Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1

Overview
NamePleckstrin homology domain containing, family H (with MyTH4 domain) member 1
Smed IDSMED30015422
Length (bp)3984
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 (SMED30015422) t-SNE clustered cells

Violin plots show distribution of expression levels for Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 (SMED30015422) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 (SMED30015422) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 (SMED30015422) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015422

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30015422SMESG000058390.1 dd_Smed_v4_13619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015422SMESG000058390.1 dd_Smed_v4_13619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Human
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:HGNC Symbol;Acc:HGNC:30506])

HSP 1 Score: 163.696 bits (413), Expect = 8.064e-40
Identity = 171/743 (23.01%), Postives = 315/743 (42.40%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSID--LTHLVSQDHREH--------FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWH--------------TDRTISQLVTDYFPRSLID 3399
            +Y +PPD  S      +    PEQ  P   ++     N + + + K G L K++ K K W   W +L    L +Y       P D   I+KP     IE+ +    ++ D         + ++TT+   TY L   +     EWI+ ++ V+    A+ +      +    G +T+VK G+ K++WC L GK L YF ++ D FP G   L  + +E       S+E+   S  S +S        +YT+ I      P ++ + ++ E  TW ++L V   A  ++++++    +  +  L++ D              HS   I+ P++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+  QL+KQ+        R  Q +                    ++  P             L  W+ +A+ + +FLP    L +L+  L + R+ +S  E   Y+ YC   +++ Q    R   PS+ E+ +  +RNPY HSLPFS+PV+  +G Y V+ F   ++++   +++ Q     +  +       FA++    S ++    L  ++KICD+ISK+E+  K+ +      +G          + +F +QA   +       R  L       L+ YQ +  + +G + L+      + + L    Q E  +F                 ++T+ Q++  ++P+   D
Sbjct:  667 DYAIPPDAYST----DTEYSQPEQKLPKTCSS--SSDNGKNEPLEKSGYLLKMSGKVKSWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--HIELSASCSILRGDNKQ------TVQLTTEK-HTYYLTADSPNILEEWIKVLQNVLRVQAANPLSLQPEGKPTMKGLLTKVKHGYSKRVWCTLIGKTLYYFRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLST-------HYTIVIHPKDQGPTYLLIGSKHEKDTWLYHLTV---AAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGIISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAI-----DYHISLAQSALQICLTHPELQNEICCQLIKQT--------RRRQPQ--------------------NQPGP-------------LQGWQLLALCVGLFLPHHPFLWLLR--LHLKRNADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDASTTVEEFLNTLNQ-----DTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQPGKC--EGTRTVRLTYKNRLYFSVQARGET------DREKL-------LLMYQTNDQIINGLFPLNKDLALEMAALL---SQVEIGDFERPFSTPAGHVTNQCKVNQTLKQVIEKFYPKRYRD 1306          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Human
Match: PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1 [Source:HGNC Symbol;Acc:HGNC:17733])

HSP 1 Score: 159.844 bits (403), Expect = 1.078e-38
Identity = 158/619 (25.53%), Postives = 257/619 (41.52%), Query Frame = 1
Query: 1384 KRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVI-LQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFYHSTGDIMEPI---------------SLTT--GTFLKTGAIQLWKALQ-------RLASVD-HYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVV-----TKFFFRIQ 3147
            K G L K+  + K W   W +L    + +Y       P D   I+KP     +++ S+ + ++ +         +F++ ++  KTY L   +     EWIR ++ ++ +Q      +     +    GW+T+VK GH K +WC L GK   Y+ +  D  P G   + ++ IE       S+E+     +  +  S      + TL I     +P ++ +  + E  TW ++L V+    SA             L+ +          GD   P+               SLTT     L+T A++L+K+ Q         ASVD H S+ +  L           Q+C     L+ E+Y QLMKQ+     +          K+SL                                +  W+ +A+  P+FLP    L  +K+ L    D  S  E   Y++YC   +++      R   PS+ EV +I +RNP+ HSLPFS+PV+  +G+YHV+ F   S++    D  LQ L   E  +       FA++    S ++    L  S+KICD ISK+E+ +K+         GKS   T VV      + +FR Q
Sbjct:  581 KSGYLLKMGSQVKTWKRRWFVLRQGQIMYYK-----SPSDV--IRKPQG--QVDLNSRCQIVRGEGSQ------TFQLISEK-KTYYLTADSPSLLEEWIRVLQSLLKVQATGPPALLRGGTKPTVKGWLTKVKHGHSKVVWCALVGKIFYYYRSHEDKRPLGCLPVRDAHIEEVDRSCDSDEDYEAGGTRRLLSS------HCTLVIHPTEHSPTYLLIGTKHEKDTWLYHLTVAAGGSSAK-----VGTAYEQLIGK-----LMDGEGDPDSPLWRHPMLCYSKDGLYASLTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTAL-----------QVCLVHPELQSEIYCQLMKQTSCRPPQ----------KYSL--------------------------------MQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRS--ETGQYATYCQRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTV----DEFLQRLN-QEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKE------LHPGKSEGGTRVVKLMYKNRLYFRSQ 1101          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Human
Match: PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1 [Source:HGNC Symbol;Acc:HGNC:17733])

HSP 1 Score: 86.2705 bits (212), Expect = 1.707e-18
Identity = 53/155 (34.19%), Postives = 83/155 (53.55%), Query Frame = 1
Query: 2602 IFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQ 3066
            +FLP    L  +K+ L   R  +   E   Y++YC   +++      R   PS+ EV +I +RNP+ HSLPFS+PV+  +G+YHV+ F   S++    D  LQ L   E  +       FA++    S ++    L  S+KICD ISK+E+ +K+
Sbjct:    2 LFLPQHHFLWYVKQQL--QRHADPRSETGQYATYCQRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTV----DEFLQRL-NQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKE 149          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Celegans
Match: max-1 (Motor AXon guidance [Source:UniProtKB/TrEMBL;Acc:Q18420])

HSP 1 Score: 95.5153 bits (236), Expect = 1.853e-19
Identity = 130/629 (20.67%), Postives = 251/629 (39.90%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKL-NKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWI----REIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVS--IQAISADDIDLSKSIDLTHLVSQDH---REHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKE-HLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSP-SVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECL-LNLKEVCLFAIYLYLNSDQ-NKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKD 3093
            +Y LPPD  S  S             PT++ +    +   EK     G   +L + + K     + +  N  + FY  KH  + E+      P   ISI  +  +  ++    +Y     +F++ T   K     T ++  +H+W+      IK   L+  A  +   +++    +GW+TRVK G  KK++  L  + L++F N ND  P G+  L  + I  K +  +     +        +  +      +L +   +  P+++ L+   +   W +YLK +    A+     ++     +   V+ D    ++  + S  +I +    +     +   +++ +A Q   SV   +   + H++   N +S  VQ  +    L++EVY QL+K +  S            + F L               +G                  W+ +A+ IP+FLP   S+L +LK+++    D  +  + +  + +C   L +   + GR   PS+ EVT++  R+      P S+ V + +  Y ++ F   + I     S+        CL L ++   L    LY+N    +  + L    K+CD +S +E + +  +      D
Sbjct:  220 DYYLPPDASSRCSG----------GTPTSRTSLIPSRETMEKS----GYWTQLTDSRIKSLKRRYVVFKNGQISFYR-KHNNRDEE------PASKISISDIRSVTKLEQQGAAY-----AFQLITSTDK-MNFMTESERTTHDWVTILSAAIKATTLREMASRVTPIDASI---SGWLTRVKCGLSKKVFAALVNQKLMFFKNSNDLVPNGFLCLQGAQISEKHNGTEEYSGSSDEQLETTKEHPNQRKNNDSLCVQIANEDPVYLILRTSEDKEKWLYYLKSASGTAALCGTPFEILVQRMMAENVANDSPLWKDLLFASGEEIPKDTMTSVDHSDRKKTLEIARACQLFVSVLMRAQATQYHIDLAQNILSTAVQQEY----LRNEVYSQLIKMTSGS------------MPFGL---------------QG------------------WKLLALTIPLFLPKQYSLLWLLKRHISRWVDLPNESDETRMAIFCESALDRCLRVGGRQEGPSRLEVTSVLTRDVTRTKFPHSISVKLPNSEYQIVEFDGSTEIGQCLSSL--------CLKLGMRPALLSGYALYMNDPMTHSLLLLKGKQKLCDALSTWETRSRDAQRGRVISD 761          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Celegans
Match: max-1 (Motor AXon guidance [Source:UniProtKB/TrEMBL;Acc:Q18420])

HSP 1 Score: 95.1301 bits (235), Expect = 2.245e-19
Identity = 130/629 (20.67%), Postives = 251/629 (39.90%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKL-NKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWI----REIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVS--IQAISADDIDLSKSIDLTHLVSQDH---REHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKE-HLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSP-SVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECL-LNLKEVCLFAIYLYLNSDQ-NKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKD 3093
            +Y LPPD  S  S             PT++ +    +   EK     G   +L + + K     + +  N  + FY  KH  + E+      P   ISI  +  +  ++    +Y     +F++ T   K     T ++  +H+W+      IK   L+  A  +   +++    +GW+TRVK G  KK++  L  + L++F N ND  P G+  L  + I  K +  +     +        +  +      +L +   +  P+++ L+   +   W +YLK +    A+     ++     +   V+ D    ++  + S  +I +    +     +   +++ +A Q   SV   +   + H++   N +S  VQ  +    L++EVY QL+K +  S            + F L               +G                  W+ +A+ IP+FLP   S+L +LK+++    D  +  + +  + +C   L +   + GR   PS+ EVT++  R+      P S+ V + +  Y ++ F   + I     S+        CL L ++   L    LY+N    +  + L    K+CD +S +E + +  +      D
Sbjct:  324 DYYLPPDASSRCSG----------GTPTSRTSLIPSRETMEKS----GYWTQLTDSRIKSLKRRYVVFKNGQISFYR-KHNNRDEE------PASKISISDIRSVTKLEQQGAAY-----AFQLITSTDK-MNFMTESERTTHDWVTILSAAIKATTLREMASRVTPIDASI---SGWLTRVKCGLSKKVFAALVNQKLMFFKNSNDLVPNGFLCLQGAQISEKHNGTEEYSGSSDEQLETTKEHPNQRKNNDSLCVQIANEDPVYLILRTSEDKEKWLYYLKSASGTAALCGTPFEILVQRMMAENVANDSPLWKDLLFASGEEIPKDTMTSVDHSDRKKTLEIARACQLFVSVLMRAQATQYHIDLAQNILSTAVQQEY----LRNEVYSQLIKMTSGS------------MPFGL---------------QG------------------WKLLALTIPLFLPKQYSLLWLLKRHISRWVDLPNESDETRMAIFCESALDRCLRVGGRQEGPSRLEVTSVLTRDVTRTKFPHSISVKLPNSEYQIVEFDGSTEIGQCLSSL--------CLKLGMRPALLSGYALYMNDPMTHSLLLLKGKQKLCDALSTWETRSRDAQRGRVISD 865          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Fly
Match: CG43867 (gene:FBgn0264449 transcript:FBtr0332605)

HSP 1 Score: 172.94 bits (437), Expect = 4.411e-43
Identity = 192/875 (21.94%), Postives = 361/875 (41.26%), Query Frame = 1
Query: 1210 QNPNNECESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLV------SSSSSIHEGYPKTIAASTV------ETN----EILAMWECIAILIPIFLPSPS-VLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFF-FRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTIS-QLVTDYFPRSLIDV--PENVSQIKTLMIN---FLKSRDSGSDNNPVNSYSQYLQYLKE-----LCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALS 3729
            ++P N     +S +Y LPPD  S  +   + + S        Q+    P    E  + K G L KL  K K W   W +L N  L ++  +H  Q       +KP   I ++ + +I   +++  S      +FE+ T   K Y L   +     +WIR ++ V  ++   L++  +  +    GW+T+VK GH KK WC L GK  +YF    +  P G  ++ ++ +E    V  S+  +   ++ D +          T++I   H  P ++ L  + E   W ++L V      +      + +        D            H+   I  P+S      ++  AI+L+K++Q   SV   ++ +  ++         +Q       L+ E+   L+KQ+     R L    +  ++  L C   +L       +  +  +   P +I A +       ++N      +  W+ +A+ + +F+P  S +L  LK +L  SR+ ++  E   Y++YC   L++     GR   PS+ EV +I ++NPY HSLP ++PV++ + +Y V+SF   ++I+    ++   L   +        CLF+       +++   YL    K+CDVISK+E  +++  S                 KF   R+  + +     W      ++ +   L+CYQ +S +  G + LS      L S +      + +     D  +  + +  ++P    D    E +  ++ L+++    LK R +      ++    YL   ++      C  Q  P   P    SN+   A     +   E  L+ L+      + + P   +++FG     F++ +S
Sbjct:  477 ESPKNAKARGLSDDYALPPDAVSESTCMDASMPS----LLMRQSYVDSPSKKIES-LEKMGHLAKLGGKLKTWRKRWFVLKNGSLNYWKSQHDVQ-------RKPQGQIQLDEVCRIN--RAEGAS------TFEIDTGK-KVYYLTADSHATMDDWIRVLQNVQRRNATKLLLSRDDQKPTVQGWVTKVKNGHPKKCWCVLLGKMFLYFKAPAETNPLGQINMRDARVEEVEHVSDSDSEEREDAAQDQAR--------LTVAIYPAHQGPTYLILSGKPERDNWLYHLTVVSGGGPSAGTQYEQLVQKLMETDGDPNCVLWRHPILLHTKDTITAPLSSMHTETMQPEAIKLFKSIQLFMSV---AVNQPGIDYHVVLAQNALQHALDMPELQTEMICILIKQT----SRHLGQKLSVGVQQLLLCATQSLFTCDTQQAGHAQANGSSPTSIQAPSATPIIDCKSNPPVYSFVQGWQLLALAVSLFVPRSSRLLWYLKLHL--SRNADTKTETGKYAAYCERALERTLKNGGRETKPSRMEVLSILLKNPYHHSLPHAIPVHMMNSTYQVVSFDGSTTIEEFQATLAHELGTRDATNGF---CLFSDDPI---EKDLEHYLEPLAKLCDVISKWETALREKGSG----------------KFENSRVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNSQIVQGRFPLSRELALELASLMSQIDMGDYSLEKSRDVGVGLKGLDKFYPYRYRDALGAEQLKDVQELLVSKWMLLKGRST------LDCVRIYLTCCRKWPYFGACLFQAKPRQSP---ESNTASGATPVAWLAVAEDALNVLELSTMAPVARYPYSSVMTFGGCQDDFMLVVS 1282          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Fly
Match: CG43867 (gene:FBgn0264449 transcript:FBtr0343360)

HSP 1 Score: 171.785 bits (434), Expect = 1.213e-42
Identity = 189/852 (22.18%), Postives = 352/852 (41.31%), Query Frame = 1
Query: 1231 ESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPS-VLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFF-FRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTIS-QLVTDYFPRSLIDV--PENVSQIKTLMIN---FLKSRDSGSDNNPVNSYSQYLQYLKE-----LCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALS 3729
            ES +S +Y LPPD  S  +   + + S        Q+    P    E  + K G L KL  K K W   W +L N  L ++  +H  Q       +KP   I ++ + +I   +++  S      +FE+ T   K Y L   +     +WIR ++ V  ++   L++  +  +    GW+T+VK GH KK WC L GK  +YF    +  P G  ++ ++ +E    V  S+  +   ++ D +          T++I   H  P ++ L  + E   W ++L V      +      + +        D            H+   I  P+S      ++  AI+L+K++Q   SV   ++ +  ++         +Q       L+ E+   L+KQ+     R L    +  ++ +   G      S++ I +        S       +  W+ +A+ + +F+P  S +L  LK +L  SR+ ++  E   Y++YC   L++     GR   PS+ EV +I ++NPY HSLP ++PV++ + +Y V+SF   ++I+    ++   L   +        CLF+       +++   YL    K+CDVISK+E  +++  S                 KF   R+  + +     W      ++ +   L+CYQ +S +  G + LS      L S +      + +     D  +  + +  ++P    D    E +  ++ L+++    LK R +      ++    YL   ++      C  Q  P   P    SN+   A     +   E  L+ L+      + + P   +++FG     F++ +S
Sbjct:  568 ESGLSDDYALPPDAVSESTCMDASMPS----LLMRQSYVDSPSKKIES-LEKMGHLAKLGGKLKTWRKRWFVLKNGSLNYWKSQHDVQ-------RKPQGQIQLDEVCRIN--RAEGAS------TFEIDTGK-KVYYLTADSHATMDDWIRVLQNVQRRNATKLLLSRDDQKPTVQGWVTKVKNGHPKKCWCVLLGKMFLYFKAPAETNPLGQINMRDARVEEVEHVSDSDSEEREDAAQDQAR--------LTVAIYPAHQGPTYLILSGKPERDNWLYHLTVVSGGGPSAGTQYEQLVQKLMETDGDPNCVLWRHPILLHTKDTITAPLSSMHTETMQPEAIKLFKSIQLFMSV---AVNQPGIDYHVVLAQNALQHALDMPELQTEMICILIKQT----SRHLGQKLSVGVQVNKKLGKQTRAPSATPIID------CKSNPPVYSFVQGWQLLALAVSLFVPRSSRLLWYLKLHL--SRNADTKTETGKYAAYCERALERTLKNGGRETKPSRMEVLSILLKNPYHHSLPHAIPVHMMNSTYQVVSFDGSTTIEEFQATLAHELGTRDATNGF---CLFSDDPI---EKDLEHYLEPLAKLCDVISKWETALREKGSG----------------KFENSRVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNSQIVQGRFPLSRELALELASLMSQIDMGDYSLEKSRDVGVGLKGLDKFYPYRYRDALGAEQLKDVQELLVSKWMLLKGRST------LDCVRIYLTCCRKWPYFGACLFQAKPRQSP---ESNTASGATPVAWLAVAEDALNVLELSTMAPVARYPYSSVMTFGGCQDDFMLVVS 1344          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Fly
Match: CG43867 (gene:FBgn0264449 transcript:FBtr0332604)

HSP 1 Score: 171.785 bits (434), Expect = 1.444e-42
Identity = 189/852 (22.18%), Postives = 352/852 (41.31%), Query Frame = 1
Query: 1231 ESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPS-VLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFF-FRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTIS-QLVTDYFPRSLIDV--PENVSQIKTLMIN---FLKSRDSGSDNNPVNSYSQYLQYLKE-----LCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALS 3729
            ES +S +Y LPPD  S  +   + + S        Q+    P    E  + K G L KL  K K W   W +L N  L ++  +H  Q       +KP   I ++ + +I   +++  S      +FE+ T   K Y L   +     +WIR ++ V  ++   L++  +  +    GW+T+VK GH KK WC L GK  +YF    +  P G  ++ ++ +E    V  S+  +   ++ D +          T++I   H  P ++ L  + E   W ++L V      +      + +        D            H+   I  P+S      ++  AI+L+K++Q   SV   ++ +  ++         +Q       L+ E+   L+KQ+     R L    +  ++ +   G      S++ I +        S       +  W+ +A+ + +F+P  S +L  LK +L  SR+ ++  E   Y++YC   L++     GR   PS+ EV +I ++NPY HSLP ++PV++ + +Y V+SF   ++I+    ++   L   +        CLF+       +++   YL    K+CDVISK+E  +++  S                 KF   R+  + +     W      ++ +   L+CYQ +S +  G + LS      L S +      + +     D  +  + +  ++P    D    E +  ++ L+++    LK R +      ++    YL   ++      C  Q  P   P    SN+   A     +   E  L+ L+      + + P   +++FG     F++ +S
Sbjct:  898 ESGLSDDYALPPDAVSESTCMDASMPS----LLMRQSYVDSPSKKIES-LEKMGHLAKLGGKLKTWRKRWFVLKNGSLNYWKSQHDVQ-------RKPQGQIQLDEVCRIN--RAEGAS------TFEIDTGK-KVYYLTADSHATMDDWIRVLQNVQRRNATKLLLSRDDQKPTVQGWVTKVKNGHPKKCWCVLLGKMFLYFKAPAETNPLGQINMRDARVEEVEHVSDSDSEEREDAAQDQAR--------LTVAIYPAHQGPTYLILSGKPERDNWLYHLTVVSGGGPSAGTQYEQLVQKLMETDGDPNCVLWRHPILLHTKDTITAPLSSMHTETMQPEAIKLFKSIQLFMSV---AVNQPGIDYHVVLAQNALQHALDMPELQTEMICILIKQT----SRHLGQKLSVGVQVNKKLGKQTRAPSATPIID------CKSNPPVYSFVQGWQLLALAVSLFVPRSSRLLWYLKLHL--SRNADTKTETGKYAAYCERALERTLKNGGRETKPSRMEVLSILLKNPYHHSLPHAIPVHMMNSTYQVVSFDGSTTIEEFQATLAHELGTRDATNGF---CLFSDDPI---EKDLEHYLEPLAKLCDVISKWETALREKGSG----------------KFENSRVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNSQIVQGRFPLSRELALELASLMSQIDMGDYSLEKSRDVGVGLKGLDKFYPYRYRDALGAEQLKDVQELLVSKWMLLKGRST------LDCVRIYLTCCRKWPYFGACLFQAKPRQSP---ESNTASGATPVAWLAVAEDALNVLELSTMAPVARYPYSSVMTFGGCQDDFMLVVS 1674          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Fly
Match: CG43867 (gene:FBgn0264449 transcript:FBtr0332610)

HSP 1 Score: 171.4 bits (433), Expect = 1.656e-42
Identity = 198/878 (22.55%), Postives = 363/878 (41.34%), Query Frame = 1
Query: 1231 ESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVD--------HYSIKKEHLNEKFNR-------ISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLF-CGGDNLVSSSSSIHEGYPKTIAASTV------ETN----EILAMWECIAILIPIFLPSPS-VLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFF-FRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTIS-QLVTDYFPRSLIDV--PENVSQIKTLMIN---FLKSRDSGSDNNPVNSYSQYLQYLKE-----LCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALS 3729
            ES +S +Y LPPD  S  +   + + S        Q+    P    E  + K G L KL  K K W   W +L N  L ++  +H  Q       +KP   I ++ + +I   +++  S      +FE+ T   K Y L   +     +WIR ++ V  ++   L++  +  +    GW+T+VK GH KK WC L GK  +YF    +  P G  ++ ++ +E    V  S+  +   ++ D +          T++I   H  P ++ L  + E   W ++L V      +      + +        D            H+   I  P+S      ++  AI+L+K++Q   SV         H  + +  L    +        I  +++   + LG K  V +Q+ K+      R L +  T+    SLF C  D   +  +  +   P +I A +       ++N      +  W+ +A+ + +F+P  S +L  LK +L  SR+ ++  E   Y++YC   L++     GR   PS+ EV +I ++NPY HSLP ++PV++ + +Y V+SF   ++I+    ++   L   +        CLF+       +++   YL    K+CDVISK+E  +++  S                 KF   R+  + +     W      ++ +   L+CYQ +S +  G + LS      L S +      + +     D  +  + +  ++P    D    E +  ++ L+++    LK R +      ++    YL   ++      C  Q  P   P    SN+   A     +   E  L+ L+      + + P   +++FG     F++ +S
Sbjct:  568 ESGLSDDYALPPDAVSESTCMDASMPS----LLMRQSYVDSPSKKIES-LEKMGHLAKLGGKLKTWRKRWFVLKNGSLNYWKSQHDVQ-------RKPQGQIQLDEVCRIN--RAEGAS------TFEIDTGK-KVYYLTADSHATMDDWIRVLQNVQRRNATKLLLSRDDQKPTVQGWVTKVKNGHPKKCWCVLLGKMFLYFKAPAETNPLGQINMRDARVEEVEHVSDSDSEEREDAAQDQAR--------LTVAIYPAHQGPTYLILSGKPERDNWLYHLTVVSGGGPSAGTQYEQLVQKLMETDGDPNCVLWRHPILLHTKDTITAPLSSMHTETMQPEAIKLFKSIQLFMSVAVNQPGIDYHVVLAQNALQHALDMPELQTEMICILIKQTSRHLGQKLSVGVQVNKKLGKQT-RQLLLCATQ----SLFTC--DTQQAGHAQANGSSPTSIQAPSATPIIDCKSNPPVYSFVQGWQLLALAVSLFVPRSSRLLWYLKLHL--SRNADTKTETGKYAAYCERALERTLKNGGRETKPSRMEVLSILLKNPYHHSLPHAIPVHMMNSTYQVVSFDGSTTIEEFQATLAHELGTRDATNGF---CLFSDDPI---EKDLEHYLEPLAKLCDVISKWETALREKGSG----------------KFENSRVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNSQIVQGRFPLSRELALELASLMSQIDMGDYSLEKSRDVGVGLKGLDKFYPYRYRDALGAEQLKDVQELLVSKWMLLKGRST------LDCVRIYLTCCRKWPYFGACLFQAKPRQSP---ESNTASGATPVAWLAVAEDALNVLELSTMAPVARYPYSSVMTFGGCQDDFMLVVS 1376          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Fly
Match: CG43867 (gene:FBgn0264449 transcript:FBtr0332611)

HSP 1 Score: 171.4 bits (433), Expect = 1.877e-42
Identity = 189/859 (22.00%), Postives = 354/859 (41.21%), Query Frame = 1
Query: 1210 QNPNNECESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPS-VLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFF-FRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTIS-QLVTDYFPRSLIDV--PENVSQIKTLMIN---FLKSRDSGSDNNPVNSYSQYLQYLKE-----LCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALS 3729
            ++P N     +S +Y LPPD  S  +   + + S        Q+    P    E  + K G L KL  K K W   W +L N  L ++  +H  Q       +KP   I ++ + +I   +++  S      +FE+ T   K Y L   +     +WIR ++ V  ++   L++  +  +    GW+T+VK GH KK WC L GK  +YF    +  P G  ++ ++ +E    V  S+  +   ++ D +          T++I   H  P ++ L  + E   W ++L V      +      + +        D            H+   I  P+S      ++  AI+L+K++Q   SV   ++ +  ++         +Q       L+ E+   L+KQ+     R L    +  ++ +   G      S++ I +        S       +  W+ +A+ + +F+P  S +L  LK +L  SR+ ++  E   Y++YC   L++     GR   PS+ EV +I ++NPY HSLP ++PV++ + +Y V+SF   ++I+    ++   L   +        CLF+       +++   YL    K+CDVISK+E  +++  S                 KF   R+  + +     W      ++ +   L+CYQ +S +  G + LS      L S +      + +     D  +  + +  ++P    D    E +  ++ L+++    LK R +      ++    YL   ++      C  Q  P   P    SN+   A     +   E  L+ L+      + + P   +++FG     F++ +S
Sbjct:  807 ESPKNAKARGLSDDYALPPDAVSESTCMDASMPS----LLMRQSYVDSPSKKIES-LEKMGHLAKLGGKLKTWRKRWFVLKNGSLNYWKSQHDVQ-------RKPQGQIQLDEVCRIN--RAEGAS------TFEIDTGK-KVYYLTADSHATMDDWIRVLQNVQRRNATKLLLSRDDQKPTVQGWVTKVKNGHPKKCWCVLLGKMFLYFKAPAETNPLGQINMRDARVEEVEHVSDSDSEEREDAAQDQAR--------LTVAIYPAHQGPTYLILSGKPERDNWLYHLTVVSGGGPSAGTQYEQLVQKLMETDGDPNCVLWRHPILLHTKDTITAPLSSMHTETMQPEAIKLFKSIQLFMSV---AVNQPGIDYHVVLAQNALQHALDMPELQTEMICILIKQT----SRHLGQKLSVGVQVNKKLGKQTRAPSATPIID------CKSNPPVYSFVQGWQLLALAVSLFVPRSSRLLWYLKLHL--SRNADTKTETGKYAAYCERALERTLKNGGRETKPSRMEVLSILLKNPYHHSLPHAIPVHMMNSTYQVVSFDGSTTIEEFQATLAHELGTRDATNGF---CLFSDDPI---EKDLEHYLEPLAKLCDVISKWETALREKGSG----------------KFENSRVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNSQIVQGRFPLSRELALELASLMSQIDMGDYSLEKSRDVGVGLKGLDKFYPYRYRDALGAEQLKDVQELLVSKWMLLKGRST------LDCVRIYLTCCRKWPYFGACLFQAKPRQSP---ESNTASGATPVAWLAVAEDALNVLELSTMAPVARYPYSSVMTFGGCQDDFMLVVS 1590          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Zebrafish
Match: plekhh1 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 [Source:NCBI gene;Acc:565914])

HSP 1 Score: 166.007 bits (419), Expect = 9.496e-41
Identity = 145/637 (22.76%), Postives = 273/637 (42.86%), Query Frame = 1
Query: 1384 KRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDID------LSKSIDLTHLVSQD--HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLS 3270
            K G L K+  + K W   W IL N  + +Y       P D   I+KP          ++E   S  ++      +F++ T+  KT+ LA  +     +WIR ++ V+    +  I      +    GW+T+VK GH K +WC L GK   Y+ N+ D FP G   +  + +E       S+E+        +S        ++TL +     +P ++ +  + E  TW ++L V+  + ++  +       + K +D+  +       RE    S   +  P++      L+T AI+L+K+ Q   +V    ++   ++   +     +Q+C     L++E+Y QL+KQ+      +  + Q                                           W+ +++ + +FLP    L  L++YL   R+ +   E+  Y+ YC   +++      R   PS+ E+ +I +RNPY HSLPFS+PV+  + +Y V+ F   ++++   +++ Q        +   ++  FA++    S ++    L  + KICDVISK+E+ +K+        +G         ++  FR QA   +      +R  L       L+ YQ++ +V  G++ +S
Sbjct:  646 KTGYLLKMGSQVKAWKRRWFILRNGEILYYK-----SPSDV--IRKP--------QGQMELNSSCHIARGEGAQTFQLITEK-KTFYLAADSPNILEDWIRVLQNVLKVQASGPISMDKEVKPTARGWLTKVKHGHSKLVWCALIGKVFYYYRNQEDKFPLGQLRVREARVEEVDRSCDSDEDYEAGGRGFLSS-------HFTLVVHPKEQSPTYLLVGTKQEKDTWLYHLTVAAGSSASLRVGTEFEQLIGKLLDVDGVSDSALWKREVLCFSKEGLRYPLTTLPSEALQTEAIKLFKSCQLFINV---LVESPSIDYHTSLAQNALQVCLTHPELQNEMYCQLIKQTNCRTPHNYALTQC------------------------------------------WQLLSLCVALFLPQHHFLWYLRQYL--QRNADPRTEVGKYAVYCQRSVERTLQNGEREAKPSRMEILSILLRNPYHHSLPFSIPVHFMNNTYEVVGFDGSTTVEEFLNTVNQ-----RTGMRKPQISGFALFTDDPSGKDLEHCLQPANKICDVISKWEQALKELHPGKY--EGTRTVRLTYKSRLCFRAQAKGET------ERERL-------LLAYQVNDEVLQGHFPVS 1192          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Zebrafish
Match: plekhh1 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 [Source:NCBI gene;Acc:565914])

HSP 1 Score: 166.007 bits (419), Expect = 9.536e-41
Identity = 145/637 (22.76%), Postives = 273/637 (42.86%), Query Frame = 1
Query: 1384 KRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDID------LSKSIDLTHLVSQD--HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLS 3270
            K G L K+  + K W   W IL N  + +Y       P D   I+KP          ++E   S  ++      +F++ T+  KT+ LA  +     +WIR ++ V+    +  I      +    GW+T+VK GH K +WC L GK   Y+ N+ D FP G   +  + +E       S+E+        +S        ++TL +     +P ++ +  + E  TW ++L V+  + ++  +       + K +D+  +       RE    S   +  P++      L+T AI+L+K+ Q   +V    ++   ++   +     +Q+C     L++E+Y QL+KQ+      +  + Q                                           W+ +++ + +FLP    L  L++YL   R+ +   E+  Y+ YC   +++      R   PS+ E+ +I +RNPY HSLPFS+PV+  + +Y V+ F   ++++   +++ Q        +   ++  FA++    S ++    L  + KICDVISK+E+ +K+        +G         ++  FR QA   +      +R  L       L+ YQ++ +V  G++ +S
Sbjct:  646 KTGYLLKMGSQVKAWKRRWFILRNGEILYYK-----SPSDV--IRKP--------QGQMELNSSCHIARGEGAQTFQLITEK-KTFYLAADSPNILEDWIRVLQNVLKVQASGPISMDKEVKPTARGWLTKVKHGHSKLVWCALIGKVFYYYRNQEDKFPLGQLRVREARVEEVDRSCDSDEDYEAGGRGFLSS-------HFTLVVHPKEQSPTYLLVGTKQEKDTWLYHLTVAAGSSASLRVGTEFEQLIGKLLDVDGVSDSALWKREVLCFSKEGLRYPLTTLPSEALQTEAIKLFKSCQLFINV---LVESPSIDYHTSLAQNALQVCLTHPELQNEMYCQLIKQTNCRTPHNYALTQC------------------------------------------WQLLSLCVALFLPQHHFLWYLRQYL--QRNADPRTEVGKYAVYCQRSVERTLQNGEREAKPSRMEILSILLRNPYHHSLPFSIPVHFMNNTYEVVGFDGSTTVEEFLNTVNQ-----RTGMRKPQISGFALFTDDPSGKDLEHCLQPANKICDVISKWEQALKELHPGKY--EGTRTVRLTYKSRLCFRAQAKGET------ERERL-------LLAYQVNDEVLQGHFPVS 1192          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Zebrafish
Match: plekhh2 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 [Source:ZFIN;Acc:ZDB-GENE-081028-42])

HSP 1 Score: 139.813 bits (351), Expect = 8.189e-33
Identity = 149/639 (23.32%), Postives = 259/639 (40.53%), Query Frame = 1
Query: 1201 NKLQNPNNECESNVSL-------EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFK-LWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQ-AISADDIDLSKSID-LTHLVSQDHREHFYHST-----GDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQ 3066
             K Q   +E    VSL       +Y +PPD    +S +      PE  QP   ++     N   + + K G L K+ K +K  W   W +L +  L FY       P D   I+KP+  I +   S I   + D+          +V T     Y  A    +   EW+R ++ V     A  +      + +  G +T VK G  K +WC L GK L +F N+ D FP G   +  + +E +       E                    +T+S+        ++ + +  E   W ++L V+   A+     +  + +  L ++      + + H T       ++ P++      L+T AI+L+K  Q   +V   +I    ++         +Q+C     L++E+Y QL+KQ+           QT                       G P  +             W+ +A+ + +FLP+  +L  L+ +L   R  +S  E+  Y+ YC   L++ Q    R    S+ E+ +I +RNPY HSLPFS+PV+  + +Y V+SF   ++++     + Q        + +++        Y +    K +   L  +LKICDVI+K+E+  K+
Sbjct:  544 EKAQTSGSESHKTVSLSSMTSESDYAIPPDA---YSTDTECFE-PESKQPKTCSS---SGNILNESMEKSGYLLKMVKTWKKAWKRHWFVLKDGELLFYK-----SPSDV--IRKPLGQIELNACSTI--TRGDEKQM------LQVVTGKSVCYLKADSPNLL-EEWVRVLQSVQRIKAASPVFTQLDMRPVIKGHLTMVKHGCSKHVWCALFGKTLYFFRNQEDKFPLGQIKMWEARVEEEHKSCDLAE----------------LSAQHTISVQSGRQGSTYLLIDSPHEKMAWVYHLSVAAGTAVGQVGTEFEQLVGKLLNMDGNQGSQLWRHPTLCFSKEGLLFPLTTLPSQALQTEAIKLFKTCQLFINV---AIDTSAIDYHVTLAQCALQVCLTHPELQNEIYCQLIKQTWKK--------QTN----------------------GPPGPLQG-----------WQFLALCVGLFLPTHPILWYLQVHL--KRHGDSRTEVGKYAIYCQRSLERTQQKGERQARSSRMEILSILLRNPYHHSLPFSMPVHFLNNTYQVVSFDASTTVEEFQSRLNQD-------MGMRKTGQSGFSFYSDDPTGKDLEHCLQGNLKICDVIAKWEQASKE 1090          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Zebrafish
Match: plekhh2 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 [Source:ZFIN;Acc:ZDB-GENE-081028-42])

HSP 1 Score: 139.813 bits (351), Expect = 8.189e-33
Identity = 149/639 (23.32%), Postives = 259/639 (40.53%), Query Frame = 1
Query: 1201 NKLQNPNNECESNVSL-------EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFK-LWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQ-AISADDIDLSKSID-LTHLVSQDHREHFYHST-----GDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQ 3066
             K Q   +E    VSL       +Y +PPD    +S +      PE  QP   ++     N   + + K G L K+ K +K  W   W +L +  L FY       P D   I+KP+  I +   S I   + D+          +V T     Y  A    +   EW+R ++ V     A  +      + +  G +T VK G  K +WC L GK L +F N+ D FP G   +  + +E +       E                    +T+S+        ++ + +  E   W ++L V+   A+     +  + +  L ++      + + H T       ++ P++      L+T AI+L+K  Q   +V   +I    ++         +Q+C     L++E+Y QL+KQ+           QT                       G P  +             W+ +A+ + +FLP+  +L  L+ +L   R  +S  E+  Y+ YC   L++ Q    R    S+ E+ +I +RNPY HSLPFS+PV+  + +Y V+SF   ++++     + Q        + +++        Y +    K +   L  +LKICDVI+K+E+  K+
Sbjct:  544 EKAQTSGSESHKTVSLSSMTSESDYAIPPDA---YSTDTECFE-PESKQPKTCSS---SGNILNESMEKSGYLLKMVKTWKKAWKRHWFVLKDGELLFYK-----SPSDV--IRKPLGQIELNACSTI--TRGDEKQM------LQVVTGKSVCYLKADSPNLL-EEWVRVLQSVQRIKAASPVFTQLDMRPVIKGHLTMVKHGCSKHVWCALFGKTLYFFRNQEDKFPLGQIKMWEARVEEEHKSCDLAE----------------LSAQHTISVQSGRQGSTYLLIDSPHEKMAWVYHLSVAAGTAVGQVGTEFEQLVGKLLNMDGNQGSQLWRHPTLCFSKEGLLFPLTTLPSQALQTEAIKLFKTCQLFINV---AIDTSAIDYHVTLAQCALQVCLTHPELQNEIYCQLIKQTWKK--------QTN----------------------GPPGPLQG-----------WQFLALCVGLFLPTHPILWYLQVHL--KRHGDSRTEVGKYAIYCQRSLERTQQKGERQARSSRMEILSILLRNPYHHSLPFSMPVHFLNNTYQVVSFDASTTVEEFQSRLNQD-------MGMRKTGQSGFSFYSDDPTGKDLEHCLQGNLKICDVIAKWEQASKE 1090          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Zebrafish
Match: plekhh2 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 [Source:ZFIN;Acc:ZDB-GENE-081028-42])

HSP 1 Score: 134.035 bits (336), Expect = 5.383e-31
Identity = 185/857 (21.59%), Postives = 339/857 (39.56%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFK-LWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSI-QAISADDIDLSKSID-LTHLVSQDHREHFYHST-----GDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWH--------------TDRTISQLVTDYFPRSLIDV---PENVSQIKTLMINFLKSRDSGSDNNP---VNSYSQYLQYLKELCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALS 3729
            +Y +PPD    +S +      PE  QP   ++     N   + + K G L K+ K +K  W   W +L +  L FY       P D   I+KP+  I +   S I   + D+          +V T     Y  A    +   EW+R ++ V     A  +      + +  G +T VK G  K +WC L GK L +F N+ D FP G   +  + +E +       E                    +T+S+        ++ + +  E   W ++L V+   A+     +  + +  L ++      + + H T       ++ P++      L+T AI+L+K    +A      I    ++         +Q+C     L++E+Y QL+KQ+           QT                       G P  +             W+ +A+ + +FLP+  +L  L+ +L   R  +S  E+  Y+ YC   L++ Q    R    S+ E+ +I +RNPY HSLPFS+PV+  + +Y V+SF   ++++     + Q        + +++        Y +    K +   L  +LKICDVI+K+E+  K+         GK+  E     K  ++   + FSK     Q +     E L L+ YQ + ++ +G++ ++      + +      Q E  +F H              +++T+ Q++  ++P+         EN   I+ L   +   R   S       +    ++  +  +L +A+   T+ P    +   +LA         E  +S L+F     L   P   I++FG   + F + ++
Sbjct:  606 DYAIPPDA---YSTDTECFE-PESKQPKTCSS---SGNILNESMEKSGYLLKMVKTWKKAWKRHWFVLKDGELLFYK-----SPSDV--IRKPLGQIELNACSTI--TRGDEKQM------LQVVTGKSVCYLKADSPNLL-EEWVRVLQSVQRIKAASPVFTQLDMRPVIKGHLTMVKHGCSKHVWCALFGKTLYFFRNQEDKFPLGQIKMWEARVEEEHKSCDLAE----------------LSAQHTISVQSGRQGSTYLLIDSPHEKMAWVYHLSVAAGTAVGQVGTEFEQLVGKLLNMDGNQGSQLWRHPTLCFSKEGLLFPLTTLPSQALQTEAIKLFKLFINVA------IDTSAIDYHVTLAQCALQVCLTHPELQNEIYCQLIKQTWKK--------QTN----------------------GPPGPLQG-----------WQFLALCVGLFLPTHPILWYLQVHL--KRHGDSRTEVGKYAIYCQRSLERTQQKGERQARSSRMEILSILLRNPYHHSLPFSMPVHFLNNTYQVVSFDASTTVEEFQSRLNQD-------MGMRKTGQSGFSFYSDDPTGKDLEHCLQGNLKICDVIAKWEQASKEQHR------GKA--EIARTVKLTYK-NRLYFSK-----QVSGETERERL-LLAYQTNEEITAGHFPVNKELALEMAAL---LAQVEFGDFEHPLSSPGGSGNTPTKSNQTLRQVLERFYPKHYQHTCTEEENRQLIQRLSTRWASLRGQTSSECIRIYLTVARKWSFFGAKLFEAE---TVTPSALKNVRVWLA-------VHEDGISVLEFNAIKVLASYPYKSIVTFGVCGEDFKLVVA 1339          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 171.785 bits (434), Expect = 7.847e-43
Identity = 160/621 (25.76%), Postives = 273/621 (43.96%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSD-KVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD-----HREHFY-----HSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQ 3066
            +Y +PPD  S      S    PEQ  P   ++     N + + + K G L K+  K K W   W +L    L +Y       P D   I+KP     IE+ S    +K D K +  L      VT K  +TY L   +     EW+R ++ V+    A ++      +    G +T+VK G+ K++WC L GK L YF ++ + FP G   L  + +E       S+E+   +  S +S        +YT+ I      P ++ + ++ E  TWH++L ++   I+  ++       +  L+S +     +R H       HS   I   ++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+Y QL+KQ++         H+    + S   G                                W+ +A+   +FLP    + +LK YL  + DN +  E   Y+ YC   +++ Q    R   PS+ E+ +I +RNPY HSLPFS+PV+  +G+Y V+ F   ++++    ++ Q        + +++  L    L+ +    K+    L  +LKICD+ISK+E+  K+
Sbjct:  102 DYAIPPDAYSI----DSEFSEPEQKLPKTCSSSN--DNGKNELLEKSGYLLKMGGKIKTWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--QIELNSSSHILKGDGKQTVQL------VTEK--RTYYLTADSPNILDEWVRVLQSVLKVQAASVLFTQPDVKPTVKGLLTKVKHGYSKRVWCTLVGKTLYYFRSQEEKFPLGQIKLWEAKVEEVDRSCDSDEDYETNGRSLLST-------HYTIVIHPKEQDPTYLLIGSKHEKETWHYHLTMAA-GITGVNVGTEFEQLVCKLLSSEGEPCKYRSHLKHPVLCHSKEAITSALTTLPSEALQTEAIKLFKTCQLFLNAAVDSPAI-----DYHVSLAQSALQVCLTHPELQNEMYCQLIKQTR---------HRQPNNQASPIQG--------------------------------WQLLALCTGLFLPQHPYIWLLKLYLSKNADNRT--EAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQD-------IGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKE 636          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 172.555 bits (436), Expect = 8.971e-43
Identity = 160/621 (25.76%), Postives = 273/621 (43.96%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSD-KVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD-----HREHFY-----HSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQ 3066
            +Y +PPD  S      S    PEQ  P   ++     N + + + K G L K+  K K W   W +L    L +Y       P D   I+KP     IE+ S    +K D K +  L      VT K  +TY L   +     EW+R ++ V+    A ++      +    G +T+VK G+ K++WC L GK L YF ++ + FP G   L  + +E       S+E+   +  S +S        +YT+ I      P ++ + ++ E  TWH++L ++   I+  ++       +  L+S +     +R H       HS   I   ++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+Y QL+KQ++         H+    + S   G                                W+ +A+   +FLP    + +LK YL  + DN +  E   Y+ YC   +++ Q    R   PS+ E+ +I +RNPY HSLPFS+PV+  +G+Y V+ F   ++++    ++ Q        + +++  L    L+ +    K+    L  +LKICD+ISK+E+  K+
Sbjct:  425 DYAIPPDAYSI----DSEFSEPEQKLPKTCSSSN--DNGKNELLEKSGYLLKMGGKIKTWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--QIELNSSSHILKGDGKQTVQL------VTEK--RTYYLTADSPNILDEWVRVLQSVLKVQAASVLFTQPDVKPTVKGLLTKVKHGYSKRVWCTLVGKTLYYFRSQEEKFPLGQIKLWEAKVEEVDRSCDSDEDYETNGRSLLST-------HYTIVIHPKEQDPTYLLIGSKHEKETWHYHLTMAA-GITGVNVGTEFEQLVCKLLSSEGEPCKYRSHLKHPVLCHSKEAITSALTTLPSEALQTEAIKLFKTCQLFLNAAVDSPAI-----DYHVSLAQSALQVCLTHPELQNEMYCQLIKQTR---------HRQPNNQASPIQG--------------------------------WQLLALCTGLFLPQHPYIWLLKLYLSKNADNRT--EAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQD-------IGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKE 959          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 171.014 bits (432), Expect = 1.221e-42
Identity = 159/619 (25.69%), Postives = 270/619 (43.62%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSD-KVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHR------EH--FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQ 3066
            +Y +PPD  S      S    PEQ  P   ++     N + + + K G L K+  K K W   W +L    L +Y       P D   I+KP     IE+ S    +K D K +  L      VT K  +TY L   +     EW+R ++ V+    A ++      +    G +T+VK G+ K++WC L GK L YF ++ + FP G   L  + +E       S+E+   +  S +S        +YT+ I      P ++ + ++ E  TWH++L ++   I+  ++       +  L+S +         H    HS   I   ++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+Y QL+KQ++         H+    + S   G                                W+ +A+   +FLP    + +LK YL  + DN    E   Y+ YC   +++ Q    R   PS+ E+ +I +RNPY HSLPFS+PV+  +G+Y V+ F   ++++    ++ Q        + +++  L    L+ +    K+    L  +LKICD+ISK+E+  K+
Sbjct:  129 DYAIPPDAYSI----DSEFSEPEQKLPKTCSSSN--DNGKNELLEKSGYLLKMGGKIKTWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--QIELNSSSHILKGDGKQTVQL------VTEK--RTYYLTADSPNILDEWVRVLQSVLKVQAASVLFTQPDVKPTVKGLLTKVKHGYSKRVWCTLVGKTLYYFRSQEEKFPLGQIKLWEAKVEEVDRSCDSDEDYETNGRSLLST-------HYTIVIHPKEQDPTYLLIGSKHEKETWHYHLTMAA-GITGVNVGTEFEQLVCKLLSSEGEPCTQIWRHPVLCHSKEAITSALTTLPSEALQTEAIKLFKTCQLFLNAAVDSPAI-----DYHVSLAQSALQVCLTHPELQNEMYCQLIKQTR---------HRQPNNQASPIQG--------------------------------WQLLALCTGLFLPQHPYIWLLKLYLSKNADNRYLTEAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQD-------IGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKE 663          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 171.4 bits (433), Expect = 1.571e-42
Identity = 159/619 (25.69%), Postives = 271/619 (43.78%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSD-KVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHR------EH--FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQ 3066
            +Y +PPD  S      S    PEQ  P   ++     N + + + K G L K+  K K W   W +L    L +Y       P D   I+KP     IE+ S    +K D K +  L      VT K  +TY L   +     EW+R ++ V+    A ++      +    G +T+VK G+ K++WC L GK L YF ++ + FP G   L  + +E       S+E+   +  S +S        +YT+ I      P ++ + ++ E  TWH++L ++   I+  ++       +  L+S +         H    HS   I   ++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+Y QL+KQ++         H+    + S   G                                W+ +A+   +FLP    + +LK YL  + DN +  E   Y+ YC   +++ Q    R   PS+ E+ +I +RNPY HSLPFS+PV+  +G+Y V+ F   ++++    ++ Q        + +++  L    L+ +    K+    L  +LKICD+ISK+E+  K+
Sbjct:  317 DYAIPPDAYSI----DSEFSEPEQKLPKTCSSSN--DNGKNELLEKSGYLLKMGGKIKTWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--QIELNSSSHILKGDGKQTVQL------VTEK--RTYYLTADSPNILDEWVRVLQSVLKVQAASVLFTQPDVKPTVKGLLTKVKHGYSKRVWCTLVGKTLYYFRSQEEKFPLGQIKLWEAKVEEVDRSCDSDEDYETNGRSLLST-------HYTIVIHPKEQDPTYLLIGSKHEKETWHYHLTMAA-GITGVNVGTEFEQLVCKLLSSEGEPCTQIWRHPVLCHSKEAITSALTTLPSEALQTEAIKLFKTCQLFLNAAVDSPAI-----DYHVSLAQSALQVCLTHPELQNEMYCQLIKQTR---------HRQPNNQASPIQG--------------------------------WQLLALCTGLFLPQHPYIWLLKLYLSKNADNRT--EAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQD-------IGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKE 849          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 170.629 bits (431), Expect = 4.278e-42
Identity = 160/622 (25.72%), Postives = 272/622 (43.73%), Query Frame = 1
Query: 1249 EYCLPPDE---GSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSD-KVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHR------EH--FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQ 3066
            +Y +PPD     S FS        PEQ  P   ++     N + + + K G L K+  K K W   W +L    L +Y       P D   I+KP     IE+ S    +K D K +  L      VT K  +TY L   +     EW+R ++ V+    A ++      +    G +T+VK G+ K++WC L GK L YF ++ + FP G   L  + +E       S+E+   +  S +S        +YT+ I      P ++ + ++ E  TWH++L ++   I+  ++       +  L+S +         H    HS   I   ++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+Y QL+KQ++         H+    + S   G                                W+ +A+   +FLP    + +LK YL  + DN +  E   Y+ YC   +++ Q    R   PS+ E+ +I +RNPY HSLPFS+PV+  +G+Y V+ F   ++++    ++ Q        + +++  L    L+ +    K+    L  +LKICD+ISK+E+  K+
Sbjct:  633 DYAIPPDAYSIDSEFSE-------PEQKLPKTCSSSN--DNGKNELLEKSGYLLKMGGKIKTWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--QIELNSSSHILKGDGKQTVQL------VTEK--RTYYLTADSPNILDEWVRVLQSVLKVQAASVLFTQPDVKPTVKGLLTKVKHGYSKRVWCTLVGKTLYYFRSQEEKFPLGQIKLWEAKVEEVDRSCDSDEDYETNGRSLLST-------HYTIVIHPKEQDPTYLLIGSKHEKETWHYHLTMAA-GITGVNVGTEFEQLVCKLLSSEGEPCTQIWRHPVLCHSKEAITSALTTLPSEALQTEAIKLFKTCQLFLNAAVDSPAI-----DYHVSLAQSALQVCLTHPELQNEMYCQLIKQTR---------HRQPNNQASPIQG--------------------------------WQLLALCTGLFLPQHPYIWLLKLYLSKNADNRT--EAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQD-------IGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKE 1165          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Mouse
Match: Plekhh2 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 [Source:MGI Symbol;Acc:MGI:2146813])

HSP 1 Score: 155.221 bits (391), Expect = 1.934e-37
Identity = 143/609 (23.48%), Postives = 264/609 (43.35%), Query Frame = 1
Query: 1360 NNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLS--------KSIDLTHLVSQDHREH--FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQA 3150
            N + + + K G L K++ + K W   W +L    L +Y       P D   I+KP     IE+ +    ++ D         + ++ T+   TY L   +     EWI+ ++ V+    A+ +      +    G +T+VK G+ K++WC L GK L YF N+ D FP G   L  + +E       S+E+        +S        +YT+ +      P ++ + ++ E   W ++L V   A  +++I++         K +++    S     H    HS   I+ P++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+  QL+KQ++    R L+                         ++  P             L  W+ +A+ + +FLP    L +L+  L + R+ +S  E   Y+ YC   +++ Q    R   PS+ E+ +  +RNPY HS PFS+PV+  +G Y V+ F   ++++   +++ Q     +  +       FA++    S ++    L  ++KICD+ISK+E+  K+ +      +G          + +F +QA
Sbjct:  697 NGKNEPLEKSGYLLKMSVRVKTWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--HIELSASCSILRGDNKQ------TVQLATEK-HTYYLTADSPNILEEWIKVLQSVLRVQAANPLCLQPEGKPAVKGLLTKVKHGYSKRVWCMLVGKVLYYFRNQEDKFPLGQLKLWEAKVEEVDRSCDSDEDYETRGCYLLST-------HYTIIVHPKDQGPTYLLIGSKHEKEAWLYHLTV---AAGSNNINVGSEFEQLVCKLLNIEGEPSSQIWRHPMLCHSKEGILSPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAI-----DYHISLAQSALQVCLTHPELQNEICCQLIKQTR---RRQLQ-------------------------NQPGP-------------LQGWQLLALCVGLFLPHHPFLWLLQ--LHLQRNADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSRPFSIPVHFMNGLYQVVGFDASTTVEEFLNTLNQ-----DTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQPGKC--EGSRTVRLTYKNRLYFSVQA 1224          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Mouse
Match: Plekhh1 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 [Source:MGI Symbol;Acc:MGI:2144989])

HSP 1 Score: 152.14 bits (383), Expect = 1.451e-36
Identity = 157/654 (24.01%), Postives = 269/654 (41.13%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVI-LQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISAD-----DIDLSKSIDLTHLVSQDHREH--FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQ-------RLASVD-HYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVV-----TKFFFRIQ 3147
            +Y +PPD  S  S+          ++P ++       +   + + K G L K+  + K W   W +L    + +Y       P D   I+KP     +++ S  + ++ ++        +F++ + N KTY L   +     EWIR ++ ++ +Q      +     +    GW+T+VK GH K +WC L GK   Y+ +  D  P G   + ++ IE       S+E+     +  +  S      + TL I     +P ++ +  + E  TW ++L V+    +A      +  + K +D           H    +S   +   ++      L+T A++L+K+ Q         ASVD H S+ +  L           Q+C     L+ E+Y QLMKQ                                          I+    +   ++  W+ +A+  P+FLP    L  +K+ L    D  S  E   Y+ YC   +++      R   PS+ EV +I +RNP+ HSLPFS+PV+  +G+Y V+ F   S++    D  LQ L   E  +       FA++    S ++    L   +KICD ISK+E+ +K+         GKS   T VV      + +FR Q
Sbjct:  539 DYAIPPDACSLDSDY---------SEPEHKLQRTSSYSTDGEALEKSGYLLKMGSRVKTWKRRWFVLRQGQILYYK-----SPSDV--IRKPQG--QVDLNSHCQIVREEEAQ------TFQLISGN-KTYYLTAESPSLLEEWIRVLQSLLKVQVTGPPALHQGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSHEDKRPLGCLPVQDAHIEEVDRSCDSDEDYEAGGTGRLLSS------HCTLVIHPPEHSPTYLLIGTKHEKDTWLYHLTVAAGGSNAKVGTVYEQLIGKLMDGEGNPDSPLWRHPMLCYSQEGLCASLTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTAL-----------QVCLVHPELQSEIYCQLMKQ------------------------------------------ISCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRS--ETGQYAIYCQRAVERTLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTV----DEFLQRLN-QETGMRKPSQSGFALFTDDPSGRDLEHCLQGRVKICDAISKWEQTLKE------LHPGKSEGGTRVVKLMYKNRLYFRSQ 1095          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Mouse
Match: Plekhh1 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 [Source:MGI Symbol;Acc:MGI:2144989])

HSP 1 Score: 152.14 bits (383), Expect = 1.451e-36
Identity = 157/654 (24.01%), Postives = 269/654 (41.13%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVI-LQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISAD-----DIDLSKSIDLTHLVSQDHREH--FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQ-------RLASVD-HYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVV-----TKFFFRIQ 3147
            +Y +PPD  S  S+          ++P ++       +   + + K G L K+  + K W   W +L    + +Y       P D   I+KP     +++ S  + ++ ++        +F++ + N KTY L   +     EWIR ++ ++ +Q      +     +    GW+T+VK GH K +WC L GK   Y+ +  D  P G   + ++ IE       S+E+     +  +  S      + TL I     +P ++ +  + E  TW ++L V+    +A      +  + K +D           H    +S   +   ++      L+T A++L+K+ Q         ASVD H S+ +  L           Q+C     L+ E+Y QLMKQ                                          I+    +   ++  W+ +A+  P+FLP    L  +K+ L    D  S  E   Y+ YC   +++      R   PS+ EV +I +RNP+ HSLPFS+PV+  +G+Y V+ F   S++    D  LQ L   E  +       FA++    S ++    L   +KICD ISK+E+ +K+         GKS   T VV      + +FR Q
Sbjct:  539 DYAIPPDACSLDSDY---------SEPEHKLQRTSSYSTDGEALEKSGYLLKMGSRVKTWKRRWFVLRQGQILYYK-----SPSDV--IRKPQG--QVDLNSHCQIVREEEAQ------TFQLISGN-KTYYLTAESPSLLEEWIRVLQSLLKVQVTGPPALHQGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSHEDKRPLGCLPVQDAHIEEVDRSCDSDEDYEAGGTGRLLSS------HCTLVIHPPEHSPTYLLIGTKHEKDTWLYHLTVAAGGSNAKVGTVYEQLIGKLMDGEGNPDSPLWRHPMLCYSQEGLCASLTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTAL-----------QVCLVHPELQSEIYCQLMKQ------------------------------------------ISCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRS--ETGQYAIYCQRAVERTLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTV----DEFLQRLN-QETGMRKPSQSGFALFTDDPSGRDLEHCLQGRVKICDAISKWEQTLKE------LHPGKSEGGTRVVKLMYKNRLYFRSQ 1095          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. UniProt/SwissProt
Match: sp|Q9W5D0|Y34F_DROME (Uncharacterized protein CG43867 OS=Drosophila melanogaster OX=7227 GN=CG43867 PE=1 SV=4)

HSP 1 Score: 170.244 bits (430), Expect = 3.658e-41
Identity = 198/878 (22.55%), Postives = 363/878 (41.34%), Query Frame = 1
Query: 1231 ESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVD--------HYSIKKEHLNEKFNR-------ISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLF-CGGDNLVSSSSSIHEGYPKTIAASTV------ETN----EILAMWECIAILIPIFLPSPS-VLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFF-FRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTIS-QLVTDYFPRSLIDV--PENVSQIKTLMIN---FLKSRDSGSDNNPVNSYSQYLQYLKE-----LCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALS 3729
            ES +S +Y LPPD  S  +   + + S        Q+    P    E  + K G L KL  K K W   W +L N  L ++  +H  Q       +KP   I ++ + +I   +++  S      +FE+ T   K Y L   +     +WIR ++ V  ++   L++  +  +    GW+T+VK GH KK WC L GK  +YF    +  P G  ++ ++ +E    V  S+  +   ++ D +          T++I   H  P ++ L  + E   W ++L V      +      + +        D            H+   I  P+S      ++  AI+L+K++Q   SV         H  + +  L    +        I  +++   + LG K  V +Q+ K+      R L +  T+    SLF C  D   +  +  +   P +I A +       ++N      +  W+ +A+ + +F+P  S +L  LK +L  SR+ ++  E   Y++YC   L++     GR   PS+ EV +I ++NPY HSLP ++PV++ + +Y V+SF   ++I+    ++   L   +        CLF+       +++   YL    K+CDVISK+E  +++  S                 KF   R+  + +     W      ++ +   L+CYQ +S +  G + LS      L S +      + +     D  +  + +  ++P    D    E +  ++ L+++    LK R +      ++    YL   ++      C  Q  P   P    SN+   A     +   E  L+ L+      + + P   +++FG     F++ +S
Sbjct:  866 ESGLSDDYALPPDAVSESTCMDASMPS----LLMRQSYVDSPSKKIES-LEKMGHLAKLGGKLKTWRKRWFVLKNGSLNYWKSQHDVQ-------RKPQGQIQLDEVCRIN--RAEGAS------TFEIDTGK-KVYYLTADSHATMDDWIRVLQNVQRRNATKLLLSRDDQKPTVQGWVTKVKNGHPKKCWCVLLGKMFLYFKAPAETNPLGQINMRDARVEEVEHVSDSDSEEREDAAQDQAR--------LTVAIYPAHQGPTYLILSGKPERDNWLYHLTVVSGGGPSAGTQYEQLVQKLMETDGDPNCVLWRHPILLHTKDTITAPLSSMHTETMQPEAIKLFKSIQLFMSVAVNQPGIDYHVVLAQNALQHALDMPELQTEMICILIKQTSRHLGQKLSVGVQVNKKLGKQT-RQLLLCATQ----SLFTC--DTQQAGHAQANGSSPTSIQAPSATPIIDCKSNPPVYSFVQGWQLLALAVSLFVPRSSRLLWYLKLHL--SRNADTKTETGKYAAYCERALERTLKNGGRETKPSRMEVLSILLKNPYHHSLPHAIPVHMMNSTYQVVSFDGSTTIEEFQATLAHELGTRDATNGF---CLFSDDPI---EKDLEHYLEPLAKLCDVISKWETALREKGSG----------------KFENSRVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNSQIVQGRFPLSRELALELASLMSQIDMGDYSLEKSRDVGVGLKGLDKFYPYRYRDALGAEQLKDVQELLVSKWMLLKGRST------LDCVRIYLTCCRKWPYFGACLFQAKPRQSP---ESNTASGATPVAWLAVAEDALNVLELSTMAPVARYPYSSVMTFGGCQDDFMLVVS 1674          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. UniProt/SwissProt
Match: sp|Q00IB7|PKHH1_DANRE (Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 6.153e-40
Identity = 145/637 (22.76%), Postives = 273/637 (42.86%), Query Frame = 1
Query: 1384 KRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDID------LSKSIDLTHLVSQD--HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLS 3270
            K G L K+  + K W   W IL N  + +Y       P D   I+KP          ++E   S  ++      +F++ T+  KT+ LA  +     +WIR ++ V+    +  I      +    GW+T+VK GH K +WC L GK   Y+ N+ D FP G   +  + +E       S+E+        +S        ++TL +     +P ++ +  + E  TW ++L V+  + ++  +       + K +D+  +       RE    S   +  P++      L+T AI+L+K+ Q   +V    ++   ++   +     +Q+C     L++E+Y QL+KQ+      +  + Q                                           W+ +++ + +FLP    L  L++YL   R+ +   E+  Y+ YC   +++      R   PS+ E+ +I +RNPY HSLPFS+PV+  + +Y V+ F   ++++   +++ Q        +   ++  FA++    S ++    L  + KICDVISK+E+ +K+        +G         ++  FR QA   +      +R  L       L+ YQ++ +V  G++ +S
Sbjct:  646 KTGYLLKMGSQVKAWKRRWFILRNGEILYYK-----SPSDV--IRKP--------QGQMELNSSCHIARGEGAQTFQLITEK-KTFYLAADSPNILEDWIRVLQNVLKVQASGPISMDKEVKPTARGWLTKVKHGHSKLVWCALIGKVFYYYRNQEDKFPLGQLRVREARVEEVDRSCDSDEDYEAGGRGFLSS-------HFTLVVHPKEQSPTYLLVGTKQEKDTWLYHLTVAAGSSASLRVGTEFEQLIGKLLDVDGVSDSALWKREVLCFSKEGLRYPLTTLPSEALQTEAIKLFKSCQLFINV---LVESPSIDYHTSLAQNALQVCLTHPELQNEMYCQLIKQTNCRTPHNYALTQC------------------------------------------WQLLSLCVALFLPQHHFLWYLRQYL--QRNADPRTEVGKYAVYCQRSVERTLQNGEREAKPSRMEILSILLRNPYHHSLPFSIPVHFMNNTYEVVGFDGSTTVEEFLNTVNQ-----RTGMRKPQISGFALFTDDPSGKDLEHCLQPANKICDVISKWEQALKELHPGKY--EGTRTVRLTYKSRLCFRAQAKGET------ERERL-------LLAYQVNDEVLQGHFPVS 1192          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. UniProt/SwissProt
Match: sp|Q8IVE3|PKHH2_HUMAN (Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2)

HSP 1 Score: 163.696 bits (413), Expect = 3.872e-39
Identity = 171/743 (23.01%), Postives = 315/743 (42.40%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSID--LTHLVSQDHREH--------FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWH--------------TDRTISQLVTDYFPRSLID 3399
            +Y +PPD  S      +    PEQ  P   ++     N + + + K G L K++ K K W   W +L    L +Y       P D   I+KP     IE+ +    ++ D         + ++TT+   TY L   +     EWI+ ++ V+    A+ +      +    G +T+VK G+ K++WC L GK L YF ++ D FP G   L  + +E       S+E+   S  S +S        +YT+ I      P ++ + ++ E  TW ++L V   A  ++++++    +  +  L++ D              HS   I+ P++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+  QL+KQ+        R  Q +                    ++  P             L  W+ +A+ + +FLP    L +L+  L + R+ +S  E   Y+ YC   +++ Q    R   PS+ E+ +  +RNPY HSLPFS+PV+  +G Y V+ F   ++++   +++ Q     +  +       FA++    S ++    L  ++KICD+ISK+E+  K+ +      +G          + +F +QA   +       R  L       L+ YQ +  + +G + L+      + + L    Q E  +F                 ++T+ Q++  ++P+   D
Sbjct:  667 DYAIPPDAYST----DTEYSQPEQKLPKTCSS--SSDNGKNEPLEKSGYLLKMSGKVKSWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--HIELSASCSILRGDNKQ------TVQLTTEK-HTYYLTADSPNILEEWIKVLQNVLRVQAANPLSLQPEGKPTMKGLLTKVKHGYSKRVWCTLIGKTLYYFRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLST-------HYTIVIHPKDQGPTYLLIGSKHEKDTWLYHLTV---AAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGIISPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAI-----DYHISLAQSALQICLTHPELQNEICCQLIKQT--------RRRQPQ--------------------NQPGP-------------LQGWQLLALCVGLFLPHHPFLWLLR--LHLKRNADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDASTTVEEFLNTLNQ-----DTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQPGKC--EGTRTVRLTYKNRLYFSVQARGET------DREKL-------LLMYQTNDQIINGLFPLNKDLALEMAALL---SQVEIGDFERPFSTPAGHVTNQCKVNQTLKQVIEKFYPKRYRD 1306          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. UniProt/SwissProt
Match: sp|Q9ULM0|PKHH1_HUMAN (Pleckstrin homology domain-containing family H member 1 OS=Homo sapiens OX=9606 GN=PLEKHH1 PE=2 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 5.176e-38
Identity = 158/619 (25.53%), Postives = 257/619 (41.52%), Query Frame = 1
Query: 1384 KRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVI-LQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFYHSTGDIMEPI---------------SLTT--GTFLKTGAIQLWKALQ-------RLASVD-HYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVV-----TKFFFRIQ 3147
            K G L K+  + K W   W +L    + +Y       P D   I+KP     +++ S+ + ++ +         +F++ ++  KTY L   +     EWIR ++ ++ +Q      +     +    GW+T+VK GH K +WC L GK   Y+ +  D  P G   + ++ IE       S+E+     +  +  S      + TL I     +P ++ +  + E  TW ++L V+    SA             L+ +          GD   P+               SLTT     L+T A++L+K+ Q         ASVD H S+ +  L           Q+C     L+ E+Y QLMKQ+     +          K+SL                                +  W+ +A+  P+FLP    L  +K+ L    D  S  E   Y++YC   +++      R   PS+ EV +I +RNP+ HSLPFS+PV+  +G+YHV+ F   S++    D  LQ L   E  +       FA++    S ++    L  S+KICD ISK+E+ +K+         GKS   T VV      + +FR Q
Sbjct:  581 KSGYLLKMGSQVKTWKRRWFVLRQGQIMYYK-----SPSDV--IRKPQG--QVDLNSRCQIVRGEGSQ------TFQLISEK-KTYYLTADSPSLLEEWIRVLQSLLKVQATGPPALLRGGTKPTVKGWLTKVKHGHSKVVWCALVGKIFYYYRSHEDKRPLGCLPVRDAHIEEVDRSCDSDEDYEAGGTRRLLSS------HCTLVIHPTEHSPTYLLIGTKHEKDTWLYHLTVAAGGSSAK-----VGTAYEQLIGK-----LMDGEGDPDSPLWRHPMLCYSKDGLYASLTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTAL-----------QVCLVHPELQSEIYCQLMKQTSCRPPQ----------KYSL--------------------------------MQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRS--ETGQYATYCQRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTV----DEFLQRLN-QEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKE------LHPGKSEGGTRVVKLMYKNRLYFRSQ 1101          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. UniProt/SwissProt
Match: sp|Q8C115|PKHH2_MOUSE (Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3)

HSP 1 Score: 155.221 bits (391), Expect = 1.353e-36
Identity = 143/609 (23.48%), Postives = 264/609 (43.35%), Query Frame = 1
Query: 1360 NNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLS--------KSIDLTHLVSQDHREH--FYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRL--ASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQA 3150
            N + + + K G L K++ + K W   W +L    L +Y       P D   I+KP     IE+ +    ++ D         + ++ T+   TY L   +     EWI+ ++ V+    A+ +      +    G +T+VK G+ K++WC L GK L YF N+ D FP G   L  + +E       S+E+        +S        +YT+ +      P ++ + ++ E   W ++L V   A  +++I++         K +++    S     H    HS   I+ P++      L+T AI+L+K  Q    A+VD  +I     +   +     +Q+C     L++E+  QL+KQ++    R L+                         ++  P             L  W+ +A+ + +FLP    L +L+  L + R+ +S  E   Y+ YC   +++ Q    R   PS+ E+ +  +RNPY HS PFS+PV+  +G Y V+ F   ++++   +++ Q     +  +       FA++    S ++    L  ++KICD+ISK+E+  K+ +      +G          + +F +QA
Sbjct:  697 NGKNEPLEKSGYLLKMSVRVKTWKRRWFVLKGGELLYYK-----SPSDV--IRKPQG--HIELSASCSILRGDNKQ------TVQLATEK-HTYYLTADSPNILEEWIKVLQSVLRVQAANPLCLQPEGKPAVKGLLTKVKHGYSKRVWCMLVGKVLYYFRNQEDKFPLGQLKLWEAKVEEVDRSCDSDEDYETRGCYLLST-------HYTIIVHPKDQGPTYLLIGSKHEKEAWLYHLTV---AAGSNNINVGSEFEQLVCKLLNIEGEPSSQIWRHPMLCHSKEGILSPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAI-----DYHISLAQSALQVCLTHPELQNEICCQLIKQTR---RRQLQ-------------------------NQPGP-------------LQGWQLLALCVGLFLPHHPFLWLLQ--LHLQRNADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSRPFSIPVHFMNGLYQVVGFDASTTVEEFLNTLNQ-----DTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQPGKC--EGSRTVRLTYKNRLYFSVQA 1224          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. TrEMBL
Match: A0A267FAV5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012375g1 PE=4 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 9.144e-63
Identity = 262/1020 (25.69%), Postives = 438/1020 (42.94%), Query Frame = 1
Query:  961 ISELIKYLPFYTCVRGTPRLAKVSTCYAQNNTYLPXXXXXXXXXXXXALNPFGLTQKFIPVSPLDL--DDSIQPENHYSELPNKLQN-PNNEC--------ESNVSLEYCLPPDEGSNFSNNQSGL----RSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYL---------KVSIQAISADDIDLSKSI-----------------DLTHLVSQDHREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFS-----LFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPE-----------TNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPRSLIDVPENVSQIKTLMINFLKSRDSGSDNNPVNSYSQYLQYLKELCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALSLLPTKRCFKRIILNLPDNCTALEFVNNLVFYLTAAKSQDK 3849
            I  L   LP Y+CV+G+ RL ++                                       P+DL  D+S   E   SE  N  QN PN            S+VS++Y LPPD+ S   ++ +        P Q  P       +P    E ++IK G + KL+ KFK+W  FWCILT + L FY  K   +       QK    +S+E +  +          DL +   E      K+  L+  +  +   W   +   I +H + LI+  NS QLLH GW+ RVK G+ KK +C L G +L+Y+   ND  PTG + L NS I          E    SSS    D  +      TL+I      P++    +E+EF  W H L         KV  +  S       KS                   L  L+S +   +F HS   I  P+S    + L   AI L+     L  +  Y   + +  EK + +  +   CF    LKDE+YLQL+ Q+  S +  L   + +K KF      LFC   +  S+ S+  +  P+ IA S +    I + W+ +++++P+FLPS  VL   + YL     +N+   ++ ++S+C   + + + + GRS+PPS  EV ++ +R P++ S PFS+PV +    Y V+ F   S++  +  S + A   P          +++IY+    D   ++YL+++ K+CDV+SK +  +    S ST +D KS P            +     F+ R ++ + S  FD      L  +E L+ I YQI  D+    Y + G  +   +++L  A + +  +  H D+T+  L+   FP  +    + V  +K +++    +  S +    + +Y   L     L          PC    + D   G  +++   E  +   D   +  ++++ L+D+++FG  + +F +  S+  +  C++++          +E    +  YL A  S+ +
Sbjct:  582 IKALTAALPIYSCVKGSARLVQLH--------------------------------------PIDLQFDNS---ECESSEYDNAFQNDPNGRSVMSESAVSASSVSMDYYLPPDDTSATGDSANAAVLLAAGPLQNDP-------LP----ESKVIKNGFVNKLSGKFKVWKRFWCILTTQSLLFYPAKPGAK-------QKAQLCVSLEDIELVNRSSLHDYGIDLKVKGSE------KSLYLSCDSTSERSLWYYAMIGAIKRHSSELIVQRNSGQLLHKGWLKRVKCGNSKKFYCRLYGHFLVYYKRHNDSVPTGNKDLSNSII---------YEVSGGSSSESDGDYSEVNSHCRTLAIRAKEKEPVYFICSDESEFIKWRHLLTQIGSRIEPKVIAEPPSVPKTPTPKSSRKVMPRRQSWLSSPFSNHLALLISDEFYGNFCHSDQLIEAPVS-KLPSDLNNSAILLF----HLILLYVYPSTEANAMEKADLVKRLSLHCFDLPLLKDELYLQLLMQTIPSPKSKL-TPKERKSKFKCTSPKLFCSAHSSTSTISASSQ-QPR-IADSDLPA-VIQSSWQLLSLIVPLFLPSDLVLSFAEYYLNEQLKSNNAL-VAKFASFCQSCIHKTRELGGRSQPPSSLEVNSMLLRQPFSVSDPFSVPVSLLGKPYKVVGFHGSSTVADLCRSAITAFDLPST-----PNVVYSIYV---KDNQSFVYLDATWKVCDVLSKCDNGV----SISTFEDVKSSPASIAHLSIKDRPSRTPVDFYLRCRSYQLS-LFD----TELMDVE-LEAIVYQIQFDLLVSYYPVDGVTLLITVAHLCQALKGDYKQIIHKDQTLGLLIKQLFPLVVTQEEDRVMHLKLMLLEQWGANCSKTKLMCLRNYIGSLSGQDHL-----GARFFPCRC-VDFDLYRGTDLLLAVSEQAIHIFDANEQSVIEQVNLVDLVAFGGQNYNFFLVTSMSKSS-CYRKMQFTFTSPLDIMECSQIVCDYLKAVDSRGR 1492          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. TrEMBL
Match: A0A0R3SG86 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3897 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 3.003e-60
Identity = 209/806 (25.93%), Postives = 351/806 (43.55%), Query Frame = 1
Query: 1234 SNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIK---SDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNS-----------TIERKTSVIKSN---ENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSI---QAISADDIDLSKSIDLTHLVSQDHRE----HFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNE------------KFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSS---VERDLRMHQTKKIK------FSLFCGGDNLVSSSSSIHEGYPKTIAASTVETN--------EILAMWECIAILIPIFLPSPSVLQVLKKYLI-------ISRDNNSC---------------KEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQ-SGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQ---------NKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYS--LSGAQIFNLISYLFDAYQAECAEFWHTDR-TISQLVTDYFPR 3387
            S+ S EY +PP + S                 TN     + ++++ K     G L KL+ +FKLW  FWCIL +K L FY+ + +         + P K I +  + ++E  +   +D     +   +F +  +N + YTL +   I++  W  +I+  + + QA  I+  +  QL+ +GW+ R + G  +++W  L G +L+Y  +      TGYR L  +           T E  T V  S+   +N   + S              T+++  ++  P+++   N  E+  W H+L  +      IS     +       HL  Q  R     H  HS   + EPI     + L+  AI+L + L  L+++      +E                K+N I  I Q+CF++ GLKDE++LQL+KQ+  S   +  +++   T+  +        L C  D      +       ++ ++    +          I+ MWEC+AI   +FLPSP VL  L+ YL          R+  +                 EIS+++++C + + + +   GR+  PS FEV AIS+RNPYTHSLPFSLP++      Y VISF     +  +  S+L  L   E +   + +C   +Y  ++  Q          K IYL +   ICD+IS +E ++ +   SS       L   ++     FRI A+         Q +P     I+ ++ +Q+HSD+ SG +S  L G     L + +      + AE       T++Q++  YFPR
Sbjct:  453 SSASTEYNVPPTDDS-----------------TNNVELELSESHK-KSFHYAGRLSKLSSRFKLWQTFWCILADKSLLFYSDESEVD-------KWPKKCIDLSGVQRVERRREPRTDGRGKPVTSSAFNLIMENGRIYTLRSIKAIENRFWENKIRHALRRVQAERIVQMHEAQLVTSGWLRRYRRGQSQRVWGMLMGTFLVYSRDSRGQILTGYRDLSTTYIRCPAVFEEVTAETDTDVASSHLAYDNCDIADSESDIGFDKTEVSNLTIALWTSNRDPVYLVCSNNNEYERWKHHLLRACWFSSLISDTTPSVQPEARFLHLWGQLVRPCYSLHRTHSESVLKEPICRVLDSSLEANAIRLSEKLLSLSNLHARKTLEESEQRPSTSYRLPVDASKYNLIKEIAQMCFENSGLKDELFLQLIKQATPSAYILPAEVQHFGTEPTRRRAARVVDLLCHRDGAEDRRAHSSHRQQQSQSSRRFVSPPGYSYKWIPIIVMWECLAIYSTVFLPSPPVLACLQAYLTQFVIRVETGREEQTSPRGRRRKVLEARRLYSEISHFAAFCTDMIVRCRIRGGRTIVPSCFEVVAISLRNPYTHSLPFSLPIHFSLPIGYEVISFDGTMKVAQLMGSLLSKLELSEAV--AQGLCHCGLYCRISGPQYAFGRAPGRPKLIYLENGWNICDIISLYESKLTRADQSS------ELNLEDMTIDLVFRITAVSKKAVV---QASPFTD-RIMDIVAHQLHSDLYSGEFSIMLRGTHFLELTALMCRCDYVDYAELQRRQEVTLTQIMDRYFPR 1221          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. TrEMBL
Match: A0A183A5I3 (PH domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2218 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 4.560e-57
Identity = 235/1007 (23.34%), Postives = 423/1007 (42.01%), Query Frame = 1
Query: 1360 NNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPE---------DFFFIQKP--------------------VKGI-------SIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIE-----------RKTSVIKSNENXXXXXXXXXXXXXXXXXFYY------------TLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTH-----------LVSQDHREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKAL-----QRLASVDHYSIK--------KEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQ---SQSSVERDLRMH-----QTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAA---------STVETN---------------------------------------EILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSC-----------KEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGS-YHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQN--KYIYLNSSLKICDVISKFEEQI----KQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSL--SGAQIFNLISYLFDAYQAECAEFWHTDR-TISQLVTDYFPRSLIDV--PENVS--QIKTLMINFL----------------KSRDSGSDNNPVNSYS-----QYLQYLKELCDAQCSPT-------------------IIP-------CVASSNS-DYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGS--TSQHFLIALSLLP 3738
             + ++ I+ +G++ +L+ + K+W  +W +L    L  +   HQP  +         D   I+KP                     +GI       S+ +  K+  +  D +    + G FE+   + KT+ L   N  ++  W+R+IK+++   +A  ++  +  QL+  GW+ R+K G +  +WC L G +L+Y  + +   PTG++SL  + I+            + + I++ ++     S++I  +                    T+++  + S P+++  +   EF+ W   L  +   ++   +D  + I+              LV   +    YH+   I +P+S TT        ++++ +L       L +V H +           E L  K   + ++  LCF   GLKDE++LQL+KQ   S +  +R +R       ++ + +  LFC    L S+  +     P+ I++           VE N                                        ++A+WEC+ +++P+FLPSP VL  L+  + I  D +              E++ Y+++C + L Q     GR   PS  EV +IS+RNPYTHS PFS+P+Y+ SG  Y VISF+  S    +   +++ L    C  +    CLFAIYL LN      KY+YL+   K+CDVIS +E+ +    +Q +     +D           +  FRIQA  + +   ++     Q   ++ ++ +Q+H+D+ SG+Y +  +G+++ +L +YL      + +         ++QL+  YFP   +     +N S  Q+K L+++                  K+     D   V + S      YL+ L+ L  A+   T                   ++P        V+SSNS  ++ G       Q+     L+     C+K IP   ILSFG   +   FL+ +  LP
Sbjct:  754 GHTDRIIMHQGLMFRLSNRVKIWRRYWAVLNPSNLLLHT-SHQPSIQAPKRCILLSDIQSIRKPHNLSASITTGMVTSSVLEQDRQGIVTKYRNGSVPVTRKLAQLHQDNLGRT-NYGHFELILTSGKTHRLRGPNTAETELWMRQIKRMLRAVRAREVVRNHEAQLVTQGWLQRIKGGEISWVWCRLMGYFLVYAQSPDSLEPTGFKSLEGTQIKTLNTMYSNPILSRGTEIRTEDSTRQDHSAEIPATLSSSSDSDTLATGDSDVRNRTIALWTDKSDPVYLICRTGEEFKQWRDNLVRACHQVNLTTMD--RPIEPIEAQGRLKDYWRVLVRPPYTNDPYHTNELIKQPLSKTTEGKQSEYCVKMFASLLFLSYPELENVQHGAKVNLSNLLGLSEWLTMKHLIVKHLASLCFSLPGLKDELFLQLIKQAMLSDTQTKRLIRRQFPVSPRSMRPRLPLFCA--RLRSADDATSRRKPRDISSPLQSRLTDPRRVEFNIPLERATQLGDLSKQLTSDARLVFPVPSFIGLIRPEGWWPLVAVWECLCLVLPLFLPSPPVLHCLELLISIYHDADGPIRENLANGGLNAELARYAAFCKDALTQTLRYGGRVEVPSALEVASISIRNPYTHSYPFSIPIYLPSGGVYEVISFNGGSEFSYVIQQIVRKLGLSTCAQD--NSCLFAIYLRLNPSGKPPKYVYLSPDWKMCDVISLYEQAVLVLNQQEQQKVRLEDA--------TVELVFRIQAFCWKRLKRFHAS---QVKSLISMLAHQLHTDLLSGSYQVLPTGSELLDLAAYLCRTDHFDYSTLQRQREIDLNQLIHTYFPSEWLQTLSADNRSFIQLKLLLLDRWGWLCQHPVDLRHVCDSKAVQETKDETMVTASSVHACFSYLRTLRNLASARFGTTAFASHVFNLPGHVESELVWLVPQENQINLLVSSSNSAQWMGGMSRSQSAQDRTQRSLN-----CIKSIPYGAILSFGGQRSGAFFLVYVDRLP 1736          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. TrEMBL
Match: A0A068WZ63 (Pleckstrin y OS=Echinococcus granulosus OX=6210 GN=EgrG_000698000 PE=4 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 5.654e-57
Identity = 207/817 (25.34%), Postives = 357/817 (43.70%), Query Frame = 1
Query: 1234 SNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQK-PVKGISIEIMSKIEFIKSDKVSYDLHL---GSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTI-------ERK-------TSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVS--IQAISADDIDLSKSID--LTHLVSQDHRE----HFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNE-----------------KFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSS---VERDLRMHQTKKIK------FSLFC---GGDNLVSSSSSIHEGYPKTIAASTVETNE---ILAMWECIAILIPIFLPSPSVLQVLKKYLI-----------------------ISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQ-SGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQ---------NKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSG--NYSLSGAQIFNLISYLFDAYQAECAEFWHTDR-TISQLVTDYFPRSLIDV 3402
            S+ S EY +PP E SN  NN        Q + T+ A                G L KL+ +FKLW  FWC++ +K L FY         D   ++K P K I +  + ++E     +      +    +  +  ++ K YTL +    ++  W  +I++ + + QA  I    S QL+ +GW+ R + G   ++W  L G +L+Y  +    + TG+R L  + I       ER        TS   + ++   + S   +          T+S+   +  P+++   N+ E+  W ++L  +    ++ +D    S   +    HL  Q  R     H  HS   + EP+S    + L+  AI+L + L  L+++  ++ ++E + E                 K+N I  I Q+CF+ +GLKDE++LQL+KQ+  S   +  D+    T+  +        L C   G +   + S+   +   +  ++    +++   I+ MWEC+AI    FLPSP VL  L+ YL                        I+       E+S ++++C + L + +   GR   PS FEV AIS+RNPYTHSLPFSLP+++     Y V+SF     +  +  S+L  L   E +   + +C   +Y  ++  Q          + IYL +   +CDVIS +E  + +      T  G      ++     F + A+         Q +PL    I+ ++ +Q+HSD+ +G  N  L G     L + +      + AE       +++Q+V  YFP+  + V
Sbjct:  468 SSASTEYNVPPTEDSN--NNMEVEHLEAQKKSTHHA----------------GPLSKLSSRFKLWQRFWCVMADKSLLFYA--------DEAEVEKWPKKCIDLADVQRVERRHDHRPEGRGKVTVSSAINLVLQSGKIYTLRSSRITETRVWENKIRRALRRVQAERIFHMYSAQLVTSGWLRRYRRGQSHRVWGMLMGTFLVYARDARGQYLTGFRDLTTTYIRCLAIPEERSADNDRELTSSQLAYDDYDATDSESDAGIDINGVSNLTISLWAPNRDPVYLVCSNDEEYERWKYHLHRACWFSSLGSDSTVSSAEPESRFLHLWKQLVRPSCVLHRSHSEVPLKEPLSRIFDSLLENDAIRLSEKLLSLSNL--HTRRQERVVEETDHRPSAMYRFPVDADKYNLIKEIAQMCFESIGLKDELFLQLIKQATPSTYALRTDIHQFGTEPTRRRATRVVDLLCHRDGAEGRRAVSTQRQQPESQRFSSPPGYSHKWIPIIVMWECLAIYSTAFLPSPLVLACLQAYLSQFTLRAETSQEEHTTSPHGRRRKITEARKLYSEVSRFAAFCTDMLMRCRIRGGRRIVPSCFEVVAISLRNPYTHSLPFSLPIHIHLPTGYEVVSFDGTMKVHQLMGSLLGKLELSEAI--AQNLCHCGLYCRISGPQYVFGRAPARPRMIYLEAEWNVCDVISLYESTLTR------TDQGSDFSLEDMTIDIVFLVTAVSKKAIV---QTSPLTE-RIMDIVAHQLHSDLYTGELNIILRGTHFLELTALMCRCDYVDYAELQRGQEISLTQIVDQYFPQHCLTV 1244          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. TrEMBL
Match: W6UK29 (Uncharacterized protein OS=Echinococcus granulosus OX=6210 GN=EGR_03560 PE=4 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 6.158e-57
Identity = 207/817 (25.34%), Postives = 357/817 (43.70%), Query Frame = 1
Query: 1234 SNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQK-PVKGISIEIMSKIEFIKSDKVSYDLHL---GSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTI-------ERK-------TSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVS--IQAISADDIDLSKSID--LTHLVSQDHRE----HFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNE-----------------KFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSS---VERDLRMHQTKKIK------FSLFC---GGDNLVSSSSSIHEGYPKTIAASTVETNE---ILAMWECIAILIPIFLPSPSVLQVLKKYLI-----------------------ISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQ-SGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQ---------NKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSG--NYSLSGAQIFNLISYLFDAYQAECAEFWHTDR-TISQLVTDYFPRSLIDV 3402
            S+ S EY +PP E SN  NN        Q + T+ A                G L KL+ +FKLW  FWC++ +K L FY         D   ++K P K I +  + ++E     +      +    +  +  ++ K YTL +    ++  W  +I++ + + QA  I    S QL+ +GW+ R + G   ++W  L G +L+Y  +    + TG+R L  + I       ER        TS   + ++   + S   +          T+S+   +  P+++   N+ E+  W ++L  +    ++ +D    S   +    HL  Q  R     H  HS   + EP+S    + L+  AI+L + L  L+++  ++ ++E + E                 K+N I  I Q+CF+ +GLKDE++LQL+KQ+  S   +  D+    T+  +        L C   G +   + S+   +   +  ++    +++   I+ MWEC+AI    FLPSP VL  L+ YL                        I+       E+S ++++C + L + +   GR   PS FEV AIS+RNPYTHSLPFSLP+++     Y V+SF     +  +  S+L  L   E +   + +C   +Y  ++  Q          + IYL +   +CDVIS +E  + +      T  G      ++     F + A+         Q +PL    I+ ++ +Q+HSD+ +G  N  L G     L + +      + AE       +++Q+V  YFP+  + V
Sbjct:  468 SSASTEYNVPPTEDSN--NNMEVEHLEAQKKSTHHA----------------GPLSKLSSRFKLWQRFWCVMADKSLLFYA--------DEAEVEKWPKKCIDLADVQRVERRHDHRPEGRGKVTVSSAINLVLQSGKIYTLRSSRITETRVWENKIRRALRRVQAERIFHMYSAQLVTSGWLRRYRRGQSHRVWGMLMGTFLVYARDARGQYLTGFRDLTTTYIRCLAIPEERSADNDRELTSSQLAYDDYDATDSESDAGIDINGVSNLTISLWAPNRDPVYLVCSNDEEYERWKYHLHRACWFSSLGSDSTVSSAEPESRFLHLWKQLVRPSCVLHRSHSEVPLKEPLSRIFDSLLENDAIRLSEKLLSLSNL--HTRRQERVVEETDHRPSAMYRFPVDADKYNLIKEIAQMCFESIGLKDELFLQLIKQATPSTYALRTDIHQFGTEPTRRRATRVVDLLCHRDGAEGRRAVSTQRQQPESQRFSSPPGYSHKWIPIIVMWECLAIYSTAFLPSPLVLACLQAYLSQFTLRAETSQEEHTTSPHGRRRKITEARKLYSEVSRFAAFCTDMLMRCRIRGGRRIVPSCFEVVAISLRNPYTHSLPFSLPIHIHLPTGYEVVSFDGTMKVHQLMGSLLGKLELSEAI--AQNLCHCGLYCRISGPQYVFGRAPARPRMIYLEAEWNVCDVISLYESTLTR------TDQGSDFSLEDMTIDIVFLVTAVSKKAIV---QTSPLTE-RIMDIVAHQLHSDLYTGELNIILRGTHFLELTALMCRCDYVDYAELQRGQEISLTQIVDQYFPQHCLTV 1244          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Cavefish
Match: plekhh1 (pleckstrin homology domain-containing family H member 1 [Source:NCBI gene;Acc:103044638])

HSP 1 Score: 168.703 bits (426), Expect = 1.082e-41
Identity = 151/679 (22.24%), Postives = 289/679 (42.56%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD--------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNY 3261
            +Y +PPD  S  S+       PEQ     + +    ++   + + K G L K+  + K W   W IL N  + +Y       P D   I+KP           IE   S +++      +F++ T+  KT+ L   +     EWIR ++ ++    +  I+     +    GW+T+V+ GH K +WC L GK   Y+ N++D FP G   +  + +E       S+E+        +S        + TL +     +P ++ +  + E  TW ++L V+  +  +  +       +  L+  D          E   +S   +  P++      L+T A++L+K+ Q   +V    ++   ++   +     +Q+C     L++E+Y QL+KQ+      +  + Q                                           W+ +++ + +FLP    L  L++YL  + D N   E+  Y+ YC   +++      R   PS+ E+ +I +RNPY HSLPFS+PV+  + +Y V+ F   ++++   +++ Q        +   ++  FA++    S ++    L  + KICDVISK+E+ +K+ +      +G  +      ++ +FR QA   +      +R  L       L+ YQ++ +V  G++
Sbjct:  504 DYAIPPDAYSLDSD----YSEPEQK--VQRTSSYSCESVGPETLEKSGYLLKMGSQVKAWKRRWFILRNGEILYYK-----SPSDV--IRKP--------QGHIELNSSCRIARGEGAQTFQLITEK-KTFYLTADSPNILEEWIRVLQNILKVQASGPILVEIQAKPTVRGWLTKVRHGHSKLVWCTLTGKVFYYYRNQDDKFPLGQIRVREARVEEVDRSCDSDEDYEAGGRGFLSS-------HCTLVVHPKEQSPTYLLIGTKQEKDTWLYHLTVAAGSCPSLKVGTEYEQLIGKLLDVDGDSDSPLWKHEVLCYSRDGLQSPLTTLPSEALQTEALKLFKSFQLFINV---LVEAPSIDYHTSLAQSALQVCLTHPELQNEMYCQLIKQTNCRTPNNYSLTQC------------------------------------------WQLLSVCVALFLPQHRFLWYLRQYLQRNADPN---EVGKYAVYCQRSVERALQNGEREAKPSRMEIMSILLRNPYHHSLPFSIPVHFMNNTYQVVGFDGSTTVEEFVNTLNQ-----RAGMRKPQLSGFALFTDDPSGKDLEHCLQPAAKICDVISKWEQALKELQPGKY--EGTRIVRLTYKSRLWFRAQAKGET------ERERL-------LLAYQVNEEVHQGHF 1085          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Cavefish
Match: plekhh1 (pleckstrin homology domain-containing family H member 1 [Source:NCBI gene;Acc:103044638])

HSP 1 Score: 168.318 bits (425), Expect = 1.299e-41
Identity = 142/636 (22.33%), Postives = 273/636 (42.92%), Query Frame = 1
Query: 1384 KRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD--------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSL 3267
            K G L K+  + K W   W IL N  + +Y       P D   I+KP           IE   S +++      +F++ T+  KT+ L   +     EWIR ++ ++    +  I+     +    GW+T+V+ GH K +WC L GK   Y+ N++D FP G   +  + +E       S+E+        +S        + TL +     +P ++ +  + E  TW ++L V+  +  +  +       +  L+  D          E   +S   +  P++      L+T A++L+K+ Q   +V    ++   ++   +     +Q+C     L++E+Y QL+KQ+      +  + Q         C                                 W+ +++ + +FLP    L  L++YL   R+ +   E+  Y+ YC   +++      R   PS+ E+ +I +RNPY HSLPFS+PV+  + +Y V+ F   ++++   +++ Q        +   ++  FA++    S ++    L  + KICDVISK+E+ +K+ +      +G  +      ++ +FR QA   +      +R  L       L+ YQ++ +V  G++ +
Sbjct:  649 KSGYLLKMGSQVKAWKRRWFILRNGEILYYK-----SPSDV--IRKP--------QGHIELNSSCRIARGEGAQTFQLITEK-KTFYLTADSPNILEEWIRVLQNILKVQASGPILVEIQAKPTVRGWLTKVRHGHSKLVWCTLTGKVFYYYRNQDDKFPLGQIRVREARVEEVDRSCDSDEDYEAGGRGFLSS-------HCTLVVHPKEQSPTYLLIGTKQEKDTWLYHLTVAAGSCPSLKVGTEYEQLIGKLLDVDGDSDSPLWKHEVLCYSRDGLQSPLTTLPSEALQTEALKLFKSFQLFINV---LVEAPSIDYHTSLAQSALQVCLTHPELQNEMYCQLIKQTNCRTPNNYSLTQ---------C---------------------------------WQLLSVCVALFLPQHRFLWYLRQYL--QRNADPKSEVGKYAVYCQRSVERALQNGEREAKPSRMEIMSILLRNPYHHSLPFSIPVHFMNNTYQVVGFDGSTTVEEFVNTLNQ-----RAGMRKPQLSGFALFTDDPSGKDLEHCLQPAAKICDVISKWEQALKELQPGKY--EGTRIVRLTYKSRLWFRAQAKGET------ERERL-------LLAYQVNEEVHQGHFPV 1194          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Cavefish
Match: plekhh2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:103031122])

HSP 1 Score: 155.992 bits (393), Expect = 8.515e-38
Identity = 164/732 (22.40%), Postives = 300/732 (40.98%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFK-LWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQA-ISADDIDLSKSIDLTHLVSQDHREHFYH------STGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSG----------AQI-FNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPR 3387
            +Y +PPD  S  ++       PE   P  +       + + + + K G L K+ K +K  W   W +L +  L +Y       P D   I+KP          +IE   S  ++        +V T   + Y L   +     EW+R ++ V+    A  +      +    G + +VK G+ K++WC L GK L YF  + D FP G   L  +++E       S E+         + S        ++SI   +  P ++ + ++ E   W ++L V+  A +     D  + +     +  D     +       S   +  P++      L+T AI+L+K  Q   +V   +I    ++         +Q+C     L++E+Y QL+KQ+     R  + H                         G P  +             W+ +A+ + +FLP   +L +L+ +L    D+ +  E+  Y+ YC    ++ Q    R   PS+ E+ +I +RNPY HSLPFSLPV+  + +Y V+SF   ++++     + Q     +  +       F++Y    + QN   YL  SLKICD+ISK+E+  K+  +      GKS     V   +  R+       +F    R   +   +  L+ YQ + ++ +G++ ++           AQ+ F      F +     +    + +T+ Q++  ++P+
Sbjct:  571 DYAIPPDAYSTDTD----CSEPENKLP--KTCSSSSDSGKSEPMEKSGYLLKMVKTWKKTWKRRWFVLKDGELLYYK-----SPSDV--IRKP--------QGQIELSASSSIARGDGKQMLQVVTGK-RVYNLKADSPNLLEEWLRVLQCVLRVKAASPLFTQPDVRPAMKGHLMKVKHGYSKRVWCALFGKTLYYFRCQEDKFPLGQIRLWEASVEEVERSCDSEEDSKRGQIGSPARS--------SISIQSLNQAPTYLIIDSQHEKAAWLYHLSVAAGASMGQVGTDFEQLVGKLLNIDGDSGSQIWRHPMLCFSKEGLTSPLTTLPSQALQTEAIKLFKTCQLFINV---TIDTPAIDYHVTLAQCALQVCLTHPELQNEIYCQLIKQT-----RRRQPH-------------------------GQPGPLQG-----------WQFLALCVGLFLPQHPILWLLQVHLKKHADSRT--EVGKYAIYCQRSAERTQQKGDRQARPSRMEILSILLRNPYHHSLPFSLPVHFLNNTYQVVSFDASTTVEEFQTRLNQ-----DTGMRKTGQSGFSLYSDDPTGQNLEHYLQGSLKICDIISKWEQACKELHT------GKSENTRTVKLTYKNRL-------YFSQQLRGETERERL--LLAYQTNEEIVAGHFPVNKELALEMSALLAQVEFGDFEVPFSSAAGSGSGQAKSKQTLKQVLERFYPK 1206          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Cavefish
Match: plekhh2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:103031122])

HSP 1 Score: 155.606 bits (392), Expect = 1.273e-37
Identity = 164/732 (22.40%), Postives = 300/732 (40.98%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFK-LWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQA-ISADDIDLSKSIDLTHLVSQDHREHFYH------STGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSG----------AQI-FNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPR 3387
            +Y +PPD  S  ++       PE   P  +       + + + + K G L K+ K +K  W   W +L +  L +Y       P D   I+KP          +IE   S  ++        +V T   + Y L   +     EW+R ++ V+    A  +      +    G + +VK G+ K++WC L GK L YF  + D FP G   L  +++E       S E+         + S        ++SI   +  P ++ + ++ E   W ++L V+  A +     D  + +     +  D     +       S   +  P++      L+T AI+L+K  Q   +V   +I    ++         +Q+C     L++E+Y QL+KQ+     R  + H                         G P  +             W+ +A+ + +FLP   +L +L+ +L    D+ +  E+  Y+ YC    ++ Q    R   PS+ E+ +I +RNPY HSLPFSLPV+  + +Y V+SF   ++++     + Q     +  +       F++Y    + QN   YL  SLKICD+ISK+E+  K+  +      GKS     V   +  R+       +F    R   +   +  L+ YQ + ++ +G++ ++           AQ+ F      F +     +    + +T+ Q++  ++P+
Sbjct:  599 DYAIPPDAYSTDTD----CSEPENKLP--KTCSSSSDSGKSEPMEKSGYLLKMVKTWKKTWKRRWFVLKDGELLYYK-----SPSDV--IRKP--------QGQIELSASSSIARGDGKQMLQVVTGK-RVYNLKADSPNLLEEWLRVLQCVLRVKAASPLFTQPDVRPAMKGHLMKVKHGYSKRVWCALFGKTLYYFRCQEDKFPLGQIRLWEASVEEVERSCDSEEDSKRGQIGSPARS--------SISIQSLNQAPTYLIIDSQHEKAAWLYHLSVAAGASMGQVGTDFEQLVGKLLNIDGDSGSQIWRHPMLCFSKEGLTSPLTTLPSQALQTEAIKLFKTCQLFINV---TIDTPAIDYHVTLAQCALQVCLTHPELQNEIYCQLIKQT-----RRRQPH-------------------------GQPGPLQG-----------WQFLALCVGLFLPQHPILWLLQVHLKKHADSRT--EVGKYAIYCQRSAERTQQKGDRQARPSRMEILSILLRNPYHHSLPFSLPVHFLNNTYQVVSFDASTTVEEFQTRLNQ-----DTGMRKTGQSGFSLYSDDPTGQNLEHYLQGSLKICDIISKWEQACKELHT------GKSENTRTVKLTYKNRL-------YFSQQLRGETERERL--LLAYQTNEEIVAGHFPVNKELALEMSALLAQVEFGDFEVPFSSAAGSGSGQAKSKQTLKQVLERFYPK 1234          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Sea Lamprey
Match: PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1 [Source:HGNC Symbol;Acc:HGNC:17733])

HSP 1 Score: 77.0258 bits (188), Expect = 1.935e-14
Identity = 70/293 (23.89%), Postives = 122/293 (41.64%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQA-------HLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISA 2106
            +Y +PPD     S++      PE  +     + R   + + + + K G L KL  +   W   W +L    L +Y       P D   I+KP     +E+ +    ++ D+    + L    VT K +      + N ++  EW+R +  V+    A       HL  CA+       GW+T+VK G+ K++WC L GK   YF ++ D  P G  ++  + +E       S+E+   +S+     +      + TL +      P ++ +    E  TW H L V+  + S 
Sbjct:  458 DYAIPPDACWADSDHSE----PEH-KLLKTCSARSSDSARAETLEKSGYLLKLGGQVPAWKRRWFVLRGGELLYYK-----SPSDV--IRKPQG--QVELNACCRVVRGDEAQM-MQL----VTEKRVLFLAADSPNLLE--EWVRALHAVLHVQAARPGLVWPHLKPCAH-------GWLTKVKHGYSKRVWCALVGKIFYYFRSQEDKMPLGQLNVRGARVEEVDRSCDSDEDYEVTSARRSVAAPP----HLTLCVQPRDQGPTYLLIAGRHEKDTWLH-LTVAAGSTSG 717          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Nematostella
Match: EDO43015 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZW1])

HSP 1 Score: 120.939 bits (302), Expect = 6.895e-28
Identity = 138/665 (20.75%), Postives = 275/665 (41.35%), Query Frame = 1
Query: 1384 KRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSI-TQNHSTPIFITLQNEAEFRTWHHYLKV-SIQAISADDIDLSKSIDLTHLVSQDHREHFYH------STGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVY----VQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIY-LNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRI---QAIRFSKFFDWYQRN--------PL---QSLEILKLICYQIHSDVKSGNYSLSGAQIFNLIS 3297
            K G L KL  + K W   W +L +  L+++   ++         +KP+  + ++         S ++S      + EV T   +TY L+     +  EW+R +  V+ +  +  ++     +   +GW   VK G  +K WC L G++L Y+ N++D  P     L + T++ ++    S+E     + +           +YTL +  +  +TP ++ +  + E   W+ +L V S   +     D  K ++       D     ++      S   I  P++      L+  A++L+K++    +V   +  +  ++         +Q+ F +  L++E+Y QL+KQ+                                       +TI    V+    L  W+ +A+   +F+P    L  L+ +L   R  N   +   Y+ YC + L++      R   PS+ EV ++ ++NPY HS   SLPV+      S  Y V      ++++   +++          L ++E       ++ ++  +   + L +S+K+CDVISK+E+ ++ N       D K L +     + +F+    +     K+F  YQ N        P+    ++E+  L+    + D K+ + SL   +I  +I+
Sbjct:    1 KEGYLTKLGGRIKNWKKRWFVLQDGKLYYFKTPNETN-------RKPLGQVPLD--------GSCRISRTEGALTIEVATPK-RTYYLSGETSDEVDEWLRVLHNVMRKFASSPLLAQMPEKEAMSGW---VKHGTSRKSWCVLRGQFLCYYKNQDDAVPFSMAKLTDVTVDNESP--DSDEEGDADAPTYR---------HYTLVLKGERQATPTYLLIDTKQERDLWYFHLTVASGTGLGNMGTDFEKIVNKLMSNEGDSENELWNTPLLTFSREPITTPLTTLPSPELEKEALELFKSILLFTTV---ATDENAIDYHVALAQNALQVVFDNPELQNEIYCQLVKQTSK-------------------------------------QTIDLRPVQEYVYLQTWQLLAMCTSLFVPKQHFLVYLRAHL--KRSCNPKTKHGKYAIYCVKSLERTIANGKREARPSRMEVLSVLVQNPYDHSCRMSLPVHFIFDTFSDIYQVFGLDGSTTVEEFTEAI-------NSTLGIREASQSGFAIFTDNPVSPVEHCLQASVKLCDVISKWEQAMRSNGQGKL--DSKRLIKLTYRNRLYFKSLQDKETEKEKYFLVYQTNINVVKGRFPVSHDMAIELAALMAQIQYGDYKAHSNSLPSKRIEMVIA 584          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Medaka
Match: plekhh1 (pleckstrin homology, MyTH4 and FERM domain containing H1 [Source:NCBI gene;Acc:101165607])

HSP 1 Score: 164.851 bits (416), Expect = 1.362e-40
Identity = 151/679 (22.24%), Postives = 283/679 (41.68%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDH--------REHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNY 3261
            +Y +PPD  S  S++      PEQ +    +++     N E  + K G L K++ + K W   W IL N  + +Y       P D   I+KP          +IE   S  + +     +F++ T+  K+Y L   +     EWIR ++ ++       +  A   +    GW+T+VK GH K +WC L GK   Y+ N+ D  P G      ++++       S+E+        +S        + TL +     +P ++ +  + E   W ++L V+    +   +       +  L+  D          +    S   +  P++      L+T A++L+K+ Q   +V    ++   ++   +     +Q+C     L++E+Y QL+KQ+                                             T   + +   W+ +++   +FLP    L  L++YL ++ D  +  E+  Y+ YC   L++      R   PS+ E+ +I +RNPY HSLPFS+PV+  + +Y V+ F   + ++   +++ Q +      +   ++  FA+     S ++    L  + KICDVISK+E+ +K+        +G  +       + FFR      S+     +R  L       L+ YQ+++DV+ G +
Sbjct:  447 DYAIPPDACSLDSDHSE----PEQ-KVQRTSSYSCESINLEA-LEKSGYLLKMSSQVKAWKRRWFILRNGEILYYK-----SPSDV--IRKP--------QGQIELNSSCGLVHGEGAKTFQLITEK-KSYFLTADSPNILEEWIRVLQNILKVQACSPVSTATGGKPTMRGWLTKVKHGHSKLVWCSLVGKVFFYYRNQEDKLPLGQLQASEASVQEVDRSCDSDEDYEAGGRGFLSS-------HCTLVVQPREQSPTYLLIGTKQEKDAWLYHLTVAAGCGANFRVGTEYEQLIGKLLDADGDPDSPLWTSDALSFSKEGLRSPLTTLPSEALQTEALKLFKSCQLFINV---LVESPSVDYHTSLAQNALQVCLTHPELQNEMYCQLIKQTHRR------------------------------------------TPHNHSLTQCWQLLSLCAALFLPQQHFLWYLREYLQLNADTRT--EVGKYAVYCQRSLERTLQNGEREARPSRMEIISILLRNPYHHSLPFSIPVHFMNNTYQVVGFDGSTIVEEFLNTLNQRI-----AMRKPQLTGFALVTDDPSGKDLEHCLQPTDKICDVISKWEQALKEMHPGKN--EGTRIVRLTCKKRLFFR------SQVKGETERERL-------LLAYQVNADVQQGRF 1029          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Medaka
Match: plekhh2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:101155790])

HSP 1 Score: 139.428 bits (350), Expect = 9.780e-33
Identity = 144/631 (22.82%), Postives = 263/631 (41.68%), Query Frame = 1
Query: 1249 EYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFK-LWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQD--------HREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNL----KEVCLFAIYLYLNSDQNKYIY--LNSSLKICDVISKFEEQIKQNKS--SSTTK 3090
            +Y +PPD  S  +        PEQ  P  +       N +   + K G L K+ K +K  W   W +L +  L +Y       P D   I+KP   I +   S I   ++ +V   L +    VT K++      + N ++  EW+R ++ V+    A  +      + +  G + +VK G+ K+++C L GK L YF ++ D FP G   L  + +E         +             +      + LSI        ++ +++  E  +W ++L V+    +   +       +  L  +D        +      S   ++ P++      L+T A++L+K  Q   +V   +I    ++   +     +Q+C     L++E++ QL+KQ+     R  + H                           P  +             W+ +A+ + +FLP      +L+ +L   +  +S  E+  Y+ YC   +++ Q   GR   PS+ E+ +I +RNPY HSLPFS+PV+  + +Y V+SF   +++              +C LNL    ++  L    LY +    + +   +   +KICD+ISK+E+  K+N S  S TT+
Sbjct:  612 DYAIPPDAYSTDTE----CSEPEQKLP--KTCCSASDNGKADSMEKSGYLLKMVKTWKKTWKRRWFVLKDGELLYYK-----SPSDV--IRKPQGQIEVNGTSSIGRGEAKQV---LQI----VTGKHVCYLKADSPNLLE--EWLRVLQIVLRVKTASPLFTQPDVRPVMKGTLIKVKHGYSKRVYCALIGKTLYYFRSQEDKFPLGQIKLWEARVEE-------VDRSRGLDDILKECGRSLQSAPFILSIHPQDQGLTYLLVESRNEKESWLYHLSVAA-GTTVGKVGTEFEQLVGKLFQEDGDPNSQIWNHPMLVFSKEALLSPLTTLPSQALQTEAVKLFKTCQLFINV---AIDAPAIDYHVSLAQSALQVCLAHPELQNEIFCQLIKQT-----RKRQPH-------------------------AQPGPLQG-----------WQFLALCVGLFLPQHPFFWLLQVHL--QKHGDSRTEVGKYAIYCQRSMERTQLRGGRQARPSRMEILSILLRNPYHHSLPFSVPVHFLNNTYQVVSFDASTTVDEF-----------QCRLNLDTGMRKTGLSGFALYTDDPSGRELEHCVQGGIKICDIISKWEQASKENLSAKSDTTR 1155          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Planmine SMEST
Match: SMESG000058390.1 (SMESG000058390.1)

HSP 1 Score: 2477.59 bits (6420), Expect = 0.000e+0
Identity = 1253/1258 (99.60%), Postives = 1255/1258 (99.76%), Query Frame = 1
Query:   79 MESMGSKFPTDNLTDSDVINKDKILMDDFYXXXXXXXXXXXXXXXVMKKSLQNHLNFLMRKIRHIKLAKSEDLVEEETINSDGIRFSIADSNGLSSRCYTTLFDSLDDFSINQDNDEFRISGLENTTSLESYSSDSNIDLNAPEHFEQPPQIHISRKKILPSEDSDYQNRSTDTFFTNHLNEPIFLPEDLKGSILSPEIVIKSPRKSTRLHRQPIKTTSYNSTSQPTSPDPLCRKLLKDPPVHYTINTSVASSASQASPIDVLRSYHSSQDRERLQIKLNTEHIFPTNSSNFNTISELIKYLPFYTCVRGTPRLAKVSTCYAQNNTYLPXXXXXXXXXXXXALNPFGLTQKFIPVSPLDLDDSIQPENHYSELPNKLQNPNNECESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPRSLIDVPENVSQIKTLMINFLKSRDSGSDNNPVNSYSQYLQYLKELCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALSLLPTKRCFKRIILNLPDNCTALEFVNNLVFYLTAAKSQDKV 3852
            MESMGSKFPTDNLTDSDVINKDKILMDDFYKQKLQELEKENQQLKVMKKSLQNHLNFLMRKIRHIKLAKSEDLVEEETINSDGIRFSIADSNGLSSRCYTTLFDSLDDFSINQDNDEFRISGLENTTSLESYSSDSNIDLNAPEHFEQPPQIHISRKKILPSEDSDYQNRSTDTFFTNHLNEPIFLPEDLKGSILSPEIVIKSPRKSTRLHRQPIKTTSYNSTSQPTSPDPLCRKLLKDPPVHYTINTSVASSASQASPIDVLRSYHSSQDRERLQIKLNTEHIFPTNSSNFNTISELIKYLPFYTCVRGTPRLAKVSTCYAQNNTYLPSGSSSSFEIGESALNPFGLTQKFIPVSPLDLDDSIQPENHYSELPNK QNPNNECESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEV TKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENDAHSSSSDISDSQDYPDFYYTLSITQNHSTPIFITLQNE EFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAI+FSKFFDWYQRNPLQSLEILKLICYQIH+DVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPRSLIDVPENVSQIKTLMINFLKSRDSGSDNNPVNSYSQYLQYLKELCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALSLLPTKRCFKRIILNLPDNCTALEFVNNLVFYLTAAKSQDKV
Sbjct:    1 MESMGSKFPTDNLTDSDVINKDKILMDDFYKQKLQELEKENQQLKVMKKSLQNHLNFLMRKIRHIKLAKSEDLVEEETINSDGIRFSIADSNGLSSRCYTTLFDSLDDFSINQDNDEFRISGLENTTSLESYSSDSNIDLNAPEHFEQPPQIHISRKKILPSEDSDYQNRSTDTFFTNHLNEPIFLPEDLKGSILSPEIVIKSPRKSTRLHRQPIKTTSYNSTSQPTSPDPLCRKLLKDPPVHYTINTSVASSASQASPIDVLRSYHSSQDRERLQIKLNTEHIFPTNSSNFNTISELIKYLPFYTCVRGTPRLAKVSTCYAQNNTYLPSGSSSSFEIGESALNPFGLTQKFIPVSPLDLDDSIQPENHYSELPNKPQNPNNECESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVITKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENDAHSSSSDISDSQDYPDFYYTLSITQNHSTPIFITLQNETEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIKFSKFFDWYQRNPLQSLEILKLICYQIHADVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPRSLIDVPENVSQIKTLMINFLKSRDSGSDNNPVNSYSQYLQYLKELCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALSLLPTKRCFKRIILNLPDNCTALEFVNNLVFYLTAAKSQDKV 1258          
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Planmine SMEST
Match: SMESG000058390.1 (SMESG000058390.1)

HSP 1 Score: 2473.35 bits (6409), Expect = 0.000e+0
Identity = 1250/1255 (99.60%), Postives = 1252/1255 (99.76%), Query Frame = 1
Query:   88 MGSKFPTDNLTDSDVINKDKILMDDFYXXXXXXXXXXXXXXXVMKKSLQNHLNFLMRKIRHIKLAKSEDLVEEETINSDGIRFSIADSNGLSSRCYTTLFDSLDDFSINQDNDEFRISGLENTTSLESYSSDSNIDLNAPEHFEQPPQIHISRKKILPSEDSDYQNRSTDTFFTNHLNEPIFLPEDLKGSILSPEIVIKSPRKSTRLHRQPIKTTSYNSTSQPTSPDPLCRKLLKDPPVHYTINTSVASSASQASPIDVLRSYHSSQDRERLQIKLNTEHIFPTNSSNFNTISELIKYLPFYTCVRGTPRLAKVSTCYAQNNTYLPXXXXXXXXXXXXALNPFGLTQKFIPVSPLDLDDSIQPENHYSELPNKLQNPNNECESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENXXXXXXXXXXXXXXXXXFYYTLSITQNHSTPIFITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICYQIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPRSLIDVPENVSQIKTLMINFLKSRDSGSDNNPVNSYSQYLQYLKELCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALSLLPTKRCFKRIILNLPDNCTALEFVNNLVFYLTAAKSQDKV 3852
            MGSKFPTDNLTDSDVINKDKILMDDFYKQKLQELEKENQQLKVMKKSLQNHLNFLMRKIRHIKLAKSEDLVEEETINSDGIRFSIADSNGLSSRCYTTLFDSLDDFSINQDNDEFRISGLENTTSLESYSSDSNIDLNAPEHFEQPPQIHISRKKILPSEDSDYQNRSTDTFFTNHLNEPIFLPEDLKGSILSPEIVIKSPRKSTRLHRQPIKTTSYNSTSQPTSPDPLCRKLLKDPPVHYTINTSVASSASQASPIDVLRSYHSSQDRERLQIKLNTEHIFPTNSSNFNTISELIKYLPFYTCVRGTPRLAKVSTCYAQNNTYLPSGSSSSFEIGESALNPFGLTQKFIPVSPLDLDDSIQPENHYSELPNK QNPNNECESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEV TKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENDAHSSSSDISDSQDYPDFYYTLSITQNHSTPIFITLQNE EFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAI+FSKFFDWYQRNPLQSLEILKLICYQIH+DVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPRSLIDVPENVSQIKTLMINFLKSRDSGSDNNPVNSYSQYLQYLKELCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALSLLPTKRCFKRIILNLPDNCTALEFVNNLVFYLTAAKSQDKV
Sbjct:    1 MGSKFPTDNLTDSDVINKDKILMDDFYKQKLQELEKENQQLKVMKKSLQNHLNFLMRKIRHIKLAKSEDLVEEETINSDGIRFSIADSNGLSSRCYTTLFDSLDDFSINQDNDEFRISGLENTTSLESYSSDSNIDLNAPEHFEQPPQIHISRKKILPSEDSDYQNRSTDTFFTNHLNEPIFLPEDLKGSILSPEIVIKSPRKSTRLHRQPIKTTSYNSTSQPTSPDPLCRKLLKDPPVHYTINTSVASSASQASPIDVLRSYHSSQDRERLQIKLNTEHIFPTNSSNFNTISELIKYLPFYTCVRGTPRLAKVSTCYAQNNTYLPSGSSSSFEIGESALNPFGLTQKFIPVSPLDLDDSIQPENHYSELPNKPQNPNNECESNVSLEYCLPPDEGSNFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLWSNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSDKVSYDLHLGSFEVITKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLIMCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRSLVNSTIERKTSVIKSNENDAHSSSSDISDSQDYPDFYYTLSITQNHSTPIFITLQNETEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFYHSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFNRISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCGGDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVLQVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTAISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPECLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSSSTTKDGKSLPETNVVTKFFFRIQAIKFSKFFDWYQRNPLQSLEILKLICYQIHADVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTISQLVTDYFPRSLIDVPENVSQIKTLMINFLKSRDSGSDNNPVNSYSQYLQYLKELCDAQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLIDILSFGSTSQHFLIALSLLPTKRCFKRIILNLPDNCTALEFVNNLVFYLTAAKSQDKV 1255          
The following BLAST results are available for this feature:
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PLEKHH28.064e-4023.01pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH11.078e-3825.53pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH11.707e-1834.19pleckstrin homology, MyTH4 and FERM domain contain... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
max-11.853e-1920.67Motor AXon guidance [Source:UniProtKB/TrEMBL;Acc:... [more]
max-12.245e-1920.67Motor AXon guidance [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG438674.411e-4321.94gene:FBgn0264449 transcript:FBtr0332605[more]
CG438671.213e-4222.18gene:FBgn0264449 transcript:FBtr0343360[more]
CG438671.444e-4222.18gene:FBgn0264449 transcript:FBtr0332604[more]
CG438671.656e-4222.55gene:FBgn0264449 transcript:FBtr0332610[more]
CG438671.877e-4222.00gene:FBgn0264449 transcript:FBtr0332611[more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhh19.496e-4122.76pleckstrin homology domain containing, family H (w... [more]
plekhh19.536e-4122.76pleckstrin homology domain containing, family H (w... [more]
plekhh28.189e-3323.32pleckstrin homology domain containing, family H (w... [more]
plekhh28.189e-3323.32pleckstrin homology domain containing, family H (w... [more]
plekhh25.383e-3121.59pleckstrin homology domain containing, family H (w... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHH27.847e-4325.76pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH28.971e-4325.76pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH21.221e-4225.69pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH21.571e-4225.69pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH24.278e-4225.72pleckstrin homology, MyTH4 and FERM domain contain... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Plekhh21.934e-3723.48pleckstrin homology domain containing, family H (w... [more]
Plekhh11.451e-3624.01pleckstrin homology domain containing, family H (w... [more]
Plekhh11.451e-3624.01pleckstrin homology domain containing, family H (w... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W5D0|Y34F_DROME3.658e-4122.55Uncharacterized protein CG43867 OS=Drosophila mela... [more]
sp|Q00IB7|PKHH1_DANRE6.153e-4022.76Pleckstrin homology domain-containing family H mem... [more]
sp|Q8IVE3|PKHH2_HUMAN3.872e-3923.01Pleckstrin homology domain-containing family H mem... [more]
sp|Q9ULM0|PKHH1_HUMAN5.176e-3825.53Pleckstrin homology domain-containing family H mem... [more]
sp|Q8C115|PKHH2_MOUSE1.353e-3623.48Pleckstrin homology domain-containing family H mem... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FAV59.144e-6325.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0R3SG863.003e-6025.93Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A183A5I34.560e-5723.34PH domain-containing protein OS=Echinostoma capron... [more]
A0A068WZ635.654e-5725.34Pleckstrin y OS=Echinococcus granulosus OX=6210 GN... [more]
W6UK296.158e-5725.34Uncharacterized protein OS=Echinococcus granulosus... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
plekhh11.082e-4122.24pleckstrin homology domain-containing family H mem... [more]
plekhh11.299e-4122.33pleckstrin homology domain-containing family H mem... [more]
plekhh28.515e-3822.40pleckstrin homology, MyTH4 and FERM domain contain... [more]
plekhh21.273e-3722.40pleckstrin homology, MyTH4 and FERM domain contain... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PLEKHH11.935e-1423.89pleckstrin homology, MyTH4 and FERM domain contain... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO430156.895e-2820.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
plekhh11.362e-4022.24pleckstrin homology, MyTH4 and FERM domain contain... [more]
plekhh29.780e-3322.82pleckstrin homology, MyTH4 and FERM domain contain... [more]
back to top
BLAST of Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000058390.10.000e+099.60SMESG000058390.1[more]
SMESG000058390.10.000e+099.60SMESG000058390.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015422 ID=SMED30015422|Name=Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3984bp
TTGTGCAATTCGATAAATACAAATCAAGGGATGTAGAAGTACGCAATATA
TTATTTTAGATTAATTTTTATATTAAATATGGAGTCGATGGGTTCTAAAT
TTCCAACTGATAATTTGACAGATAGTGATGTTATTAACAAAGATAAAATA
TTAATGGATGATTTTTATAAGCAGAAACTCCAAGAACTCGAAAAGGAAAA
TCAGCAGTTAAAAGTAATGAAAAAATCTTTGCAAAATCATTTAAATTTCT
TAATGCGAAAAATTCGACACATTAAATTAGCAAAATCTGAAGATCTCGTT
GAAGAAGAAACTATCAATTCCGATGGAATTAGATTTAGTATAGCAGATTC
CAATGGACTCAGTTCTCGATGCTATACTACTTTGTTCGATTCTCTTGATG
ATTTTTCTATTAACCAAGACAATGATGAATTTAGAATATCAGGTTTAGAA
AACACGACATCTTTGGAGTCATATAGCAGTGATTCAAATATTGATTTGAA
TGCTCCGGAGCACTTTGAGCAGCCTCCACAAATTCATATTTCACGCAAAA
AGATTTTACCATCTGAAGATTCAGATTATCAAAACAGATCCACTGATACT
TTTTTCACAAACCATCTAAATGAGCCAATATTTCTTCCAGAAGATTTAAA
AGGAAGCATTTTATCTCCTGAAATAGTGATTAAAAGTCCAAGGAAATCAA
CAAGACTTCATCGTCAGCCAATTAAAACGACAAGTTATAATTCAACTTCT
CAACCAACTTCTCCCGATCCTCTTTGTAGGAAATTGTTGAAAGATCCTCC
TGTGCATTACACAATTAATACAAGTGTTGCTTCCAGTGCCAGCCAGGCAT
CACCAATTGATGTCTTACGCTCATATCATTCGTCCCAAGATCGGGAAAGA
CTTCAAATAAAGCTCAATACGGAGCACATATTTCCAACAAATTCATCAAA
TTTTAATACGATATCAGAACTGATCAAATATTTGCCATTCTATACATGCG
TTCGGGGAACTCCAAGATTGGCTAAAGTATCAACCTGCTATGCGCAAAAT
AACACTTACCTACCAAGTGGATCATCTAGTTCATTTGAAATTGGCGAATC
AGCTCTAAATCCTTTTGGATTGACACAAAAGTTTATTCCAGTTTCTCCTT
TAGATCTTGATGATTCTATACAACCGGAAAATCACTATTCCGAATTACCA
AATAAACTTCAAAATCCAAATAACGAGTGTGAATCCAATGTGTCTCTTGA
ATACTGTCTACCACCGGATGAGGGATCCAATTTCAGTAATAACCAATCTG
GATTGCGATCTCCCGAGCAGGCCCAGCCAACCAATCAGGCTGCATTTAGA
GTTCCGCAAAACAATCAGGAGAAACAAATAATTAAACGAGGCATACTAAG
AAAGTTAAATAAAAAATTCAAACTTTGGTCAAATTTTTGGTGTATTCTCA
CTAACAAGGGACTTTTCTTTTACAATCTCAAACACCAACCTCAGCCCGAA
GATTTTTTCTTTATTCAAAAACCAGTGAAAGGAATATCAATAGAGATAAT
GTCTAAAATTGAGTTTATAAAGTCAGACAAAGTAAGCTATGATCTCCACC
TTGGAAGCTTTGAAGTAACTACTAAGAATTTGAAAACCTATACCTTAGCC
ACAGGAAATAAAATTCAATCTCACGAATGGATCCGAGAAATTAAAAAGGT
AATTCTTCAACATCAAGCCCATCTGATCATGTGCGCAAATTCAAACCAAT
TACTACACAATGGATGGATAACGCGAGTGAAATGGGGACACGTGAAAAAG
ATTTGGTGTTGTTTGGCTGGGAAATATTTAATATATTTCAATAATAAAAA
CGATTTTTTTCCAACTGGATACAGGAGCCTAGTGAATTCAACTATTGAAA
GAAAGACATCTGTGATAAAGTCAAATGAAAACGATGCCCACAGCTCTAGT
TCTGACATTAGTGACAGTCAGGATTATCCAGACTTTTATTACACCCTTTC
TATCACTCAAAACCACTCTACTCCGATCTTTATAACTCTCCAAAATGAGG
CAGAGTTCCGAACTTGGCACCATTATTTGAAAGTAAGCATCCAAGCAATA
TCTGCTGATGACATAGATTTGTCTAAGTCTATAGATTTGACGCATTTAGT
TTCACAGGATCATCGAGAACATTTCTATCATTCTACTGGAGACATTATGG
AACCTATTTCCCTGACAACTGGAACGTTTTTGAAAACTGGCGCTATTCAA
TTATGGAAAGCTTTACAAAGACTTGCCAGTGTCGATCATTATAGTATTAA
AAAAGAACATTTAAATGAGAAATTTAACAGAATTTCTTATATTGTTCAAC
TATGTTTTCAGGATTTGGGATTGAAAGATGAAGTTTATCTTCAATTGATG
AAACAATCTCAAAGTTCTGTGGAAAGGGATTTAAGAATGCATCAAACCAA
GAAAATCAAATTTTCCTTGTTTTGCGGAGGAGACAATTTAGTAAGTAGTA
GCAGCAGCATTCATGAAGGATACCCCAAGACAATAGCAGCATCAACAGTG
GAAACTAATGAAATTCTAGCTATGTGGGAATGTATTGCAATCTTGATTCC
GATATTTCTCCCTTCTCCAAGTGTGTTGCAAGTGTTGAAAAAGTATTTAA
TTATTTCAAGAGATAATAATTCATGCAAGGAAATTTCCAATTACTCATCT
TATTGTTATGAACAGCTTCAGCAAGTTCAAAATATGGTTGGTCGTTCAAG
ACCTCCAAGTCAATTTGAAGTTACAGCCATATCGATGAGAAACCCCTATA
CACATTCTTTGCCATTCAGTCTACCAGTTTACGTGCAATCGGGAAGTTAT
CATGTCATCAGCTTTTCTCCTCTCAGCTCAATTCAAATGATGCACGACTC
CATGCTTCAAGCTCTTTTCCCCCCAGAATGTCTACTTAACCTCAAAGAGG
TCTGTTTGTTTGCGATCTATCTCTACCTTAATTCCGATCAGAACAAGTAT
ATTTACTTAAACTCATCTCTGAAAATCTGTGATGTGATCTCGAAATTTGA
AGAGCAAATCAAACAAAATAAATCCAGTTCAACAACAAAAGACGGAAAAA
GTCTACCTGAAACAAATGTTGTCACAAAGTTCTTCTTCCGGATTCAGGCC
ATTAGATTTTCAAAGTTTTTTGATTGGTATCAGAGAAATCCTTTACAGAG
TCTGGAAATTCTGAAATTGATATGCTATCAGATCCATTCTGACGTAAAGT
CCGGTAATTACAGTCTATCAGGCGCTCAAATTTTTAATCTAATCTCCTAT
TTATTTGATGCCTATCAGGCGGAATGCGCGGAATTCTGGCACACAGATAG
AACTATAAGCCAGTTAGTTACAGATTATTTCCCACGCAGTCTCATTGATG
TCCCAGAAAATGTCAGCCAAATAAAAACCCTCATGATCAATTTCCTGAAG
AGTCGTGACTCGGGATCCGATAACAATCCTGTCAATAGTTATTCACAATA
CCTACAGTATTTGAAAGAATTGTGTGATGCCCAATGCAGTCCTACAATCA
TACCATGTGTAGCTAGTTCCAATAGTGATTATCTAGCTGGCCAACAAATG
GTTATCATTTGTCAAGAGTCTTTTTTATCATTTCTCGATTTTAAATGTAG
AATATGTTTAAAAAAAATTCCTTTGATTGATATTCTTTCGTTCGGGAGCA
CATCTCAGCATTTTTTAATTGCACTATCTCTCCTACCGACCAAAAGATGC
TTCAAACGAATTATTCTCAATCTTCCAGACAATTGCACAGCTCTGGAGTT
TGTTAATAATTTAGTATTTTATTTGACTGCAGCGAAATCTCAGGATAAAG
TTTAAAAAGCACAGAGAAACTTCAAGAAATGCGGTTTGCATTCGTCTTTG
AATTATTTACTTTTACTTTATTTTGATTATTTTGTTTATTTAATGGATAT
TTATTTTATATATTACTAATATGTTTGTAAATAG
back to top

protein sequence of SMED30015422-orf-1

>SMED30015422-orf-1 ID=SMED30015422-orf-1|Name=SMED30015422-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1259bp
MESMGSKFPTDNLTDSDVINKDKILMDDFYKQKLQELEKENQQLKVMKKS
LQNHLNFLMRKIRHIKLAKSEDLVEEETINSDGIRFSIADSNGLSSRCYT
TLFDSLDDFSINQDNDEFRISGLENTTSLESYSSDSNIDLNAPEHFEQPP
QIHISRKKILPSEDSDYQNRSTDTFFTNHLNEPIFLPEDLKGSILSPEIV
IKSPRKSTRLHRQPIKTTSYNSTSQPTSPDPLCRKLLKDPPVHYTINTSV
ASSASQASPIDVLRSYHSSQDRERLQIKLNTEHIFPTNSSNFNTISELIK
YLPFYTCVRGTPRLAKVSTCYAQNNTYLPSGSSSSFEIGESALNPFGLTQ
KFIPVSPLDLDDSIQPENHYSELPNKLQNPNNECESNVSLEYCLPPDEGS
NFSNNQSGLRSPEQAQPTNQAAFRVPQNNQEKQIIKRGILRKLNKKFKLW
SNFWCILTNKGLFFYNLKHQPQPEDFFFIQKPVKGISIEIMSKIEFIKSD
KVSYDLHLGSFEVTTKNLKTYTLATGNKIQSHEWIREIKKVILQHQAHLI
MCANSNQLLHNGWITRVKWGHVKKIWCCLAGKYLIYFNNKNDFFPTGYRS
LVNSTIERKTSVIKSNENDAHSSSSDISDSQDYPDFYYTLSITQNHSTPI
FITLQNEAEFRTWHHYLKVSIQAISADDIDLSKSIDLTHLVSQDHREHFY
HSTGDIMEPISLTTGTFLKTGAIQLWKALQRLASVDHYSIKKEHLNEKFN
RISYIVQLCFQDLGLKDEVYLQLMKQSQSSVERDLRMHQTKKIKFSLFCG
GDNLVSSSSSIHEGYPKTIAASTVETNEILAMWECIAILIPIFLPSPSVL
QVLKKYLIISRDNNSCKEISNYSSYCYEQLQQVQNMVGRSRPPSQFEVTA
ISMRNPYTHSLPFSLPVYVQSGSYHVISFSPLSSIQMMHDSMLQALFPPE
CLLNLKEVCLFAIYLYLNSDQNKYIYLNSSLKICDVISKFEEQIKQNKSS
STTKDGKSLPETNVVTKFFFRIQAIRFSKFFDWYQRNPLQSLEILKLICY
QIHSDVKSGNYSLSGAQIFNLISYLFDAYQAECAEFWHTDRTISQLVTDY
FPRSLIDVPENVSQIKTLMINFLKSRDSGSDNNPVNSYSQYLQYLKELCD
AQCSPTIIPCVASSNSDYLAGQQMVIICQESFLSFLDFKCRICLKKIPLI
DILSFGSTSQHFLIALSLLPTKRCFKRIILNLPDNCTALEFVNNLVFYLT
AAKSQDKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR038185MyTH4_dom_sf
IPR019748FERM_central
IPR001849PH_domain
IPR000857MyTH4_dom
IPR011993PH-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 27..61
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 205..230
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 213..230
NoneNo IPR availablePANTHERPTHR22903PLEKHH PROTEINcoord: 17..1214
NoneNo IPR availablePANTHERPTHR22903:SF8MAX-1Acoord: 17..1214
NoneNo IPR availableCDDcd17094FERM_F1_Max1_likecoord: 912..1000
e-value: 2.54618E-8
score: 51.0858
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 365..543
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 556..675
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 558..674
e-value: 1.2E-4
score: 31.4
coord: 434..545
e-value: 2.6E-8
score: 43.6
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 561..669
e-value: 2.9E-6
score: 27.7
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 557..672
score: 7.399
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 433..543
score: 10.578
IPR000857MyTH4 domainPFAMPF00784MyTH4coord: 752..901
e-value: 2.4E-15
score: 56.9
IPR000857MyTH4 domainPROSITEPS51016MYTH4coord: 701..902
score: 14.471
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 422..549
e-value: 1.7E-13
score: 52.4
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 550..678
e-value: 3.9E-6
score: 28.6
IPR038185MyTH4 domain superfamilyGENE3DG3DSA:1.25.40.530coord: 688..794
e-value: 1.4E-5
score: 27.0
coord: 818..905
e-value: 2.4E-8
score: 36.0
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 1047..1148
e-value: 0.00667244
score: 35.2999