYSGNGYKFIPFSFEFISESKYEE*
back to top

protein sequence of SMED30015427-orf-2

>SMED30015427-orf-2 ID=SMED30015427-orf-2|Name=SMED30015427-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=250bp
RSDRNLYKSYMMGSLFRSQEMALCQLFLHTETAYMCISELGELGMVQFKD
SSPDTSAFHRKFVNEVRRCDEMERKLRFLEKEIRKDTIPILDTGDNPEAP
APREIIDLESTFEKLEKELQEVNINAEQLKKNYLELLELKEILRKTQIFF
DEGMHDSSMNEESLELLGEEGLKAGGMAGQGLRLGFVAGVILRERLAAFE
RMLWRACRGNVYLKQAEIDTELEDPISGAKVEISFLNIFPRRSVEESSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015991ATP hydrolysis coupled proton transport
GO:0006810transport
GO:0006811ion transport
GO:0015992proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002490V-ATPase_116kDa_su
Vocabulary: molecular function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0033179proton-transporting V-type ATPase, V0 domain
GO:0000220vacuolar proton-transporting V-type ATPase, V0 domain
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 51..71
NoneNo IPR availableCOILSCoilCoilcoord: 94..135
NoneNo IPR availablePANTHERPTHR11629:SF68V-TYPE PROTON ATPASE 116 KDA SUBUNIT A ISOFORM 1coord: 1..238
IPR002490V-type ATPase, V0 complex, 116kDa subunit familyPFAMPF01496V_ATPase_Icoord: 27..238
e-value: 5.7E-61
score: 206.5
IPR002490V-type ATPase, V0 complex, 116kDa subunit familyPANTHERPTHR11629VACUOLAR PROTON ATPASEScoord: 1..238