G_PROTEIN_RECEP_F2_4 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F2_4 domain-containing protein
Smed IDSMED30015414
Length (bp)2076
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F2_4 domain-containing protein (SMED30015414) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F2_4 domain-containing protein (SMED30015414) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F2_4 domain-containing protein (SMED30015414) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F2_4 domain-containing protein (SMED30015414) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015414

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30015414SMESG000070072.1 SmedASXL_070308SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30015414SMESG000014523.1 SmedASXL_017632SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30015414SMESG000014578.1 SMESG000014566.1 SMESG000014563.1 SMESG000014554.1 SMESG000014544.1 SMESG000014542.1 SmedASXL_017630SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30015414SMESG000033615.1 dd_Smed_v4_10981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015414SMESG000033615.1 dd_Smed_v4_10981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015414SMESG000033615.1 dd_Smed_v4_10981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015414SMESG000033615.1 dd_Smed_v4_10981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015414SMESG000033615.1 dd_Smed_v4_10981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015414SMESG000033615.1 dd_Smed_v4_10981_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015414SMESG000070072.1 dd_Smed_v4_1789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015414SMESG000070072.1 dd_Smed_v4_1789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015414SMESG000070072.1 dd_Smed_v4_1789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015414SMESG000070072.1 dd_Smed_v4_1789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015414SMESG000070072.1 Contig47911newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015414SMESG000070072.1 Contig47911uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015414SMESG000033615.1 Contig31763newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015414SMESG000033615.1 Contig31763uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30015414SMESG000070072.1 dd_Smed_v6_1789_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015414SMESG000070072.1 dd_Smed_v6_1789_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mthl10 (gene:FBgn0035132 transcript:FBtr0072572)

HSP 1 Score: 74.7146 bits (182), Expect = 1.432e-13
Identity = 57/248 (22.98%), Postives = 112/248 (45.16%), Query Frame = 2
Query: 1190 SASCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWF-TSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKE-CRIVKKKDANSTL-------WLCMRLTAVFGVGYVLQIFAIFTQLEI----LISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQN 1888
              +CK      +F  +  ++W++V + DL   F GT+ +N  +++  K F  Y L  + I+   +  +   +      + L+P  G G YCW   S +  +IY++ P+  +++ N IM      ++    +E  RI+  +++   L        L +RL  + G+ ++ ++ + F   +     L  +  + N +QGF++ + FV  K+ + L+ NR + +       S    PT  S K    D  N
Sbjct:  307 GVTCKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIALVFLAFTYCAQQLTNLPANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHLITNRTIRVRSLRQTESVTMGPTSFSMKQRFMDASN 552          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mthl10 (gene:FBgn0035132 transcript:FBtr0306566)

HSP 1 Score: 69.707 bits (169), Expect = 4.330e-12
Identity = 55/248 (22.18%), Postives = 116/248 (46.77%), Query Frame = 2
Query: 1190 SASCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWF-TSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKE-CRIVKKKDANSTL-------WLCMRLTAVFGVGYVLQIFAIFTQLE----ILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQN 1888
              +CK      +F  +  ++W++V + DL   F GT+ +N  +++  K F  Y L  + I+   +  +   +      + L+P  G G YCW   S +  +IY++ P+  +++ N IM      ++    +E  RI+  +++   L        L +RL  + G+ ++ ++ + F   +     L  +  + N +QGF++ + FV  K+ + L+ NR  ++     +  +  + +Q S K+ S+   N
Sbjct:  307 GVTCKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIALVFLAFTYCAQQLTNLPANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHLITNRCSSV-----RDGSNQRQSQYSTKTTSSSVAN 547          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mthl10 (gene:FBgn0035132 transcript:FBtr0333904)

HSP 1 Score: 69.707 bits (169), Expect = 4.330e-12
Identity = 55/248 (22.18%), Postives = 116/248 (46.77%), Query Frame = 2
Query: 1190 SASCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWF-TSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKE-CRIVKKKDANSTL-------WLCMRLTAVFGVGYVLQIFAIFTQLE----ILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQN 1888
              +CK      +F  +  ++W++V + DL   F GT+ +N  +++  K F  Y L  + I+   +  +   +      + L+P  G G YCW   S +  +IY++ P+  +++ N IM      ++    +E  RI+  +++   L        L +RL  + G+ ++ ++ + F   +     L  +  + N +QGF++ + FV  K+ + L+ NR  ++     +  +  + +Q S K+ S+   N
Sbjct:  307 GVTCKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIALVFLAFTYCAQQLTNLPANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHLITNRCSSV-----RDGSNQRQSQYSTKTTSSSVAN 547          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mthl10 (gene:FBgn0035132 transcript:FBtr0333903)

HSP 1 Score: 69.707 bits (169), Expect = 4.330e-12
Identity = 55/248 (22.18%), Postives = 116/248 (46.77%), Query Frame = 2
Query: 1190 SASCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWF-TSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKE-CRIVKKKDANSTL-------WLCMRLTAVFGVGYVLQIFAIFTQLE----ILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQN 1888
              +CK      +F  +  ++W++V + DL   F GT+ +N  +++  K F  Y L  + I+   +  +   +      + L+P  G G YCW   S +  +IY++ P+  +++ N IM      ++    +E  RI+  +++   L        L +RL  + G+ ++ ++ + F   +     L  +  + N +QGF++ + FV  K+ + L+ NR  ++     +  +  + +Q S K+ S+   N
Sbjct:  307 GVTCKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIALVFLAFTYCAQQLTNLPANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHLITNRCSSV-----RDGSNQRQSQYSTKTTSSSVAN 547          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Match: mthl10 (gene:FBgn0035132 transcript:FBtr0306565)

HSP 1 Score: 69.3218 bits (168), Expect = 6.046e-12
Identity = 60/255 (23.53%), Postives = 119/255 (46.67%), Query Frame = 2
Query: 1190 SASCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWF-TSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKE-CRIVKKKDANSTL-------WLCMRLTAVFGVGYVLQIFAIFTQLEI----LISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSS------TANKPTQKSDKSHSNDQQNA 1891
              +CK      +F  +  ++W++V + DL   F GT+ +N  +++  K F  Y L  + I+   +  +   +      + L+P  G G YCW   S +  +IY++ P+  +++ N IM      ++    +E  RI+  +++   L        L +RL  + G+ ++ ++ + F   +     L  +  + N +QGF++ + FV  K+ + L+ NRLL+I      ++      T +KP   +D  HS +   A
Sbjct:  307 GVTCKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIALVFLAFTYCAQQLTNLPANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHLITNRLLSILLKSKLNTNRHCLQTNSKP--NTDSQHSTESPAA 557          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Match: galnt4 (polypeptide N-acetylgalactosaminyltransferase 4 [Source:Xenbase;Acc:XB-GENE-5803663])

HSP 1 Score: 53.1434 bits (126), Expect = 1.861e-6
Identity = 61/249 (24.50%), Postives = 106/249 (42.57%), Query Frame = 2
Query: 1118 ICLSICLWLINF-MSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALD-LLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGP-YCWFTSKFGGLIYYFI-PVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILIS-LGSMVNCLQGFMLTLCFVCTKR-ARSLLRNRLLTITESISKSSTANKP 1846
            I ++ CL +I+  + +LV  TQI     C     F HF  L++F W+   A    +   G       +KR L      CL     +  V      T+            YG P YCW + + GGL+Y F+ P   ++L N ++   VF +L           K  A ++LW    +  +  + ++  + A+  +  IL   L ++ + LQGF++ +     +R  +   R RL    + I+  S+++ P
Sbjct:  922 ILINFCLSIISSNILILVGQTQIHNKGICTMTTAFLHFFFLASFCWVLTEAWQSYMAVTGKIRTRVIRKRFL------CLGWGLPALVVAISMGFTKA---------KGYGTPHYCWLSLE-GGLLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQGFVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFP 1154          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Match: galnt4 (polypeptide N-acetylgalactosaminyltransferase 4 [Source:Xenbase;Acc:XB-GENE-5803663])

HSP 1 Score: 53.1434 bits (126), Expect = 1.984e-6
Identity = 61/249 (24.50%), Postives = 106/249 (42.57%), Query Frame = 2
Query: 1118 ICLSICLWLINF-MSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALD-LLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGP-YCWFTSKFGGLIYYFI-PVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILIS-LGSMVNCLQGFMLTLCFVCTKR-ARSLLRNRLLTITESISKSSTANKP 1846
            I ++ CL +I+  + +LV  TQI     C     F HF  L++F W+   A    +   G       +KR L      CL     +  V      T+            YG P YCW + + GGL+Y F+ P   ++L N ++   VF +L           K  A ++LW    +  +  + ++  + A+  +  IL   L ++ + LQGF++ +     +R  +   R RL    + I+  S+++ P
Sbjct:  885 ILINFCLSIISSNILILVGQTQIHNKGICTMTTAFLHFFFLASFCWVLTEAWQSYMAVTGKIRTRVIRKRFL------CLGWGLPALVVAISMGFTKA---------KGYGTPHYCWLSLE-GGLLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQGFVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFP 1117          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Mouse
Match: Adgre1 (adhesion G protein-coupled receptor E1 [Source:MGI Symbol;Acc:MGI:106912])

HSP 1 Score: 53.5286 bits (127), Expect = 8.581e-7
Identity = 58/258 (22.48%), Postives = 115/258 (44.57%), Query Frame = 2
Query: 1085 QVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDL-LQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPY--CWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFK--TAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQG-FMLTLCFVCTKRARSLLRNRLLTITESISKSSTAN 1840
            +  +N   Y+ + L +CL+L   + L   +    ++A C  +A F H++ L+ F WM V A+ L L     K+VN    R +K   +           V+            +++++P+  G +  CW  ++ G +  +  PVC+++  N ++ ++  + L +   +    + K KD     +  +    + G  +VL IF I     I+  L +++N LQG F+  +  +  ++ R   +  L   T+  S S T+ 
Sbjct:  673 RAVQNHNTYMHLHLCVCLFLAKILFLTGIDKTDNQTA-CAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPVLVVII-----------SASVQPRGYGMHNRCWLNTETGFIWSFLGPVCMIITINSVLLAWTLWVLRQKLCSVSSEVSKLKDTRLLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTIINSLQGAFIFLIHCLLNRQVRDEYKKLLTRKTDLSSHSQTSG 918          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Mouse
Match: Adgre1 (adhesion G protein-coupled receptor E1 [Source:MGI Symbol;Acc:MGI:106912])

HSP 1 Score: 53.5286 bits (127), Expect = 8.581e-7
Identity = 58/258 (22.48%), Postives = 115/258 (44.57%), Query Frame = 2
Query: 1085 QVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDL-LQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPY--CWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFK--TAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQG-FMLTLCFVCTKRARSLLRNRLLTITESISKSSTAN 1840
            +  +N   Y+ + L +CL+L   + L   +    ++A C  +A F H++ L+ F WM V A+ L L     K+VN    R +K   +           V+            +++++P+  G +  CW  ++ G +  +  PVC+++  N ++ ++  + L +   +    + K KD     +  +    + G  +VL IF I     I+  L +++N LQG F+  +  +  ++ R   +  L   T+  S S T+ 
Sbjct:  673 RAVQNHNTYMHLHLCVCLFLAKILFLTGIDKTDNQTA-CAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPVLVVII-----------SASVQPRGYGMHNRCWLNTETGFIWSFLGPVCMIITINSVLLAWTLWVLRQKLCSVSSEVSKLKDTRLLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTIINSLQGAFIFLIHCLLNRQVRDEYKKLLTRKTDLSSHSQTSG 918          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95NT6|MTH2_DROYA (G-protein coupled receptor Mth2 OS=Drosophila yakuba OX=7245 GN=mth2 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.579e-11
Identity = 56/246 (22.76%), Postives = 118/246 (47.97%), Query Frame = 2
Query: 1196 SCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWF-TSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKE-CRIVKKKDANSTL-------WLCMRLTAVFGVGYVLQIFAIFTQLE----ILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQN 1888
            +CK      +F  +  ++W++V + DL   F GT+ +N  +++  K F  Y L  + I+   +  + I +      + L+P  G G YCW   S +  +IY++ P+ ++++ N IM      ++    +E  RI+  +++   L        L +RL  + G+ ++ ++ + F   +     L  +  + N +QGF++ + FV  K+ + L+ NR  ++     +  +  + +Q S K+ S+   N
Sbjct:  270 ACKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIAVVFLAFTYIAQELTNLPAYLKPGIGDGVYCWLDMSNWAAMIYFYGPILVIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHLITNRCSSV-----RDGSNQRQSQYSTKTTSSSVAN 508          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95NQ0|MTH2_DROSI (G-protein coupled receptor Mth2 OS=Drosophila simulans OX=7240 GN=mth2 PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.114e-11
Identity = 63/283 (22.26%), Postives = 129/283 (45.58%), Query Frame = 2
Query: 1091 FKNFGGYLTICLSICLWLINFMSLLVTNTQIVES--ASCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWF-TSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKE-CRIVKKKDANSTL-------WLCMRLTAVFGVGYVLQIFAIFTQLE----ILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQN 1888
             +N  G   +C  I L  + + SL       V++   +CK      +F  +  ++W++V + DL   F GT+ +N  +++  K F  Y L  + I+   +  +   +        L+P  G G YCW   S +  +IY++ P+  +++ N IM      ++    +E  RI+  +++   L        L +RL  + G+ ++ ++ + F   +     L  +  + N +QGF++ + FV  K+ + L+ NR  ++     +  +  + +Q S K+ S+   N
Sbjct:  234 LRNQHGKSLVCYLIGL-TVGYSSLCYVQLYQVDATGVTCKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIALVFLAFTYCAQQLSNLPDNLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHLITNRCSSV-----RDGSNQRQSQYSTKTTSSSVAN 508          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9W0R5|MTH10_DROME (Probable G-protein coupled receptor Mth-like 10 OS=Drosophila melanogaster OX=7227 GN=mthl10 PE=3 SV=3)

HSP 1 Score: 66.6254 bits (161), Expect = 4.051e-10
Identity = 56/258 (21.71%), Postives = 117/258 (45.35%), Query Frame = 2
Query: 1190 SASCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWF-TSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKE-CRIVKKKDANSTL-----------W------LCMRLTAVFGVGYVLQIFAIFTQLE----ILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQN 1888
              +CK      +F  +  ++W++V + DL   F GT+ +N  +++  K F  Y L  + I+   +  +   +      + L+P  G G YCW   S +  +IY++ P+  +++ N IM      ++    +E  RI+  +++   L           W      L +RL  + G+ ++ ++ + F   +     L  +  + N +QGF++ + FV  K+ + L+ NR  ++     +  +  + +Q S K+ S+   N
Sbjct:  307 GVTCKVFGYTAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEK--KRFLFYSLYSWGIALVFLAFTYCAQQLTNLPANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKRFYRAWSNYRFGLFLRLFLIMGITWLTELISYFVGSDKGWSKLFYISDLANAMQGFLIFMLFVMKKKVKHLITNRCSSV-----RDGSNQRQSQYSTKTTSSSVAN 557          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P83118|MTH11_DROME (Probable G-protein coupled receptor Mth-like 11 OS=Drosophila melanogaster OX=7227 GN=mthl11 PE=3 SV=3)

HSP 1 Score: 60.4622 bits (145), Expect = 3.241e-8
Identity = 61/261 (23.37%), Postives = 122/261 (46.74%), Query Frame = 2
Query: 1118 ICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTN--STLRPQYGGPYCW-FTSKFGGLIYYFIPVCLLLLWN----FIMCSFVFYQLFKTAK-----ECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLE----ILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQ 1852
            ICL+I  +L+N +SL       +++  C       +F  ++TF+W++V + D+ + F  +      K    SF  Y +I +S +G +  I  + + F +TN  +   P  G   CW FT+ +    Y++ P+ +L++ N    F+   +++ +  +  K     E + + +  AN  ++   RL  + G  + L+I A   ++E     LI L   +NC QG ++ +   C      L+R R+     +  + +  ++P +
Sbjct:  266 ICLAIT-FLLNVISLF--GIFELKTPICYLTGYAGYFTVMATFLWLSVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIVWSSAGLLTCIIFLVDQFVETNLDNPYNPAVGVFSCWIFTNGWSATFYFYAPLAILIILNCASFFLTTRYIYVENKQNQKVLNNSEPQKLSRNHANYRIYF--RLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVATFCNHEMFRLIRKRIQNRNITSLELTNTSRPVE 521          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9W0R6|MTH9_DROME (Probable G-protein coupled receptor Mth-like 9 OS=Drosophila melanogaster OX=7227 GN=mthl9 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.752e-6
Identity = 36/144 (25.00%), Postives = 75/144 (52.08%), Query Frame = 2
Query: 1160 LLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSK-FGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIV 1588
            L + N   +   +C+ +    +F  + +FV++A+ +LD L  F  K V ++ +R   + +V  +IG     S+   S + ++F       +P  G  YCWF  + +G LIYY+ P+ LLL+++ + C   ++ +++   + + +
Sbjct:  261 LALKNPMKLSHVACRNIGFLAYFCIMLSFVFLAICSLDFLLKFKQKAVRSSVRRLSLALAVLAVIGLRFLVSLAQDSKLPKHF-------KPGMGEDYCWFDVRTWGILIYYYGPIALLLIFSIVCCLKAYFSIYELPPDTQYI 397          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: A0A087UWI6 (Putative G-protein coupled receptor Mth-like 3 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_01041 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.493e-17
Identity = 65/222 (29.28%), Postives = 117/222 (52.70%), Query Frame = 2
Query: 1199 CKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLL--RNRLLTITESISKSSTANKPTQKS 1858
            C   A+F +F  LS F WM+V A D+ +TF    +  ++ R  K+F  Y L  +  S S++ IS+  +   K N+  RP+YG P CWF  + G L+++ +PV  LL+ N I+ +   + + + +++ R V      +  +L M+LT + G+ + L IFA  T+++ +     ++N LQG  + + F   K   ++L  + ++ ++T  + K S   K    S
Sbjct:  147 CYLNAVFTYFGYLSAFHWMSVMAFDIHKTFS---MTQSRNRNSKTFIKYSLCSWISSASILLISITVDNVLKENNEFRPRYGQPICWFNHRKGLLVFFVVPVTTLLMANVILFAVTAFYVRRISRQARSVSNFTDKTRYFLYMKLTTILGLTWFLGIFAAITRIDAVWYAFIILNGLQGAFIFIAFTLKKSILNMLVIKLKIRSVTYRMGKPSGLKKAMYSS 365          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: R7URK6 (G_PROTEIN_RECEP_F2_4 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_63867 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.443e-17
Identity = 58/200 (29.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query: 1199 CKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECR-IVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNR 1795
            C  +A   HF  L++F WM V A D+ +TF       +     K +  Y L G+ +   +   ++   +    ++  RP YG   CW  S+ G  I++  PV  +L++N +  +     ++K  K  R + K K     LWL ++LT + G+ ++    A    LE+L  L  +VN LQG  + + FVCT+    LLR +
Sbjct:   69 CATMAAVTHFAFLASFSWMHVMAFDIWKTFAKSSQPNSLDNSTKKYFRYSLYGWGVPLLITTTAITVNFSVAEDAAYRPAYGEMICWIRSRIGLAIFFATPVAAVLVFNIVFYTLTVVSIYKITKMARGVTKPKSDQRQLWLYVKLTCIMGLTWIFGFVAAAFDLEVLWYLFIVVNSLQGAFICVAFVCTRNVVKLLREK 268          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: V4B5X4 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_108512 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.587e-17
Identity = 74/261 (28.35%), Postives = 123/261 (47.13%), Query Frame = 2
Query: 1094 KNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRG--LKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAK-ECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSS-TANKPTQKSDK 1864
            +N  G + I L I L ++ ++++L+        A CK  AI  H+  L  F WM V A+D+  TF       + +R    + + +Y  I  SI   +  I   TE  D       P YG   CWFT +   L+++ +P  L+L+ N I+       ++   K   R++ K+D  S L + +RLT V GV Y+            ++ +  ++N LQG  + + FVCT++   L+R R    ++S S  S + ++ T KS  
Sbjct:  116 RNIPGKIVISLCISL-ILAYLTMLIGPAMRENFAGCKSFAIMMHYFFLVAFFWMNVMAIDVWYTFAYHQAGGSSERSTRFRFYVLYVFIMASIPVILSTILNETEIADD----FSPHYGEGICWFTRRNALLVFFGLPSLLVLIANVILFLIAANTIYSAQKNSVRLLGKED-KSMLSIYVRLTIVMGVAYLFGFLVPLYNHPAILYIFIILNTLQGLFIFVSFVCTRKVLGLIRERANNWSQSRSDGSYSGSRSTTKSSA 370          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: A0A0L8FHQ6 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22019923mg PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.036e-16
Identity = 65/256 (25.39%), Postives = 126/256 (49.22%), Query Frame = 2
Query: 1094 KNFGGYLTICLSICLWLINFMSLLVTNT-QIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKS 1858
            +N  G + + L   L+L N + LL     ++     C+  AI  H+  L +F WM + A D  QTF  K + +   R  +SF  Y +  +    ++V  + +T+Y  +++S   P YG   CWF  +   LI++ +P+ ++L+ N I  +F F  ++   K  +    K   +T  +  +L  + G+ +++ I   FTQ+E+L  +  +    QGF +   ++ +++     +N++   T +I+ S ++ K T  S
Sbjct:  151 RNLPGKMAMNLMASLFLANLVFLLANIIKELPGHFLCRTFAIIAHYTYLVSFCWMNIMAFDSWQTFSRKQILSITDRSNRSFKFYMVYAWLSPVTIVAGAGVTQYL-QSDSVFSPAYGDSLCWFNKRLALLIFFGLPLIIILIMNTIFFTFTFRAIYLANKFTKRCLSKSDKNTFIVFFKLYFILGINWLVSILYTFTQIELLRYISVLFTSFQGFFVGCSYLFSRKVYRQFQNKVSFFT-TINSSESSCKHTAIS 404          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Match: A0A3M6T4U7 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00005188 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.162e-16
Identity = 76/241 (31.54%), Postives = 120/241 (49.79%), Query Frame = 2
Query: 1091 FKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRG--LKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGG-PYCWFTSKFGGLIYYFIPVCLLLLWNFIMCS---FVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNR 1795
             KN  G   I LS  L L     L    +  V+   CK +AI  HF  LSTF WM++ A D   TF  K+    ++     K F  YC++G+ +   +VG+  + ++      T    YG   YCW +          IPV   L++N +  +   +V + L + A    +  + +A+ TL +C++LT V G+ ++L++ A + Q   L    +++N LQGF +TLCFV TK+ R L+R R
Sbjct: 1152 LKNLPGRCVISLSAALLLYQITFLSAKKSTEVD-VLCKAVAILLHFFILSTFAWMSIMAFDAANTFSIKVTVRRRQPSDTRKIFIKYCIVGWGLPAVIVGLCSVLDH----TGTFHIGYGNLVYCWISDSKALTFAMVIPVSATLVFNIVCFTKNIYVIHHL-QMAANMAVSNRSNASLTL-ICVKLTTVMGLTWILELAANWKQTNFLRYPSTVLNSLQGFFITLCFVTTKKVRGLVRER 1385          

HSP 2 Score: 79.7221 bits (195), Expect = 2.029e-11
Identity = 64/231 (27.71%), Postives = 110/231 (47.62%), Query Frame = 2
Query: 1199 CKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRG--LKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGG-PYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWL-CMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSND 1879
            C+ +AI  HF ALS F WMAV A D   TF   + + +++     K F  YC++G+ +   +VG  ++ +       T    YG   +CW +      +    PV   L++N I  +   Y +    +   +     + ++L L C++LT V G+ ++LQ+ A +   E L    +++N +QG  +T CFV TK+ R L + R        ++ S + +P   S  S  +D
Sbjct:  508 CQAVAILIHFFALSAFSWMAVMAFDTASTFTPTVADTSRQPSDTRKIFIKYCILGWGLPAVIVGFCIVLDL----TGTFHVGYGNFLFCWISDNTALTVVMVTPVSAALIFNVICFAKSVYAIRHLQQAAALAASNSSKASLILICIKLTTVMGLTWILQLAAKWRHTEFLQYPSAVLNSMQGLFITSCFVTTKKVRGLFKERF------SNRRSRSVEPQTNSAHSSEDD 728          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO34420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE2])

HSP 1 Score: 86.6557 bits (213), Expect = 1.088e-17
Identity = 70/265 (26.42%), Postives = 124/265 (46.79%), Query Frame = 2
Query: 1091 FKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRG--LKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYG-GPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANST--------LWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQ 1852
             +N  G + + L+I + L + +  LV  +     A C  +A+  HF  LS F WM V A D+  TF          RG    ++++Y    + I  ++V IS   +     + + R  YG G YC+  +    L  + +PV ++LL+NFI        LF T    R V+KK + ++          +C ++T+  G+ +VL  FA       L     ++N LQGF++ L +V  +R  S+ R  L ++ ++ ++ + +  P +
Sbjct:  439 LRNLPGRVVLSLAITMLLYHLLYFLVNQSDT--RALCVAVAVSLHFALLSAFCWMNVLAFDVHHTFTKPGQRRTASRGHCPGTYAIYAAYSWGIPLAIVTISFSVDL----SGSWRIGYGRGEYCFIENPSAMLYLFLLPVAIILLYNFI-------ALFHTMWHIRAVRKKTSKASNQQRKPNLPIICFKMTSAMGITWVLAYFASTQATSFLWYAFVILNSLQGFLILLSYVLNRRVLSMYRETLQSMRKTSTQGTRSTTPGR 690          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO37470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFI6])

HSP 1 Score: 73.1738 bits (178), Expect = 2.029e-13
Identity = 64/228 (28.07%), Postives = 103/228 (45.18%), Query Frame = 2
Query: 1091 FKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTF-GTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWL---CMRLTAVFGVGYVLQIFA-IFTQLEILISLGSMVNCLQGFMLTLCFV 1759
             +N  G + + LS+ L   + +  +V  +     A CK +AI  H+  L  F WMAV A D+ +TF G        +R +  +S  CL     +  V  I V     D T         G +C+ TS+FG +  + +PV L+L WN +  +   + +    K  R ++    N    L   CM+LT+V G+ +   + A +F     L  + +  N LQGF + L F+
Sbjct:  713 LRNLPGKIQMNLSVALLAFHVLFFMVAMS--TSGALCKAIAIGIHYFLLVGFAWMAVMAYDVHRTFTGQTEAILQPQRSMLVYS--CLSWLLPAAFVGAIVV----IDLTVPGAIDYGKGEFCYITSRFGLIFAFLVPVSLVLSWNILSLARTLFYIRLARKAARGLRTSSGNQNNILPIMCMKLTSVLGLPWTFGVLASLFPSCLALWIVYTAFNSLQGFFMLLSFL 932          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO36509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH3])

HSP 1 Score: 72.7886 bits (177), Expect = 3.305e-13
Identity = 56/247 (22.67%), Postives = 103/247 (41.70%), Query Frame = 2
Query: 1115 TICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDAN-STLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQ 1852
             I LS   WL         + Q+ +  +C  +AI  H+  L++F+W A+ A D  + F  +   + K    ++               +    IT   D + +          CW T+    L+ + +PV ++L++N I  +     +  TAK+ R         +  W+ +R+ A+ G  +V    A    +  L  +  ++NCLQG  + L F  T+RAR+L +  ++T    +    +    TQ
Sbjct:  796 AILLSQIFWLSG-------SGQVHDRTACTVVAILLHYFFLASFIWTAIIAWDTWRAFSHRSHRSAKTMKRENLIGTLRCMAVGWLPALLFVAITTAIDLSGAVAIGYGSDVACWITNGTPLLVVFGLPVVVILVFNSIFYALTIIAIRATAKQARFASSDSRQKAHFWIYLRIAAIMGFTWVFGFIAA-VGITALWYVFVILNCLQGVYIALAFALTERARNLYKAVVITWRMKLRDDKSVKTSTQ 1034          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO39172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS2])

HSP 1 Score: 60.4622 bits (145), Expect = 3.531e-10
Identity = 49/212 (23.11%), Postives = 93/212 (43.87%), Query Frame = 2
Query: 1154 MSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFS-VYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPY-CWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSL 1783
            M  L  + Q  + ++C+ +AI  H+  LS+F WM+V A D  + F  K    N     K    V  L      G V+    + +     + T+   YGG   CW  +K+  + ++ +PV  LL+WN +        + K  K+  + + +   + L +  ++ ++ G  ++    A FT   ++     + N LQG  + + F+   + + L
Sbjct:   12 MLWLAGSGQTEDHSACQIIAIALHYSFLSSFTWMSVIAFDTWRAFSRKTRRHNNVINWKRVGRVIALGWLPPLGFVILCVALDQ-----SGTVTIDYGGAKGCWINNKWSNIFFFAVPVLGLLIWNIVFFVLTVVAIRKVMKQSSMAQDESNRNDLVIYAKIASLMGFTWLFGFLAPFTTYFLMFPF-VICNSLQGVFIAVAFLMNGKVKKL 217          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO31226 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYI9])

HSP 1 Score: 56.6102 bits (135), Expect = 4.992e-9
Identity = 57/219 (26.03%), Postives = 97/219 (44.29%), Query Frame = 2
Query: 1163 LVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTF---GTKLVNANK----KRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPY-CWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKK--------DANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKR 1771
            LV + Q    A C ++AI  HF  L++F WM++ A D  + F   G   + ++K    +R +K  ++  L  F +   +          D++ +    +YGG   CW  +    L  + IPV L L+WN      VF+ L  T K  R+ K++        D    + +  ++ ++ G  +V  I A F   E L+    +    QG  + + FV T+R
Sbjct:   16 LVGSGQTGSKAGCVFIAIVLHFAFLASFSWMSIIAFDTWRAFSFSGQSAMRSDKAKQRQRIMKRLAIGYLSVFVLVIILTA-------LDQSGA-FAIRYGGSKGCWINNGDANLYIFVIPVSLALVWN-----AVFFVL--TVKAIRVAKQQSRAAVNEGDQKRDIVVYAKIASLMGFAWVFGILAAFIS-EYLMFPFVIFTTAQGVFIAVSFVFTRR 218          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033615.1 (SMESG000033615.1)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 418/419 (99.76%), Postives = 418/419 (99.76%), Query Frame = 2
Query:  635 MKQISKFCNVLPYFDKRLQRNCSIKTKDVSNISSMIEDEDDRMGMNYIVYNCNIKNCSDIEKNMLLTKPRPFSTSFTGFSYLFNYGKWETDGGNKDESPDNNQKNFTPYTNSTFDYSTGMGETVIYHISFAFTCXXXXXXXXXXXXXXTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQNA 1891
            MKQISKFCNVLPYFDKRLQRNCSIKTKDVSNISSMIEDEDDRMGMNYIVYNCNIKNCSDIEKNMLLTKPRPFSTSFTGFSYLFNYGKWETDGGNKDESPDNNQKNFTPYTNSTFDYSTGMGETVIYHISFAFTCLSLVSLFFLIILYLTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLIGFS SGSVVGISVITEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQNA
Sbjct:    1 MKQISKFCNVLPYFDKRLQRNCSIKTKDVSNISSMIEDEDDRMGMNYIVYNCNIKNCSDIEKNMLLTKPRPFSTSFTGFSYLFNYGKWETDGGNKDESPDNNQKNFTPYTNSTFDYSTGMGETVIYHISFAFTCLSLVSLFFLIILYLTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLIGFSTSGSVVGISVITEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPTQKSDKSHSNDQQNA 419          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033614.1 (SMESG000033614.1)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 396/555 (71.35%), Postives = 434/555 (78.20%), Query Frame = 2
Query:  239 HNGSQIDQICHSDPQCPLYGDCCYGHQDNGKPGLLKDVLSCKPYNKLFPSAMWVTNKCKNLNHPLSDFCTKKIFNPKNHLKSWIPVISNRKIIYDNLFCAKCNEEIDFKYLQVDIECKSIPFDINIILNKTAMKQISKFCNVLPYFDKRLQRNCS-------IKTKDVSNISSMIEDEDDRMGMNYIVYNC----NIKNCSDIEKNMLLTKPRPFSTSFTGFSYLFNYGKWETDGGNKDESPDN-NQKNFTP------YTNSTFDYSTGMGETVIYHISFAFTCXXXXXXXXXXXXXXTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANKPT 1849
            +NGSQ D+ICHSDPQCPLYGDCCYGHQD+GKPGLLKDVLSCKPYNKLFPSAMW+ NKCKNLNHPLSDFCTKKIF PK  LKSWIPVISNRKIIYDNLFCAKCNEEIDF YL V + C  +        N+  +      C + PYF++ LQR+C          TK + N    + D+ +    +Y V+      N+  C    KN    +  P +   + FSYL N+  WE     K E+ +   +KNFT        TNST DYSTGMGETVIYHISFAFTCLSLVSLFFLIILYLTHQVFKN GGYLTICLSICLWLINFMSLLVTNTQIV+SASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTK  + NK RG K+F +Y +  F++SG VVGISVI EYFDKTNSTLRPQYGGP+CWFTSKFGGLI+YFIPVCLLLLWN I C FVFYQLFKTAKECRI+   D NSTLWLCMRLTAVFGVGYVLQI AIFTQL ILISLGSMVNCLQGFMLTLCFVCTKR RS LRNRLLTITESISKSSTAN+P+
Sbjct:   17 YNGSQSDRICHSDPQCPLYGDCCYGHQDHGKPGLLKDVLSCKPYNKLFPSAMWLINKCKNLNHPLSDFCTKKIFYPKAPLKSWIPVISNRKIIYDNLFCAKCNEEIDFTYLPVKVNCGPLEIYDYASANQAVIDN-PNHCEIFPYFNRTLQRSCEGEIITNCTNTKLIQN--KFVIDKCENGEKDYFVFRLQKYKNVFCCKCWNKNCFGRRKLP-NIRNSPFSYLLNFNDWE-----KQENKETVKEKNFTQENNSSNNTNSTLDYSTGMGETVIYHISFAFTCLSLVSLFFLIILYLTHQVFKNLGGYLTICLSICLWLINFMSLLVTNTQIVKSASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKSASINKNRGWKTFCIYFICVFAVSGCVVGISVIIEYFDKTNSTLRPQYGGPHCWFTSKFGGLIWYFIPVCLLLLWNIITCGFVFYQLFKTAKECRIINNNDLNSTLWLCMRLTAVFGVGYVLQIIAIFTQLNILISLGSMVNCLQGFMLTLCFVCTKRVRSQLRNRLLTITESISKSSTANRPS 562          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033611.1 (SMESG000033611.1)

HSP 1 Score: 397.897 bits (1021), Expect = 2.006e-130
Identity = 242/560 (43.21%), Postives = 335/560 (59.82%), Query Frame = 2
Query:  260 QICHSDPQCPLYGDCCYGHQDNGKPGLLKDVLSCKPYNKLFPSAMWVTNKCKN-LNHPLSDFCTKKIFNPKNHLKSWIPVISNRKIIYDNLFCAKCNEEIDFKYLQVDIECKSIPFDINIILNKTAMKQISKF---CNVLPYFDKRLQRNCSIKTKDVSNISSMIED-------------EDDRMGMNYIVYNCNIKNCSDIE-KNMLLTKPRPFSTSFTGFSYLFNYGKWETDGGNKDESPDNNQKNFTPYTNSTFDYSTGMGETVIYHISFAFTCXXXXXXXXXXXXXXTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSST---ANKPTQKSDKSHSN 1876
            + C+ D +C LYGDCC GH+   K G L+++L CK +      +++V +KCKN   H LS  C K++   K  +KS+IPVI+   +I++N FCAKCN E  + YL + I C     D+NI     A + I+K    C + P  +  ++R C  KTK +   S+  ED             E   +    +  N     C  I  + + + KP       + FSYL N+  W  +  ++   P+ N   F     S         +  +Y+ISF FTCLS++SL  LI+LY+T +VF NFGGYLTICLSICLWLINF +LLV +  IV S+ C+YL IF HF+ +  F+WMA+YALDLLQTFG K  N++KK+  K+F  YCL+GFS SG +V +S + E+  +TN T+RP YGG +CWFT+K GG ++YFIP+C+LLLWNF  C  VFY++ KT+KEC++V    + S LWLC+RLT+VFG GY+ QI AI T  + LI  GS VNCLQG +L  CF+ TKR R +  + L + T+  SKS+      K T KS K+  N
Sbjct:   27 EYCNCDDKCTLYGDCCSGHESFNKTGSLRNILKCKLFKPSVAESIYVVDKCKNNTKHILSKLCRKEVIFSKIPVKSFIPVINENGVIFENSFCAKCNNEDLYSYLNISISCP----DVNITDIYDANQAIAKSRDSCEIQPEIESNIKRIC--KTKLIDFCSNSFEDIGENITGKCTNGPESFEVHGEILYRNTFCCKCWKIHCRRLQVMKPTSI-LDMSTFSYLLNFNDW-VESEDEVYKPEQNNTEFDEIIKSK------NLKYFVYYISFTFTCLSMISLTVLIVLYITQKVFHNFGGYLTICLSICLWLINFCTLLVQSPNIVNSSFCQYLGIFQHFITICNFIWMAIYALDLLQTFGVKSFNSSKKKTWKTFCFYCLVGFSCSGLIVTLSTVLEFTLETNCTIRPNYGGTHCWFTNKLGGTVWYFIPICILLLWNFGACILVFYRIIKTSKECQLVSNDQSYSILWLCIRLTSVFGFGYIFQIIAILTHFQPLIVFGSFVNCLQGCLLACCFIWTKRVRIIFVDVLTSFTDIFSKSNENVDKYKTTNKSLKTSDN 572          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000033610.1 (SMESG000033610.1)

HSP 1 Score: 364.77 bits (935), Expect = 1.397e-117
Identity = 228/541 (42.14%), Postives = 311/541 (57.49%), Query Frame = 2
Query:  239 HNGSQIDQICHSDPQCPLYGDCCYGHQDNGKPGLLKDVLSCKPYNKLFPSAMWVTNKCKNLNHPLSDFCTKKIFNPKNHLKSWIPVISNRKIIYDNLFCAKCNEEIDFKYLQVDIECKSIPFDINIILNKTAMKQISKF-------CNVLPYFDKRLQRNCSIK---------TKDVSNISSM-----IEDEDDRMGMNYIVYNCNIKNCSDIEKNMLLTKPRPFSTSFTGFSYLFNYGKWETDGGNKDESPDNNQKNFTPYTNSTFDYSTGMGETVIYHI----SFAFTCXXXXXXXXXXXXXXTHQVFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLL 1786
             N  + DQ C  D  C  +GDCC GH+   + G L+ + SCK + K     M V NKC N NH  S +CTK++ +PK  +KS+  V+   K+IY+N +CA+CN    ++Y  + + C    F  NI    T  KQ+++        C++LP  D  LQR C I          +K   N+S M     ++   D        + C+ +N S  ++      P     + + FS+  N+  WE +   K            P +N T  Y T     +IY I    +  FT LS+V LF LI+LY T  +F+NFGGYLT+CLS CLWL NF +LLV      +S +C Y+ I   F  L  FVWMAVY+LDLLQTFG +  N  KK+ LKSF  YC+ GFS     VG ++I E+    NST RP+YGG YCWFT+   GLI+YFIPVCLLLLWN + C  VFY++ KT+KECR+V+KK++NSTLWLC+RLT VFG+GYVLQIFAI ++++IL+ +  + N LQG  L +CF   KR R++L
Sbjct:   18 ENCRKSDQYCQCDKICVQFGDCCPGHEKFQQTGSLESISSCKVFAKNSYENMRVINKCVNDNHYYSKYCTKELMDPKLPIKSFAAVMGENKLIYENYYCARCNNIKRYQYFSLSVSC----FGHNI----TNFKQVNEIMIKSPYSCSILPLIDSELQRTCFINLTRLCQEPLSKRFDNVSDMCLNGKLDIVSDGRNFYRNDHCCSCRNISCFKQ-----IPLALDVASSAFSFSLNFAAWENEVQTKP----------VPQSNLTNKYFTHNVYEIIYKIFDKTTEVFTFLSMVCLFILILLYTTQSMFRNFGGYLTVCLSTCLWLSNFFNLLVFYKDFEKSFACTYIGISQQFFNLGMFVWMAVYSLDLLQTFGFRSTNIGKKKTLKSFCFYCITGFSCVAINVGSAIIVEFTLPNNSTFRPKYGGRYCWFTNIPSGLIWYFIPVCLLLLWNSVTCVIVFYRIIKTSKECRVVQKKESNSTLWLCVRLTTVFGLGYVLQIFAILSKVDILVRILVVFNSLQGCFLMICFFWAKRVRAIL 535          
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000067292.1 (SMESG000067292.1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.599e-16
Identity = 72/243 (29.63%), Postives = 124/243 (51.03%), Query Frame = 2
Query: 1145 INFMSLLVTNT--QIVESAS---CKYLAIFHHFVALSTFVWMAVYALDLLQTFGTKLVNANKKRGL---KSFSVYCLXXXXXXXXXXXXXXXTEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKK--DANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTANK 1843
            I+ +SL VTN    +VE+ S   C Y +I +HF  LS+F WM ++ALD+ ++  +  +  NK   L   +    Y L G+ +   +   +V  + FD  N  L P +G   C+     GGL+++FIP+C+ LL N I+C  ++  ++K  ++   V            LC++L+ +FG  ++     +F    IL  +G +++ LQG  L+LCF+            + +ITE+IS  +T  +
Sbjct:  317 ISVLSLCVTNIIFSVVENPSKRFCLYFSIAYHFCFLSSFFWMTIFALDVYKSITSPRLRINKTISLIKSRKLKFYFLGGYGLPLLLTITAVCIQKFDSEN-ILNPSFGEIQCFINQLIGGLVWFFIPLCICLLTNIIICCVLYRFIYKINQQTVEVGHSLNVEKKNFILCIKLSILFGATWLPAFVGVFFNNYILKFIGGLLSSLQGLSLSLCFIYGMDVHKTTTKYIRSITENISSFATRKQ 558          

HSP 2 Score: 53.5286 bits (127), Expect = 4.246e-7
Identity = 33/110 (30.00%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  266 CHSDPQCPLYGDCCYGHQDNGKPGLLKDVLSCKPYNKLFPSAMWVTNKC--KNLNHPLSDFCTKKIFNPKNHLKSWIPVISNRK---IIYDNLFCAKCNEEIDFKYLQVD 580
            C+ D QC ++GDCC+ HQ + +P     + SC           +V +KC  K+ +  L D C +K     N+L   +P   N +   + + N FCA CN +  F++ +V+
Sbjct:   36 CYCDDQCSMFGDCCHKHQQHHEP-----IASCH-------DGYYVIDKCLYKSTDGNLKDKCERKSEISVNNLLYHVPTYGNYENVSLTFKNAFCAVCNGKNQFEFARVE 133          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mthl101.432e-1322.98gene:FBgn0035132 transcript:FBtr0072572[more]
mthl104.330e-1222.18gene:FBgn0035132 transcript:FBtr0306566[more]
mthl104.330e-1222.18gene:FBgn0035132 transcript:FBtr0333904[more]
mthl104.330e-1222.18gene:FBgn0035132 transcript:FBtr0333903[more]
mthl106.046e-1223.53gene:FBgn0035132 transcript:FBtr0306565[more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
galnt41.861e-624.50polypeptide N-acetylgalactosaminyltransferase 4 [S... [more]
galnt41.984e-624.50polypeptide N-acetylgalactosaminyltransferase 4 [S... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Adgre18.581e-722.48adhesion G protein-coupled receptor E1 [Source:MGI... [more]
Adgre18.581e-722.48adhesion G protein-coupled receptor E1 [Source:MGI... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95NT6|MTH2_DROYA1.579e-1122.76G-protein coupled receptor Mth2 OS=Drosophila yaku... [more]
sp|Q95NQ0|MTH2_DROSI4.114e-1122.26G-protein coupled receptor Mth2 OS=Drosophila simu... [more]
sp|Q9W0R5|MTH10_DROME4.051e-1021.71Probable G-protein coupled receptor Mth-like 10 OS... [more]
sp|P83118|MTH11_DROME3.241e-823.37Probable G-protein coupled receptor Mth-like 11 OS... [more]
sp|Q9W0R6|MTH9_DROME1.752e-625.00Probable G-protein coupled receptor Mth-like 9 OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087UWI61.493e-1729.28Putative G-protein coupled receptor Mth-like 3 (Fr... [more]
R7URK62.443e-1729.00G_PROTEIN_RECEP_F2_4 domain-containing protein (Fr... [more]
V4B5X43.587e-1728.35G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A0L8FHQ61.036e-1625.39G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A3M6T4U71.162e-1631.54Uncharacterized protein OS=Pocillopora damicornis ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO344201.088e-1726.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374702.029e-1328.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365093.305e-1322.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391723.531e-1023.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312264.992e-926.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F2_4 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033615.10.000e+099.76SMESG000033615.1[more]
SMESG000033614.10.000e+071.35SMESG000033614.1[more]
SMESG000033611.12.006e-13043.21SMESG000033611.1[more]
SMESG000033610.11.397e-11742.14SMESG000033610.1[more]
SMESG000067292.11.599e-1629.63SMESG000067292.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015414 ID=SMED30015414|Name=G_PROTEIN_RECEP_F2_4 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2076bp
ACCAACGGATATCAAATTTATTCGGCTCAGATTATTATTCTTCGATATCA
ACAAGATTAATTAATGTTCGATATTGTATTCGACAATTCCAGTGACAACT
TTATCAGCCTATCAAATTATTTATTACACAACTCGCTAATTTAAACAAAT
AATTGAACCCAATTCACAATTAATTGACAATCGATTAATGTATAGTTTAT
TAATATTGATAATTTTATTCTCATCAATGAAATCAATTCATAATGGTTCA
CAAATTGATCAAATATGTCATTCAGATCCCCAATGTCCTCTATATGGTGA
CTGTTGCTATGGCCACCAGGATAACGGTAAGCCAGGATTGCTTAAGGATG
TTTTATCATGCAAGCCATACAATAAATTATTTCCATCGGCCATGTGGGTA
ACTAATAAATGCAAAAATCTCAATCATCCTCTCTCGGATTTTTGCACGAA
GAAAATATTCAATCCCAAGAATCATCTGAAATCCTGGATTCCGGTGATTT
CAAACAGAAAGATAATCTATGACAATCTATTCTGTGCCAAATGCAATGAG
GAAATTGATTTTAAATATCTACAAGTAGATATCGAATGCAAGTCCATTCC
ATTTGATATAAATATAATTTTGAATAAAACTGCGATGAAACAGATATCAA
AATTTTGCAATGTTTTACCGTATTTTGACAAAAGGTTACAAAGAAATTGT
TCGATTAAAACAAAAGATGTTTCAAATATTTCTTCGATGATTGAAGATGA
AGATGATCGAATGGGGATGAATTATATCGTTTATAATTGTAATATTAAAA
ATTGCTCCGATATTGAAAAAAATATGTTATTGACGAAACCAAGGCCTTTT
TCAACAAGCTTTACCGGATTTAGTTACTTATTCAATTACGGCAAATGGGA
AACTGATGGCGGGAATAAAGACGAATCTCCTGACAATAATCAAAAGAATT
TCACACCATACACAAATTCCACATTTGATTATTCTACAGGCATGGGAGAA
ACGGTTATTTATCACATCTCTTTTGCATTCACTTGTCTATCCTTAGTTTC
TTTATTCTTTTTGATTATATTGTACTTAACTCACCAAGTCTTCAAAAACT
TTGGAGGCTACTTAACTATATGTTTGAGTATTTGTCTTTGGTTGATCAAT
TTCATGAGTTTATTGGTAACCAACACTCAAATTGTCGAATCAGCTTCATG
TAAGTATTTGGCAATATTCCATCATTTTGTTGCTTTGAGTACTTTCGTTT
GGATGGCTGTTTACGCCTTGGATCTGTTACAAACATTTGGTACAAAGTTG
GTAAATGCCAACAAGAAAAGAGGTTTGAAGAGTTTTAGTGTTTACTGCTT
GATTGGTTTTAGTATTTCTGGTTCCGTTGTGGGTATTTCTGTAATTACTG
AATATTTCGATAAAACTAATTCAACGCTTAGACCTCAATACGGAGGGCCT
TATTGTTGGTTTACTAGTAAATTTGGAGGGTTGATTTATTATTTCATTCC
TGTTTGTTTGTTATTATTATGGAATTTTATCATGTGTAGCTTTGTGTTTT
ATCAACTATTCAAAACTGCTAAAGAATGCAGAATTGTAAAGAAGAAAGAC
GCAAATTCTACTTTGTGGCTCTGTATGAGACTCACTGCAGTATTTGGTGT
TGGTTACGTTTTGCAAATATTTGCAATATTTACGCAACTCGAGATTTTAA
TAAGTTTAGGTTCGATGGTAAATTGCCTTCAAGGATTTATGTTGACTCTC
TGCTTTGTTTGTACTAAACGTGCACGTTCTCTATTACGGAACAGACTTTT
AACAATAACGGAAAGTATTTCAAAGTCATCTACTGCAAATAAACCAACGC
AGAAGTCAGATAAGAGTCACTCAAATGATCAGCAGAATGCATTAGAACTT
CTGTTAAAGAAATAAAATTCATTAATTTTAATATTTTGTTTAAATGCTTC
ATTAAACGTTGACTTTGTTTCTTTTTACCTTTGATATTGGCGCAATCTCA
AATTCCATTGTTTGTCAAATCGGTCTCGAAATTTCCACATTTAATTGGTG
ACGCCTTTTCACTGGATATCCAATCA
back to top

protein sequence of SMED30015414-orf-1

>SMED30015414-orf-1 ID=SMED30015414-orf-1|Name=SMED30015414-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MYSLLILIILFSSMKSIHNGSQIDQICHSDPQCPLYGDCCYGHQDNGKPG
LLKDVLSCKPYNKLFPSAMWVTNKCKNLNHPLSDFCTKKIFNPKNHLKSW
IPVISNRKIIYDNLFCAKCNEEIDFKYLQVDIECKSIPFDINIILNKTAM
KQISKFCNVLPYFDKRLQRNCSIKTKDVSNISSMIEDEDDRMGMNYIVYN
CNIKNCSDIEKNMLLTKPRPFSTSFTGFSYLFNYGKWETDGGNKDESPDN
NQKNFTPYTNSTFDYSTGMGETVIYHISFAFTCLSLVSLFFLIILYLTHQ
VFKNFGGYLTICLSICLWLINFMSLLVTNTQIVESASCKYLAIFHHFVAL
STFVWMAVYALDLLQTFGTKLVNANKKRGLKSFSVYCLIGFSISGSVVGI
SVITEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMC
SFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQ
LEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNRLLTITESISKSSTA
NKPTQKSDKSHSNDQQNALELLLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000832GPCR_2_secretin-like
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 120..412
e-value: 1.1E-37
score: 131.6
NoneNo IPR availablePANTHERPTHR45902FAMILY NOT NAMEDcoord: 115..415
NoneNo IPR availableCDDcd150397tmB3_Methuselah-likecoord: 128..389
e-value: 9.45499E-50
score: 167.786
NoneNo IPR availableTMHMMTMhelixcoord: 193..212
NoneNo IPR availableTMHMMTMhelixcoord: 156..178
NoneNo IPR availableTMHMMTMhelixcoord: 327..349
NoneNo IPR availableTMHMMTMhelixcoord: 233..255
NoneNo IPR availableTMHMMTMhelixcoord: 354..376
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
NoneNo IPR availableTMHMMTMhelixcoord: 284..306
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 127..369
e-value: 2.8E-19
score: 69.4
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 125..378
score: 16.836