ras-related protein Rab-28-like

Overview
Nameras-related protein Rab-28-like
Smed IDSMED30015413
Length (bp)2367
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ras-related protein Rab-28-like (SMED30015413) t-SNE clustered cells

Violin plots show distribution of expression levels for ras-related protein Rab-28-like (SMED30015413) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ras-related protein Rab-28-like (SMED30015413) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ras-related protein Rab-28-like (SMED30015413) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015413

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 28

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle progenitor cellSMED30015413SMESG000007739.1 SMESG000007738.1 SMED30015413smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v4_375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v4_375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v4_375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v4_375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v4_375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v4_375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v4_375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 SMESG000007738.1 Contig16292uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 SMESG000007738.1 Contig16292newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007738.1 Contig41612uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007738.1 Contig41612newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 Contig22501uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 Contig22501newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 Contig2898uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 Contig2898newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000079804.1 Contig2898uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000079804.1 Contig2898newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 Contig44005uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 Contig44005newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 Contig41706uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000007739.1 Contig41706newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000050211.1 SMESG000014784.1 SMESG000007739.1 Contig6409uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015413SMESG000050211.1 SMESG000014784.1 SMESG000007739.1 Contig6409newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
musculature systemSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v6_375_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v6_375_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v6_375_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30015413SMESG000007739.1 SMESG000007738.1 dd_Smed_v6_375_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ras-related protein Rab-28-like vs. Ensembl Human
Match: RAB28 (RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9768])

HSP 1 Score: 228.024 bits (580), Expect = 6.531e-69
Identity = 111/218 (50.92%), Postives = 152/218 (69.72%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSV 2089
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A G+L VYDITN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R ++ +KH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I ++     S    P   S+
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSE-ESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSM 217          
BLAST of ras-related protein Rab-28-like vs. Ensembl Human
Match: RAB28 (RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9768])

HSP 1 Score: 225.713 bits (574), Expect = 4.711e-68
Identity = 106/199 (53.27%), Postives = 146/199 (73.37%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGI 2032
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A G+L VYDITN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R ++ +KH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + +V+A I
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSE-ESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRIVRAEI 198          
BLAST of ras-related protein Rab-28-like vs. Ensembl Human
Match: RAB28 (RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9768])

HSP 1 Score: 219.164 bits (557), Expect = 7.189e-66
Identity = 103/192 (53.65%), Postives = 141/192 (73.44%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQK 2011
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A G+L VYDITN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R ++ +KH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + +
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSE-ESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQ 191          
BLAST of ras-related protein Rab-28-like vs. Ensembl Human
Match: RAB28 (RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9768])

HSP 1 Score: 136.346 bits (342), Expect = 1.060e-36
Identity = 64/121 (52.89%), Postives = 87/121 (71.90%), Query Frame = 2
Query: 1670 LNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGI 2032
            L+ YIY A G+L VYDITN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R ++ +KH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + +V+A I
Sbjct:    2 LDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSE-ESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRIVRAEI 121          
BLAST of ras-related protein Rab-28-like vs. Ensembl Human
Match: RAB26 (RAB26, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:14259])

HSP 1 Score: 109.383 bits (272), Expect = 5.109e-26
Identity = 60/172 (34.88%), Postives = 96/172 (55.81%), Query Frame = 2
Query: 1457 EFEEKCIKIVVVGDGSAGKTSIVNRFVN-SFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            +F +   K+++VGD   GKT ++ RF + +F    +  T+GIDF + ++++ G+ VK+ +WD  GQ    S+ + Y   A  +L +YD+TN  SF+NI  WL    +I E     +  M L+GNKVD  H R V+ +  EK A + G+     SA+T  +V L   +I  E+
Sbjct:   58 DFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLT---EIHEYAQHDVALM-LLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKEL 225          
BLAST of ras-related protein Rab-28-like vs. Ensembl Celegans
Match: rab-28 (Ras-related protein Rab-28 [Source:UniProtKB/Swiss-Prot;Acc:Q9XWR6])

HSP 1 Score: 169.859 bits (429), Expect = 9.784e-48
Identity = 84/189 (44.44%), Postives = 120/189 (63.49%), Query Frame = 2
Query: 1469 KCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGI 2032
            K IKIVVVGDG++GKTSI  RF    F+K Y QT+G+DFFS  I LP  + V V +WDIGGQ++ G +++ Y+  A+ +  VYD+TN+ SFEN VDWL  VKK  +S    +  + L+GNK DLE  R V ++ H+ FA  + M   +VSA+T D+V L      AE+  + L++AE+     +V+  +
Sbjct:   34 KVIKIVVVGDGASGKTSICQRFAKESFDKSYHQTLGLDFFSRRITLPHEMQVLVQVWDIGGQSIAGEMIDKYLTGANIVFLVYDVTNSKSFENAVDWLSVVKKNTKSSETPVK-LVLMGNKTDLEERRVVSVEAHKNFATSNDMMPTYVSAKTGDTVFLTFRQAVAEVLNVGLSRAEVEADIEIVQGSV 221          
BLAST of ras-related protein Rab-28-like vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 112.464 bits (280), Expect = 5.327e-28
Identity = 63/164 (38.41%), Postives = 88/164 (53.66%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K++++GD   GKT I+ RF +  FN  +  TIGIDF    I L G  +K+ +WD  GQ    ++   Y   A GI+ VYDITN  SF+NI  WL   + I E  ++ +  M L GNK D+   R V  ++ EK A D G+S H  SA+ +  V    Y +   I
Sbjct:   11 KLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWL---RNIDEHASEDVVKMIL-GNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAI 170          
BLAST of ras-related protein Rab-28-like vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 112.464 bits (280), Expect = 5.327e-28
Identity = 63/164 (38.41%), Postives = 88/164 (53.66%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K++++GD   GKT I+ RF +  FN  +  TIGIDF    I L G  +K+ +WD  GQ    ++   Y   A GI+ VYDITN  SF+NI  WL   + I E  ++ +  M L GNK D+   R V  ++ EK A D G+S H  SA+ +  V    Y +   I
Sbjct:   11 KLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWL---RNIDEHASEDVVKMIL-GNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAI 170          
BLAST of ras-related protein Rab-28-like vs. Ensembl Celegans
Match: K02E10.1 (pep chromosome:WBcel235:X:2496180:2501001:1 gene:WBGene00019317.1 transcript:K02E10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K02E10.1)

HSP 1 Score: 110.153 bits (274), Expect = 4.406e-27
Identity = 61/166 (36.75%), Postives = 93/166 (56.02%), Query Frame = 2
Query: 1475 IKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVD-WLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
             KIVVVGD + GK+ I+ RF  + F  D+  T+G+DF    I L    +++ LWD  G     ++ N Y +SA G++ VYD+TN  SFEN+   WL+ +K+           + LVGNK D++  R V  D+ EK A   G+S + VSA+T  +     +++TA +
Sbjct:    7 FKIVVVGDHNCGKSCILLRFAENSFRMDHISTLGVDFKLKTIKLGRDKIRLELWDTAGMERYRTIYNSYYHSAHGVMCVYDMTNEKSFENLEKYWLKEIKQ----HAPPNAVLMLVGNKADMDQERKVDFDRAEKLASRLGVSLYEVSAKTGINCEEAFHTLTAAM 168          
BLAST of ras-related protein Rab-28-like vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 105.916 bits (263), Expect = 1.026e-25
Identity = 59/184 (32.07%), Postives = 100/184 (54.35%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAG 2029
            K++++GD   GKT ++ RF +  FN  +  TIGIDF    I L G  +K+ +WD  GQ    ++   Y   A GI+ VYDITN  SFENI +W+  +++   S+ +++    ++GNK D+E  R V  D+ E+ A + G      SA+ + ++    +++  +I   ++ Q E+    +V   G
Sbjct:   10 KLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERM----IIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKS-KMEQNEMRAGGSVSNTG 188          
BLAST of ras-related protein Rab-28-like vs. Ensembl Fly
Match: Rab10 (gene:FBgn0015789 transcript:FBtr0077337)

HSP 1 Score: 103.99 bits (258), Expect = 5.076e-25
Identity = 57/150 (38.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTD 1927
            K++++GD   GKT I+ RF +  F   +  TIGIDF    + L G  +K+ +WD  GQ    ++   Y   A GI+ VYDITN  SFENIV WL   + I E  N+ +  M L GNK D+   R V  ++ E  A + G+     SA+++
Sbjct:   11 KLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWL---RNIDEHANEDVEKMIL-GNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSN 156          
BLAST of ras-related protein Rab-28-like vs. Ensembl Fly
Match: Rab11 (gene:FBgn0015790 transcript:FBtr0084011)

HSP 1 Score: 103.99 bits (258), Expect = 6.457e-25
Identity = 60/180 (33.33%), Postives = 101/180 (56.11%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGI 1978
            M   E+E++    K+V++GD   GK+++++RF  + FN + + TIG++F +  I + G ++K  +WD  GQ    ++ + Y   A G L VYDI  + ++EN+  WL   +++ +  ++ I  M LVGNK DL H R+V  D+ + FA  +G+S    SA    +V     +I  EI  I
Sbjct:    1 MGAREDEYD-YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL---RELRDHADQNIVIM-LVGNKSDLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRI 175          
BLAST of ras-related protein Rab-28-like vs. Ensembl Fly
Match: Rab11 (gene:FBgn0015790 transcript:FBtr0084010)

HSP 1 Score: 103.99 bits (258), Expect = 6.457e-25
Identity = 60/180 (33.33%), Postives = 101/180 (56.11%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGI 1978
            M   E+E++    K+V++GD   GK+++++RF  + FN + + TIG++F +  I + G ++K  +WD  GQ    ++ + Y   A G L VYDI  + ++EN+  WL   +++ +  ++ I  M LVGNK DL H R+V  D+ + FA  +G+S    SA    +V     +I  EI  I
Sbjct:    1 MGAREDEYD-YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL---RELRDHADQNIVIM-LVGNKSDLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRI 175          
BLAST of ras-related protein Rab-28-like vs. Ensembl Fly
Match: Rab19 (gene:FBgn0015793 transcript:FBtr0331832)

HSP 1 Score: 100.908 bits (250), Expect = 9.999e-24
Identity = 55/149 (36.91%), Postives = 80/149 (53.69%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAH 1885
            MA   EE  +   KIV++GD   GKT IV+RF    + + +  TIG+DF    I + G  +K+ +WD  GQ    ++   Y  SA+G+L VYDIT  +SF N+  W+E V++   S       + LVGNK DLE  R V  ++  +   
Sbjct:   10 MALPNEEHFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASN----VLIILVGNKCDLEEQREVDFEEARQMCQ 154          
BLAST of ras-related protein Rab-28-like vs. Ensembl Fly
Match: Rab19 (gene:FBgn0015793 transcript:FBtr0076705)

HSP 1 Score: 100.908 bits (250), Expect = 9.999e-24
Identity = 55/149 (36.91%), Postives = 80/149 (53.69%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAH 1885
            MA   EE  +   KIV++GD   GKT IV+RF    + + +  TIG+DF    I + G  +K+ +WD  GQ    ++   Y  SA+G+L VYDIT  +SF N+  W+E V++   S       + LVGNK DLE  R V  ++  +   
Sbjct:   10 MALPNEEHFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASN----VLIILVGNKCDLEEQREVDFEEARQMCQ 154          
BLAST of ras-related protein Rab-28-like vs. Ensembl Zebrafish
Match: rab11al (RAB11a, member RAS oncogene family, like [Source:ZFIN;Acc:ZDB-GENE-031118-188])

HSP 1 Score: 109.768 bits (273), Expect = 9.693e-27
Identity = 64/180 (35.56%), Postives = 101/180 (56.11%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGI 1978
            M   E+E++    K+V++GD   GK+++++RF  + FN + + TIG++F +  I++ G +VK  +WD  GQ    ++ + Y   A G L VYDI  + ++EN   WL   K++ +  +  I  M LVGNK DL H RAV +D+ + FA   G+S    SA    +V L   +I  EI  I
Sbjct:    1 MTGREDEYD-YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIHVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWL---KELQDHADSNIVIM-LVGNKSDLRHLRAVPMDEAKAFAEKHGLSFLETSALDSSNVELAFQTILTEIYRI 175          
BLAST of ras-related protein Rab-28-like vs. Ensembl Zebrafish
Match: rab13 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:373105])

HSP 1 Score: 107.842 bits (268), Expect = 3.113e-26
Identity = 59/164 (35.98%), Postives = 91/164 (55.49%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K++++GD   GKT ++ RF    FN  Y  TIGIDF    I + G  VK+ +WD  GQ    ++   Y   A GI+ VYDIT+  S+ENI +W++++K   E+ +  +  M L+GNK D+E  R V  +  EK A + G+     SA++  +V     S+  +I
Sbjct:   10 KLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIK---ENASAGVSRM-LLGNKCDIEAKRKVSKETGEKLAKEHGIRFFETSAKSSINVEESFTSLARDI 169          
BLAST of ras-related protein Rab-28-like vs. Ensembl Zebrafish
Match: rab10 (RAB10, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-304])

HSP 1 Score: 106.686 bits (265), Expect = 7.670e-26
Identity = 59/164 (35.98%), Postives = 89/164 (54.27%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K++++GD   GKT ++ RF +  FN  +  TIGIDF    + L G  +K+ +WD  GQ    ++   Y   A GI+ VYDITN  SFENI  WL   + I E  N+ +  M L+GNK D+E  R V   K E+ A + G+     SA+ + ++     ++  +I
Sbjct:   11 KLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWL---RNIDEHANEDVERM-LLGNKCDMEDKRVVPKAKGEQIAKEHGIRFFETSAKANINIEKAFLTLAEDI 170          
BLAST of ras-related protein Rab-28-like vs. Ensembl Zebrafish
Match: megf8 (multiple EGF-like-domains 8 [Source:ZFIN;Acc:ZDB-GENE-090730-1])

HSP 1 Score: 105.531 bits (262), Expect = 8.595e-26
Identity = 57/164 (34.76%), Postives = 91/164 (55.49%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K++++GD   GKT ++ RF    FN  +  TIGIDF    I L G  +K+ +WD  GQ    ++   Y   A GI+ VYDIT+  SFENI +W+  +++   S+ +K+    ++GNK D+   R V  ++ EK A D G+     SA+T  +V    +++  +I
Sbjct:   10 KLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITSEKSFENIKNWIRNIEEHASSDVEKM----ILGNKCDMNERRQVSKERGEKLAIDYGIKFLETSAKTSINVEEAFFTLARDI 169          
BLAST of ras-related protein Rab-28-like vs. Ensembl Zebrafish
Match: rab11a (RAB11a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-041114-53])

HSP 1 Score: 106.686 bits (265), Expect = 1.074e-25
Identity = 63/191 (32.98%), Postives = 107/191 (56.02%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQK 2011
            M   ++E++    K+V++GD   GK+++++RF  + FN + + TIG++F +  I + G +VK  +WD  GQ    ++ + Y   A G L VYDI  + ++EN+  WL   K++ +  +  I  M LVGNK DL H RAV  D+   FA  +G+S    SA    +V     +I  EI  I ++Q +++ ++
Sbjct:    1 MGTRDDEYD-YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL---KELRDHADSNIVIM-LVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRI-VSQKQMSDRR 185          
BLAST of ras-related protein Rab-28-like vs. Ensembl Xenopus
Match: rab28 (RAB28, member RAS oncogene family [Source:NCBI gene;Acc:594989])

HSP 1 Score: 224.172 bits (570), Expect = 1.558e-67
Identity = 107/218 (49.08%), Postives = 152/218 (69.72%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSV 2089
            M+DSEEE +++ IKIV++GDG+ GKTS+  RF    F K Y+QT+GIDFF   I LPG ++V + + DIGGQT+GG +L+ YIY   G+L VYDITN  SFEN+ DW   VKK+   E++  P++ALVGNK+DLEH R V+ DKH++F  ++ + S+FVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I +++    + +  P   S+
Sbjct:    1 MSDSEEESQDRQIKIVILGDGACGKTSLAMRFAQESFGKQYKQTVGIDFFLKRITLPGNLNVTLQVLDIGGQTIGGKMLDKYIYGTQGVLLVYDITNYQSFENLEDWFSMVKKV-NDESETQPFVALVGNKIDLEHMRTVKADKHQRFCQENNLGSYFVSAKTGDSVFLCFQRVAAEILGIKLNKAEIEQSQRVVKADIVNYSQEPVTRMVNPPRSSM 217          
BLAST of ras-related protein Rab-28-like vs. Ensembl Xenopus
Match: rab28 (RAB28, member RAS oncogene family [Source:NCBI gene;Acc:594989])

HSP 1 Score: 222.631 bits (566), Expect = 5.432e-67
Identity = 105/207 (50.72%), Postives = 148/207 (71.50%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRS 2056
            M+DSEEE +++ IKIV++GDG+ GKTS+  RF    F K Y+QT+GIDFF   I LPG ++V + + DIGGQT+GG +L+ YIY   G+L VYDITN  SFEN+ DW   VKK+   E++  P++ALVGNK+DLEH R V+ DKH++F  ++ + S+FVSA+T DSV LC   + AEI GI+L +AE+ + + +VKA I +F   ++
Sbjct:    1 MSDSEEESQDRQIKIVILGDGACGKTSLAMRFAQESFGKQYKQTVGIDFFLKRITLPGNLNVTLQVLDIGGQTIGGKMLDKYIYGTQGVLLVYDITNYQSFENLEDWFSMVKKV-NDESETQPFVALVGNKIDLEHMRTVKADKHQRFCQENNLGSYFVSAKTGDSVFLCFQRVAAEILGIKLNKAEIEQSQRIVKAEIINFPEEQN 206          
BLAST of ras-related protein Rab-28-like vs. Ensembl Xenopus
Match: rab26 (RAB26, member RAS oncogene family [Source:NCBI gene;Acc:780350])

HSP 1 Score: 112.464 bits (280), Expect = 4.092e-27
Identity = 62/172 (36.05%), Postives = 99/172 (57.56%), Query Frame = 2
Query: 1457 EFEEKCIKIVVVGDGSAGKTSIVNRFVN-SFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            EF +   K+++VGD   GKT ++ RF + +F    +  T+GIDF + ++N+ G+ VK+ +WD  GQ    S+ + Y   A  +L +YD+TN +SF+NI  WL    +I E   K +  M L+GNKVD  H R V+I+  E+ A + G+     SA++  +V L   +I  E+
Sbjct:   51 EFYDIAFKVMLVGDSGVGKTCLLVRFKDGAFLAGSFISTVGIDFRNKVLNVDGVKVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKSSFDNIQAWLT---EIHEYAQKDVVIM-LLGNKVDSTHERVVKIEDGERLAKEYGVPFMETSAKSGLNVDLAFIAIAKEL 218          
BLAST of ras-related protein Rab-28-like vs. Ensembl Xenopus
Match: rab11a (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:549235])

HSP 1 Score: 107.842 bits (268), Expect = 5.947e-26
Identity = 63/191 (32.98%), Postives = 108/191 (56.54%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQK 2011
            M   ++E++    K+V++GD   GK+++++RF  + FN + + TIG++F +  I + G ++K  +WD  GQ    ++ + Y   A G L VYDI  + ++EN+  WL   K++ +  + KI  M LVGNK DL H RAV  D+   FA  +G+S    SA    +V     +I  EI  I ++Q +++ ++
Sbjct:    1 MGTRDDEYD-YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL---KELRDHADNKIVIM-LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRI-VSQTQMSDRR 185          
BLAST of ras-related protein Rab-28-like vs. Ensembl Xenopus
Match: rab11a (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:549235])

HSP 1 Score: 105.531 bits (262), Expect = 4.459e-25
Identity = 60/177 (33.90%), Postives = 101/177 (57.06%), Query Frame = 2
Query: 1481 IVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQK 2011
            +V++GD   GK+++++RF  + FN + + TIG++F +  I + G ++K  +WD  GQ    ++ + Y   A G L VYDI  + ++EN+  WL   K++ +  + KI  M LVGNK DL H RAV  D+   FA  +G+S    SA    +V     +I  EI  I ++Q +++ ++
Sbjct:   12 LVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL---KELRDHADNKIVIM-LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRI-VSQTQMSDRR 183          
BLAST of ras-related protein Rab-28-like vs. Ensembl Mouse
Match: Rab28 (RAB28, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1917285])

HSP 1 Score: 228.024 bits (580), Expect = 3.683e-69
Identity = 113/218 (51.83%), Postives = 151/218 (69.27%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSV 2089
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A GIL VYDITN  SFEN+ DW   VK + E E++  P +ALVGNK+DLEH R V+ DKH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I ++     S    P   S+
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSE-ESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLSRTVNPPRSSM 217          
BLAST of ras-related protein Rab-28-like vs. Ensembl Mouse
Match: Rab28 (RAB28, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1917285])

HSP 1 Score: 226.483 bits (576), Expect = 1.551e-68
Identity = 108/199 (54.27%), Postives = 145/199 (72.86%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGI 2032
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A GIL VYDITN  SFEN+ DW   VK + E E++  P +ALVGNK+DLEH R V+ DKH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + +V+A I
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSE-ESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRIVRAEI 198          
BLAST of ras-related protein Rab-28-like vs. Ensembl Mouse
Match: Rab28 (RAB28, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1917285])

HSP 1 Score: 224.172 bits (570), Expect = 5.082e-68
Identity = 107/194 (55.15%), Postives = 142/194 (73.20%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTV 2017
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A GIL VYDITN  SFEN+ DW   VK + E E++  P +ALVGNK+DLEH R V+ DKH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + +TV
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSE-ESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQTV 193          
BLAST of ras-related protein Rab-28-like vs. Ensembl Mouse
Match: Rab13 (RAB13, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1927232])

HSP 1 Score: 108.997 bits (271), Expect = 1.517e-26
Identity = 66/202 (32.67%), Postives = 107/202 (52.97%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSR--SSGLKAPD 2077
            K++++GD   GKT ++ RF    FN  Y  TIGIDF    +++ G  +K+ +WD  GQ    ++   Y   A GI+ VYDIT+  SFENI +W++++K   E+ +  +  + L+GNK D+E  R V+ ++ EK A +  +     SA++  +V     S+  +I               +   G +S TNS+  S+GLK  D
Sbjct:   10 KLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIK---ENASAGVERL-LLGNKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDIL--------------LKTGGRRSGTNSKPSSTGLKTSD 193          
BLAST of ras-related protein Rab-28-like vs. Ensembl Mouse
Match: Rab26 (RAB26, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2443284])

HSP 1 Score: 109.383 bits (272), Expect = 3.989e-26
Identity = 59/175 (33.71%), Postives = 98/175 (56.00%), Query Frame = 2
Query: 1448 SEEEFEEKCIKIVVVGDGSAGKTSIVNRFVN-SFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            S  +F +   K+++VGD   GKT ++ RF + +F    +  T+GIDF + ++++ G+ VK+ +WD  GQ    S+ + Y   A  +L +YDITN +SF+NI  WL  +++  + +      + L+GNKVD    R V+ +  EK A + G+     SART  +V L   +I  E+
Sbjct:   59 STGDFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGMKVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDITNKDSFDNIQAWLTEIQEYAQQDV----VLMLLGNKVDSTQDRVVKREDGEKLAKEYGLPFMETSARTGLNVDLAFTAIAKEL 229          
BLAST of ras-related protein Rab-28-like vs. UniProt/SwissProt
Match: sp|P51158|RAB28_RAT (Ras-related protein Rab-28 OS=Rattus norvegicus OX=10116 GN=Rab28 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.275e-68
Identity = 113/218 (51.83%), Postives = 151/218 (69.27%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSV 2089
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A GIL VYDITN  SFEN+ DW   VK + E E++  P +ALVGNK+DLEH R V+ DKH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I ++     S    P   S+
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSE-ESETQPLVALVGNKIDLEHMRTVKPDKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSM 217          
BLAST of ras-related protein Rab-28-like vs. UniProt/SwissProt
Match: sp|Q99KL7|RAB28_MOUSE (Ras-related protein Rab-28 OS=Mus musculus OX=10090 GN=Rab28 PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.576e-68
Identity = 113/218 (51.83%), Postives = 151/218 (69.27%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSV 2089
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A GIL VYDITN  SFEN+ DW   VK + E E++  P +ALVGNK+DLEH R V+ DKH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I ++     S    P   S+
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSE-ESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLSRTVNPPRSSM 217          
BLAST of ras-related protein Rab-28-like vs. UniProt/SwissProt
Match: sp|P51157|RAB28_HUMAN (Ras-related protein Rab-28 OS=Homo sapiens OX=9606 GN=RAB28 PE=1 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 3.136e-68
Identity = 111/218 (50.92%), Postives = 152/218 (69.72%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSV 2089
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A G+L VYDITN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R ++ +KH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I ++     S    P   S+
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSE-ESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSM 217          
BLAST of ras-related protein Rab-28-like vs. UniProt/SwissProt
Match: sp|Q5RFI2|RAB28_PONAB (Ras-related protein Rab-28 OS=Pongo abelii OX=9601 GN=RAB28 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.343e-68
Identity = 111/218 (50.92%), Postives = 152/218 (69.72%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSV 2089
            M+DSEEE +++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A G+L VYDITN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R ++ +KH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I ++     S    P   S+
Sbjct:    1 MSDSEEESQDRQLKIVVLGDGASGKTSLATCFAQETFGKRYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSE-ESETRPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSM 217          
BLAST of ras-related protein Rab-28-like vs. UniProt/SwissProt
Match: sp|Q3SWY9|RAB28_BOVIN (Ras-related protein Rab-28 OS=Bos taurus OX=9913 GN=RAB28 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.696e-67
Identity = 111/218 (50.92%), Postives = 151/218 (69.27%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSV 2089
            M+DSEEE  ++ +KIVV+GDG++GKTS+   F    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQT+GG +L+ YIY A G+L VYD+TN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R V+ +KH +F  ++G SSHFVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I ++     S    P   S+
Sbjct:    1 MSDSEEESLDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGSLNVTLQVWDIGGQTIGGKMLDKYIYGAQGVLLVYDVTNYQSFENLEDWYSVVKKVSE-ESETQPLVALVGNKIDLEHMRTVKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSM 217          
BLAST of ras-related protein Rab-28-like vs. TrEMBL
Match: A0A2R2MKR9 (ras-related protein Rab-28-like OS=Lingula unguis OX=7574 GN=LOC112041598 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.442e-73
Identity = 117/213 (54.93%), Postives = 159/213 (74.65%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAP 2074
            M+DSE+E  +K +KIV++GDG++GKTS+  R+    F K Y+QT+GIDFF   I LPG ++V + +WDIGGQTLGG +L+ Y+Y A G+L VYDITN +SFEN+ DWL  V+++FE+E K +P+ ALVGNKVDLEH R V++DKH+KFA ++GMSSHFVSA+T DSV+LC   I AEI GI LT+ EL + + VVKA I ++     +  + P
Sbjct:    1 MSDSEDESIDKQLKIVIIGDGASGKTSLTTRYAQEQFGKQYKQTVGIDFFLRRIVLPGNVNVALQVWDIGGQTLGGGMLDKYLYGAHGVLLVYDITNYSSFENLEDWLVVVRRVFENEGK-MPHRALVGNKVDLEHMRTVKLDKHQKFAQENGMSSHFVSAKTGDSVNLCFQKIAAEILGITLTKPELEQHQRVVKADIINYQAKEQTSKQPP 212          
BLAST of ras-related protein Rab-28-like vs. TrEMBL
Match: A0A210R1W1 (Ras-related protein Rab-28 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17036 PE=4 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.020e-72
Identity = 116/199 (58.29%), Postives = 150/199 (75.38%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGI 2032
            M+DSE+E  +K +KIV++GDGS+GKTSI  R+    F + Y+QTIG+DFF   I LPG + V + +WDIGGQTLGG +L  YIY ++GI+ VYDITN  SFEN+ DW  +VKK+F   + KIP+MALVGNKVDLEH R V++DKH+KFA + GMSSHFVSA+T DSVSLC   + AEI GI+LT+ E+   + V+KA I
Sbjct:    1 MSDSEDEAPDKQLKIVIMGDGSSGKTSIATRYSQEQFGRQYKQTIGLDFFLKRIILPGNVHVALQVWDIGGQTLGGKMLENYIYGSNGIVLVYDITNYASFENVEDWYSSVKKVF-GRDTKIPHMALVGNKVDLEHMRTVKMDKHQKFAQEKGMSSHFVSAKTGDSVSLCFQRVAAEILGIKLTKPEVETHQRVIKAEI 198          
BLAST of ras-related protein Rab-28-like vs. TrEMBL
Match: A0A1U7R3S9 (ras-related protein Rab-28 isoform X3 OS=Alligator sinensis OX=38654 GN=RAB28 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 4.156e-69
Identity = 112/204 (54.90%), Postives = 150/204 (73.53%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTN 2047
            M+DSEEE  E+ +K+V++GDG++GKTS+  RF    F K Y+QT+G+DFF   I LPG ++V + LWDIGGQT+GG +L+ YIY A GIL VYDITN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R V+ DKH++F  ++G SSHFVSA+T DSV LC   I AEI GI+L +AE+ + + VVKA I +++ 
Sbjct:    1 MSDSEEESPERQLKLVLLGDGTSGKTSLATRFAQEAFGKQYKQTVGLDFFLKRITLPGNVNVTLQLWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYNVVKKVNE-ESETQPLVALVGNKIDLEHMRTVKADKHQRFCQENGFSSHFVSAKTGDSVFLCFQRIAAEILGIKLNKAEMEQSQRVVKADIVNYSQ 203          
BLAST of ras-related protein Rab-28-like vs. TrEMBL
Match: A0A151P9R3 (Ras-related protein Rab-28 OS=Alligator mississippiensis OX=8496 GN=RAB28 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 4.156e-69
Identity = 112/204 (54.90%), Postives = 150/204 (73.53%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTN 2047
            M+DSEEE  E+ +K+V++GDG++GKTS+  RF    F K Y+QT+G+DFF   I LPG ++V + LWDIGGQT+GG +L+ YIY A GIL VYDITN  SFEN+ DW   VKK+ E E++  P +ALVGNK+DLEH R V+ DKH++F  ++G SSHFVSA+T DSV LC   I AEI GI+L +AE+ + + VVKA I +++ 
Sbjct:    1 MSDSEEESPERQLKLVLLGDGTSGKTSLATRFAQEAFGKQYKQTVGLDFFLKRITLPGNVNVTLQLWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYNVVKKVNE-ESETQPLVALVGNKIDLEHMRTVKADKHQRFCQENGFSSHFVSAKTGDSVFLCFQRIAAEILGIKLNKAEMEQSQRVVKADIVNYSQ 203          
BLAST of ras-related protein Rab-28-like vs. TrEMBL
Match: K1S6C8 (Ras-related protein Rab-28 OS=Crassostrea gigas OX=29159 GN=CGI_10023572 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 4.917e-69
Identity = 110/199 (55.28%), Postives = 149/199 (74.87%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGI 2032
            M+DSE+E  +K +KIV++GDG++GKTS+  R+    F ++Y QTIG+DFF   I LPG + V + +WDIGGQTLGG +L  Y++ + GIL VYDITN  SFEN+ DW    KK+F  ++ K+P++ALVGNK+DLEH R V++DKH+KFA + GMSSHFVSA+T D+VSLC   + AEI GIRLT+ E+ + + VVKA I
Sbjct:    1 MSDSEDEAPDKQLKIVIMGDGASGKTSLATRYSQEQFGRNYVQTIGVDFFLKRIVLPGNVHVALQVWDIGGQTLGGKMLETYVFGSTGILLVYDITNIASFENVEDWYSCAKKVF-GKDSKMPHLALVGNKIDLEHMRTVKMDKHQKFAQERGMSSHFVSAKTGDNVSLCFQRVAAEILGIRLTKPEVEQHQRVVKAEI 198          
BLAST of ras-related protein Rab-28-like vs. Ensembl Cavefish
Match: RAB28 (RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9768])

HSP 1 Score: 221.476 bits (563), Expect = 3.656e-67
Identity = 102/195 (52.31%), Postives = 143/195 (73.33%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVV 2020
            M+DSEEE +++ +K+V+VGDG++GKTS+  RF    F K Y+QTIG+DFF   I LPG ++V + +WDIGGQTLGG +L+ Y+Y A G+L VYDITN+ SFEN+ DW   VKK  E  + + P ++LVGNK+DLEH R V++DKH++F  ++G+ S FVSA+T DSV LC   + AEI GI+L +AE+ + +  V
Sbjct:    1 MSDSEEESQDRQLKLVLVGDGASGKTSLATRFSQEAFGKQYKQTIGLDFFLKRITLPGNLNVTLQVWDIGGQTLGGKMLDKYVYGAQGVLLVYDITNSQSFENLEDWYSMVKKANEESDVQ-PVISLVGNKIDLEHMRTVKVDKHQRFCQENGLISQFVSAKTGDSVFLCFQRVAAEILGIKLNKAEIEQSQVSV 194          
BLAST of ras-related protein Rab-28-like vs. Ensembl Cavefish
Match: rab13 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:103044636])

HSP 1 Score: 110.923 bits (276), Expect = 2.210e-27
Identity = 61/164 (37.20%), Postives = 91/164 (55.49%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K++++GD   GKT ++ RF    FN  Y  TIGIDF    I + G  VK+ +WD  GQ    ++   Y   A GI+ VYDIT+  SFENI +W++++K   E+ +  +  M L+GNK D+E  R V  +  EK A D G+     SA++  +V     S+  +I
Sbjct:   10 KLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIK---ENASAGVSRM-LLGNKCDIEAKRKVSKEMGEKLAKDHGIRFFETSAKSSINVEESFMSLARDI 169          
BLAST of ras-related protein Rab-28-like vs. Ensembl Cavefish
Match: rab11a (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:103028965])

HSP 1 Score: 107.071 bits (266), Expect = 7.296e-26
Identity = 63/191 (32.98%), Postives = 107/191 (56.02%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQK 2011
            M   ++E++    K+V++GD   GK+++++RF  + FN + + TIG++F +  I + G +VK  +WD  GQ    ++ + Y   A G L VYDI  + ++EN+  WL   K++ +  +  I  M LVGNK DL H RAV  D+   FA  +G+S    SA    +V     +I  EI  I ++Q +++ ++
Sbjct:    1 MGTRDDEYD-YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL---KELRDHADSNIVIM-LVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRI-VSQKQMSDRR 185          
BLAST of ras-related protein Rab-28-like vs. Ensembl Cavefish
Match: rab6a (RAB6A, member RAS oncogene family [Source:NCBI gene;Acc:103024949])

HSP 1 Score: 105.145 bits (261), Expect = 2.394e-25
Identity = 61/171 (35.67%), Postives = 92/171 (53.80%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQ 1990
            K+V +G+ S GKTS++ RF+   F+  Y+ TIGIDF S  + L   +V++ LWD  GQ    SL+  YI  +   + VYDITN NSF+    W++ V+    +E      + LVGNK DL   R V I++ E+ A +  +     SA+   +V      + A + G+  TQ
Sbjct:   15 KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVR----TERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQ 181          
BLAST of ras-related protein Rab-28-like vs. Ensembl Cavefish
Match: RAB10 (RAB10, member RAS oncogene family [Source:NCBI gene;Acc:103045708])

HSP 1 Score: 104.76 bits (260), Expect = 3.304e-25
Identity = 58/164 (35.37%), Postives = 89/164 (54.27%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K++++GD   GKT ++ RF +  FN  +  TIGIDF    + L G  +K+ +WD  GQ    ++   Y   A GI+ VYDI+N  SFENI  WL   + I E  N+ +  M L+GNK D+E  R V   K E+ A + G+     SA+ + ++     ++  +I
Sbjct:   11 KLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDISNAKSFENISKWL---RNIDEHANEDVERM-LLGNKCDMEDKRIVPKAKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDI 170          
BLAST of ras-related protein Rab-28-like vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 105.916 bits (263), Expect = 3.132e-26
Identity = 57/177 (32.20%), Postives = 98/177 (55.37%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQ 2008
            K++++GD   GKT ++ RF    FN  +  TIGIDF    I+L G  +K+ +WD  GQ    ++   Y   A GI+ VYDITN  SFENI +W+  +++   ++ +K+    ++GNK D+   R V  ++ EK A + G+     SA+   +V    +++  +I      +A+++R+
Sbjct:   10 KLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKM----ILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDI------KAKMDRK 176          
BLAST of ras-related protein Rab-28-like vs. Ensembl Sea Lamprey
Match: rab11ba (RAB11B, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-040426-2860])

HSP 1 Score: 102.834 bits (255), Expect = 3.921e-25
Identity = 57/163 (34.97%), Postives = 92/163 (56.44%), Query Frame = 2
Query: 1481 IVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            +V++GD   GK+++++RF  + FN + + TIG++F +  I + G ++K  +WD  GQ    ++ + Y   A G L VYDI  + ++EN+  WL   K++ +  +  I  M LVGNK DL H RAV  D+ + FA + G+S    SA    +V     +I  EI
Sbjct:    1 VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAYGALLVYDIAKHLTYENVERWL---KELRDHADSNIVIM-LVGNKSDLRHLRAVTTDEAKAFAENHGLSFIETSALDSTNVESAFITILTEI 159          
BLAST of ras-related protein Rab-28-like vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 100.523 bits (249), Expect = 2.765e-24
Identity = 62/200 (31.00%), Postives = 102/200 (51.00%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEIC-GIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAP 2074
            K +++GD   GK+ ++ +F +  F   +  TIG++F + +I + G  VK+ +WD  GQ    S+   Y   A G L VYDIT  ++F ++  WLE  +   +  N  +  M L+GNK DLE  R V+ ++ E FA + G+     SA+T  +V     +   EI   I+    ++N +   +K G Q    + S+G   P
Sbjct:   13 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDAR---QHSNSNMVIM-LIGNKSDLESRREVKCEEGEAFAREHGLVFMETSAKTAANVEEAFINTAREIYEKIQEGVFDVNNEANGIKIGPQQLGATPSAGQGRP 208          
BLAST of ras-related protein Rab-28-like vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 97.8265 bits (242), Expect = 1.056e-23
Identity = 56/164 (34.15%), Postives = 88/164 (53.66%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K +++GD   GK+ ++ +F +  F   +  TIG++F + +IN+ G  VK+ +WD  GQ    S+   Y   A G L VYDIT  ++F ++  WLE  ++   S N  I    L+GNK DLE  R V+ ++ E FA + G+     SA+T  +V     +   EI
Sbjct:   13 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQ-HSSSNMII---MLIGNKSDLESRRDVKREEGEAFAREHGLVFMETSAKTAANVEEAFINTAKEI 172          
BLAST of ras-related protein Rab-28-like vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 98.2117 bits (243), Expect = 1.717e-23
Identity = 54/164 (32.93%), Postives = 87/164 (53.05%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K +++GD   GK+ ++ +F +  F   +  TIG++F + +I + G  VK+ +WD  GQ    S+   Y   A G L VYDIT  ++F ++  WLE  +   +  N  +  M L+GNK DLE  R V+ ++ E FA + G+     SA+T  +V     +   EI
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDAR---QHSNSNMVIM-LIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTASNVEEAFINTAKEI 167          
BLAST of ras-related protein Rab-28-like vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 104.375 bits (259), Expect = 7.735e-26
Identity = 62/181 (34.25%), Postives = 98/181 (54.14%), Query Frame = 2
Query: 1475 IKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTV 2017
            +KI+++GD   GK+ ++ RFV   FN  +  TIGIDF    +++ G  VK+ LWD  GQ    ++   Y   A GI+ VYD+T+  +F NI  W +TV +    E      + LVGNK D+E +R V  D+ E  A + G+     SA+ DD+V+   +++       +L Q +++  K V
Sbjct:   21 MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDE----AQLLLVGNKSDME-TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLA------KLIQEKIDSNKLV 190          
BLAST of ras-related protein Rab-28-like vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 98.2117 bits (243), Expect = 1.133e-23
Identity = 54/136 (39.71%), Postives = 75/136 (55.15%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAH 1885
            KIV +G+   GKTS++ RF+   F+  Y+ TIGIDF S  + L   ++++ LWD  GQ    SL+  YI  +   + VYDIT   SFE I  W+E VK     EN     + +VGNK DL   R +  ++ EK A 
Sbjct:   12 KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDEN---VILCIVGNKSDLSDERQISTEEGEKKAK 144          
BLAST of ras-related protein Rab-28-like vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 97.4413 bits (241), Expect = 2.673e-23
Identity = 48/140 (34.29%), Postives = 84/140 (60.00%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGM 1897
            KIV++GD   GK+++++RF  + FN D + TIG++F +  + + G  +K  +WD  GQ    ++ + Y   A G L VYDI+ ++S+EN   WL  ++   E+ +  +  + L+GNK DL H RAV  ++ + FA ++ +
Sbjct:   15 KIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELR---ENADDNVA-VGLIGNKSDLAHLRAVPTEESKTFAQENQL 150          
BLAST of ras-related protein Rab-28-like vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 96.6709 bits (239), Expect = 4.255e-23
Identity = 53/153 (34.64%), Postives = 87/153 (56.86%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSV 1936
            KIV++GD   GK+++++RF    FN + + TIG++F +  I +    +K  +WD  GQ    ++ + Y   A G L VYDI+ ++S+EN   WL  ++   E+ +  +  + L+GNK DL H RAV  D+ + FA ++ M     SA   D+V
Sbjct:   15 KIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELR---ENADDNVA-VGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNV 163          
BLAST of ras-related protein Rab-28-like vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 92.4337 bits (228), Expect = 9.203e-22
Identity = 61/197 (30.96%), Postives = 100/197 (50.76%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNR--QKTVVKAGI----QSFTNS 2050
            K++++G+   GK+ ++ RF +  +  DY  TIG+DF    + L G +VK+ +WD  GQ    ++ + Y   + GI+ VYD+T+  SF  +  WL+ + +   S   K+    LVGNK DL+  R V  D  ++FA  + M     SA    +V     ++  +I    ++Q  LN   QK   K  +    QS TN+
Sbjct:   10 KLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKL----LVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQI-KESMSQQNLNETTQKKEDKGNVNLKGQSLTNT 201          
BLAST of ras-related protein Rab-28-like vs. Ensembl Nematostella
Match: EDO43164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZL0])

HSP 1 Score: 234.187 bits (596), Expect = 7.232e-72
Identity = 108/214 (50.47%), Postives = 151/214 (70.56%), Query Frame = 2
Query: 1439 MADSEEEFE-EKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAP 2074
            M+DSE+E   E  +K V++GDG+AGKTS+  R+    F + Y+QTIG+DFF   I LPG + V + +WDIGGQTLGG +L+ YI+ A  IL VYD+TN +SF+N+ DW ET KK+ E +  K+P+MALV NK+DLEH R V+ DKH +FA ++ +SSHF+SA+T + VSLC + + AE+ GIRLT+ E+ +Q  VVKA +  ++N       AP
Sbjct:    1 MSDSEDETSTEHQLKFVLIGDGAAGKTSLCIRYTQENFEQTYKQTIGLDFFLKRIVLPGNVHVTIQVWDIGGQTLGGQMLDKYIFGAHAILLVYDVTNQSSFDNLEDWYETAKKVAEKQGGKMPHMALVANKMDLEHMRVVKPDKHGRFAQENSLSSHFISAKTAEQVSLCFHKVAAEVLGIRLTKNEMEQQSRVVKAEVIQYSNHEMPTRAAP 214          
BLAST of ras-related protein Rab-28-like vs. Ensembl Nematostella
Match: EDO43166 (pep supercontig:ASM20922v1:NEMVEscaffold_51:826520:829361:-1 gene:NEMVEDRAFT_v1g232494 transcript:EDO43166 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 233.032 bits (593), Expect = 1.592e-71
Identity = 108/214 (50.47%), Postives = 151/214 (70.56%), Query Frame = 2
Query: 1439 MADSEEEFE-EKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAP 2074
            M+DSE+E   E  +K V++GDG+AGKTS+  R+    F + Y+QTIG+DFF   I LPG + V + +WDIGGQTLGG +L+ YI+ A  IL VYD+TN +SF+N+ DW ET KK+ E +  K+P+MALV NK+DLEH R V+ DKH +FA ++ +SSHF+SA+T + VSLC + + AE+ GIRLT+ E+ +Q  VVKA +  ++N       AP
Sbjct:    1 MSDSEDETSTEHQLKFVLIGDGAAGKTSLCIRYTQENFEQTYKQTIGLDFFLKRIVLPGNVHVTIQVWDIGGQTLGGQMLDKYIFGAHAILLVYDVTNQSSFDNLEDWYETAKKVAEKQGGKMPHMALVXNKMDLEHMRVVKPDKHGRFAQENSLSSHFISAKTAEQVSLCFHKVAAEVLGIRLTKNEMEQQSRVVKAEVIQYSNHEMPTRAAP 214          
BLAST of ras-related protein Rab-28-like vs. Ensembl Nematostella
Match: EDO40980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I3])

HSP 1 Score: 107.457 bits (267), Expect = 1.214e-26
Identity = 60/180 (33.33%), Postives = 94/180 (52.22%), Query Frame = 2
Query: 1436 NMADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMA--LVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            N   S E+  E   KI+V+GD   GKT ++ RF    F+  Y  TIGID  S +++L G  +++ +WD  GQ    +L + Y   A GIL VYDIT  +SF++I  WL+ +      E+   P +   L+GNK+D E  R +   +      D+ +  +  SART ++V     ++  +I
Sbjct:    4 NSQSSPEKDFEATYKILVLGDSGVGKTCLIFRFAEDIFSDSYISTIGIDCRSRVVDLDGQRIRLQIWDTAGQERFRTLTSAYYRGAMGILLVYDITTEDSFKHISQWLQNI------EDNASPNVCKVLLGNKLDAEDERVIDAQRGRSVGEDNNLEFYEASARTGENVQQAFMAVARKI 177          
BLAST of ras-related protein Rab-28-like vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 107.071 bits (266), Expect = 2.248e-26
Identity = 58/164 (35.37%), Postives = 90/164 (54.88%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            K++++GD   GKT ++ RF    FN  +  TIGIDF    I L G  +K+ +WD  GQ    ++   Y   A GI+ VYDITN+ SFENI +W   ++ I E  ++ +  M L GNK D+E  R V  ++ E+ A + G+     SA+   +V    +++  +I
Sbjct:   10 KLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNW---IRNIEEHASQDVEKMVL-GNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDI 169          
BLAST of ras-related protein Rab-28-like vs. Ensembl Nematostella
Match: EDO33171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST02])

HSP 1 Score: 107.071 bits (266), Expect = 3.160e-26
Identity = 61/180 (33.89%), Postives = 102/180 (56.67%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGI 1978
            M   ++E++    K+V++GD   GK+++++RF  + FN + + TIG++F +  I + G ++K  +WD  GQ    ++ + Y   A G L VYDI  + ++EN+  WL   K++ +  +  I  M LVGNK DL H RAV  D+ + FA  +G+S    SA    +V +  ++I  EI  I
Sbjct:    1 MGTKDDEYD-YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWL---KELRDHADSNIVIM-LVGNKSDLRHLRAVPTDEAKAFAEKNGLSFIETSALDSTNVEVAFHNILTEIYHI 175          
BLAST of ras-related protein Rab-28-like vs. Ensembl Medaka
Match: ENSORLT00000000746.2 (RAB28, member RAS oncogene family [Source:NCBI gene;Acc:101166561])

HSP 1 Score: 223.787 bits (569), Expect = 1.378e-67
Identity = 109/204 (53.43%), Postives = 145/204 (71.08%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPG-ISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTN 2047
            M+DSEE+ ++K +KIVVVGDG+ GKTS+  RF    F K Y+QTIG+DFF   I+LPG  +V + +WDIGGQTLGG +L+ Y Y A G+L VYDITN  SFEN+ DW   VKK  E  + + P M LVGNK+DLEH R V+ DKH++F  ++G+ S FVSA+T DSV LC   + AEI GI+L +AE+ + + VVKA I +++ 
Sbjct:    1 MSDSEEDSQDKQLKIVVVGDGACGKTSLATRFAQESFGKQYKQTIGLDFFLKRISLPGNQNVTLQVWDIGGQTLGGKMLDKYAYGAHGVLLVYDITNYQSFENLEDWFSMVKKSNEESDIQ-PIMFLVGNKIDLEHIRTVKADKHQRFCQENGLLSQFVSAKTGDSVYLCFQRVAAEILGIKLNKAEIEQSQRVVKADIVNYSQ 203          
BLAST of ras-related protein Rab-28-like vs. Ensembl Medaka
Match: RAB26 (RAB26, member RAS oncogene family [Source:NCBI gene;Acc:105358274])

HSP 1 Score: 108.997 bits (271), Expect = 3.854e-26
Identity = 59/172 (34.30%), Postives = 97/172 (56.40%), Query Frame = 2
Query: 1457 EFEEKCIKIVVVGDGSAGKTSIVNRFVN-SFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            EF +   K+++VGD   GKT ++ RF + +F    +  T+GIDF + ++N+ G+ VK+ +WD  GQ    S+ + Y   A  +L +YD+TN +SF+NI  WL    +I E   + +  M L+GNK D  H R V+ +  E+ A + G+     SAR+  +V L   ++  E+
Sbjct:   56 EFYDISFKVMLVGDSGVGKTCLLVRFKDGAFLAGSFISTVGIDFRNKVMNIDGVKVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKSSFDNIQSWLT---EIHEYAQQDVVLM-LLGNKADSAHDRVVKREDGERLAKEFGVPFMETSARSGLNVELAFTAVAKEL 223          
BLAST of ras-related protein Rab-28-like vs. Ensembl Medaka
Match: rab11al (ras-related protein Rab-11A [Source:NCBI gene;Acc:101171030])

HSP 1 Score: 107.842 bits (268), Expect = 4.259e-26
Identity = 63/180 (35.00%), Postives = 98/180 (54.44%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGI 1978
            M + E+E++    K+V++GD   GK+++++RF  + FN + + TIG++F +  I + G +VK  +WD  GQ    ++ + Y   A G L VYDI  + ++EN   WL   K++ +  +  I  M LVGNK DL H RAV  D+   FA   G+S    SA    +V L   +I   I  I
Sbjct:    1 MTNREDEYD-YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWL---KELQDHADSNIVIM-LVGNKSDLRHLRAVPTDEARAFAEKHGLSFLETSALDSSNVELAFQTILTAIYNI 175          
BLAST of ras-related protein Rab-28-like vs. Ensembl Medaka
Match: rab6bb (ras-related protein Rab-6B [Source:NCBI gene;Acc:101156359])

HSP 1 Score: 107.071 bits (266), Expect = 5.112e-26
Identity = 60/167 (35.93%), Postives = 92/167 (55.09%), Query Frame = 2
Query: 1478 KIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGI 1978
            K+V +G+ S GKTS++ RF+   F+  Y+ TIGIDF S  + L   +V++ LWD  GQ    SL+  YI  +   + VYDITN NSF+    W++ V+    +E      + LVGNK DLE  R + I++ E+ A +  +     SA+T  +V      + A + G+
Sbjct:   15 KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTCKWIDDVR----TERGSDVIIMLVGNKTDLEEKRQITIEEGEQRAKELNVMFIETSAKTGSNVKQLFRRVAAALPGM 177          
BLAST of ras-related protein Rab-28-like vs. Ensembl Medaka
Match: ENSORLT00000015272.2 (ras-related protein Rab-37 [Source:NCBI gene;Acc:101160735])

HSP 1 Score: 107.457 bits (267), Expect = 6.582e-26
Identity = 56/172 (32.56%), Postives = 99/172 (57.56%), Query Frame = 2
Query: 1457 EFEEKCIKIVVVGDGSAGKTSIVNRFVN-SFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEI 1969
            E+ +   K++++GD + GKT ++ RF + +F   ++  T+GIDF + ++++  + VK+ +WD  GQ    S+ + Y   A  +L +YDITN  SF+NI  WL    +I E   K +  M L+GNK D+   R V+ ++ EK A + G+     SA+T  ++ L  +++  E+
Sbjct:   30 EYYDIAFKVMLLGDSAVGKTCVLVRFKDGAFLGGNFIATVGIDFRNKVVDVDNLKVKLQIWDTAGQERFRSVTHAYYRDAQALLLIYDITNKPSFDNIRAWLT---EIHEYAQKDVVIM-LLGNKSDMAAERVVKTEEGEKLAKECGIPFMETSAKTGVNIELAFHAVAKEL 197          
BLAST of ras-related protein Rab-28-like vs. Planmine SMEST
Match: SMESG000007738.1 (SMESG000007738.1)

HSP 1 Score: 456.833 bits (1174), Expect = 5.603e-157
Identity = 247/248 (99.60%), Postives = 247/248 (99.60%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSVLPKVPXXXXXXXXXXXXXXXXXXXXXACSIL 2182
            MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNS FNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSVLPKVPISINSEGINNNNSISDQNNSQACSIL
Sbjct:    1 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSCFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSVLPKVPISINSEGINNNNSISDQNNSQACSIL 248          
BLAST of ras-related protein Rab-28-like vs. Planmine SMEST
Match: SMESG000007738.1 (SMESG000007738.1)

HSP 1 Score: 456.447 bits (1173), Expect = 2.383e-156
Identity = 247/248 (99.60%), Postives = 247/248 (99.60%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSVLPKVPXXXXXXXXXXXXXXXXXXXXXACSIL 2182
            MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNS FNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSVLPKVPISINSEGINNNNSISDQNNSQACSIL
Sbjct:    1 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSCFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQSFTNSRSSGLKAPDYQSVLPKVPISINSEGINNNNSISDQNNSQACSIL 248          
BLAST of ras-related protein Rab-28-like vs. Planmine SMEST
Match: SMESG000007739.1 (SMESG000007739.1)

HSP 1 Score: 409.838 bits (1052), Expect = 1.376e-137
Identity = 291/293 (99.32%), Postives = 293/293 (100.00%), Query Frame = 1
Query:  175 AQIKMEADAKRRXXXXXXXXXXXXXMRKSEKEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKTSKRPNFVINKRANDELVSDEPTKEEVAKSKEQLEAERKATLEQRIQALAIDGFDLNKLKEKAKELHQNIYKLESEKYDLEQQFQRQTLDLMELAERARQMNKGGKGQKVNVSQTDALPTKMSRAPPKVVMYSQYERVKDPRSFVDRSTVFKGPLYSDYFTKIEPRFKVQMGEQGGEVIMGDGLHNDHD 1053
            AQIKMEADAKRRKEKADEEWKEYEEMRKSEKEKEAEEILQLRERREQRKKERAAEEQRLAELRAVEEQKRRAEDEERQRRKREEEQKKREERELKNKEAEERSKTSKRPNFVINKRANDELVSDEPTKEEVAKSKEQLEAE+KATLEQRIQALAIDGFDLNKLKEKAKELHQNIYKLESEKYDLEQQFQRQTLDLMELAERARQMNKGGKGQKVNVSQTDALP+KMSRAPPKVVMYSQYERVKDPRSFVDRSTVFKGPLYSDYFTKIEPRFKVQMGEQGGEVIMGDGLHNDHD
Sbjct:   19 AQIKMEADAKRRKEKADEEWKEYEEMRKSEKEKEAEEILQLRERREQRKKERAAEEQRLAELRAVEEQKRRAEDEERQRRKREEEQKKREERELKNKEAEERSKTSKRPNFVINKRANDELVSDEPTKEEVAKSKEQLEAEKKATLEQRIQALAIDGFDLNKLKEKAKELHQNIYKLESEKYDLEQQFQRQTLDLMELAERARQMNKGGKGQKVNVSQTDALPSKMSRAPPKVVMYSQYERVKDPRSFVDRSTVFKGPLYSDYFTKIEPRFKVQMGEQGGEVIMGDGLHNDHD 311          
BLAST of ras-related protein Rab-28-like vs. Planmine SMEST
Match: SMESG000007738.1 (SMESG000007738.1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.243e-132
Identity = 191/192 (99.48%), Postives = 191/192 (99.48%), Query Frame = 2
Query: 1439 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKT 2014
            MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNS FNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKT
Sbjct:    1 MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSCFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKT 192          
BLAST of ras-related protein Rab-28-like vs. Planmine SMEST
Match: SMESG000076068.1 (SMESG000076068.1)

HSP 1 Score: 107.071 bits (266), Expect = 3.975e-26
Identity = 56/168 (33.33%), Postives = 95/168 (56.55%), Query Frame = 2
Query: 1475 IKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFFSNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSFENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHDSGMSSHFVSARTDDSVSLCLYSITAEICGI 1978
            +KI++VGD   GK+S++ RF +  FN+ Y QT+G+DF    I +    VK+ +WD  G     SL + +   + GI+ VY++ + N+F+N+  W++ V +     NK++    LVGNK+DL   RAV  +  ++FA  + M     SA+T ++V    +S+   I  +
Sbjct:   11 LKIIIVGDPGVGKSSLLARFADDTFNESYIQTLGVDFKLRTIKINESKVKIQIWDTAGTEKYASLTSSFYRGSHGIIIVYNLIDQNTFQNVSYWIKEVNRSTGVRNKRL----LVGNKLDLSDKRAVSTETAKEFAEQNEMQFIETSAKTSENVEEAFFSLVDTIVTL 174          
The following BLAST results are available for this feature:
BLAST of ras-related protein Rab-28-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB286.531e-6950.92RAB28, member RAS oncogene family [Source:HGNC Sym... [more]
RAB284.711e-6853.27RAB28, member RAS oncogene family [Source:HGNC Sym... [more]
RAB287.189e-6653.65RAB28, member RAS oncogene family [Source:HGNC Sym... [more]
RAB281.060e-3652.89RAB28, member RAS oncogene family [Source:HGNC Sym... [more]
RAB265.109e-2634.88RAB26, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-289.784e-4844.44Ras-related protein Rab-28 [Source:UniProtKB/Swis... [more]
rab-105.327e-2838.41Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
rab-105.327e-2838.41Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
K02E10.14.406e-2736.75pep chromosome:WBcel235:X:2496180:2501001:1 gene:W... [more]
rab-81.026e-2532.07RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab105.076e-2538.00gene:FBgn0015789 transcript:FBtr0077337[more]
Rab116.457e-2533.33gene:FBgn0015790 transcript:FBtr0084011[more]
Rab116.457e-2533.33gene:FBgn0015790 transcript:FBtr0084010[more]
Rab199.999e-2436.91gene:FBgn0015793 transcript:FBtr0331832[more]
Rab199.999e-2436.91gene:FBgn0015793 transcript:FBtr0076705[more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11al9.693e-2735.56RAB11a, member RAS oncogene family, like [Source:Z... [more]
rab133.113e-2635.98RAB13, member RAS oncogene family [Source:NCBI gen... [more]
rab107.670e-2635.98RAB10, member RAS oncogene family [Source:ZFIN;Acc... [more]
megf88.595e-2634.76multiple EGF-like-domains 8 [Source:ZFIN;Acc:ZDB-G... [more]
rab11a1.074e-2532.98RAB11a, member RAS oncogene family [Source:ZFIN;Ac... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab281.558e-6749.08RAB28, member RAS oncogene family [Source:NCBI gen... [more]
rab285.432e-6750.72RAB28, member RAS oncogene family [Source:NCBI gen... [more]
rab264.092e-2736.05RAB26, member RAS oncogene family [Source:NCBI gen... [more]
rab11a5.947e-2632.98RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
rab11a4.459e-2533.90RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab283.683e-6951.83RAB28, member RAS oncogene family [Source:MGI Symb... [more]
Rab281.551e-6854.27RAB28, member RAS oncogene family [Source:MGI Symb... [more]
Rab285.082e-6855.15RAB28, member RAS oncogene family [Source:MGI Symb... [more]
Rab131.517e-2632.67RAB13, member RAS oncogene family [Source:MGI Symb... [more]
Rab263.989e-2633.71RAB26, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51158|RAB28_RAT2.275e-6851.83Ras-related protein Rab-28 OS=Rattus norvegicus OX... [more]
sp|Q99KL7|RAB28_MOUSE2.576e-6851.83Ras-related protein Rab-28 OS=Mus musculus OX=1009... [more]
sp|P51157|RAB28_HUMAN3.136e-6850.92Ras-related protein Rab-28 OS=Homo sapiens OX=9606... [more]
sp|Q5RFI2|RAB28_PONAB6.343e-6850.92Ras-related protein Rab-28 OS=Pongo abelii OX=9601... [more]
sp|Q3SWY9|RAB28_BOVIN1.696e-6750.92Ras-related protein Rab-28 OS=Bos taurus OX=9913 G... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MKR91.442e-7354.93ras-related protein Rab-28-like OS=Lingula unguis ... [more]
A0A210R1W12.020e-7258.29Ras-related protein Rab-28 OS=Mizuhopecten yessoen... [more]
A0A1U7R3S94.156e-6954.90ras-related protein Rab-28 isoform X3 OS=Alligator... [more]
A0A151P9R34.156e-6954.90Ras-related protein Rab-28 OS=Alligator mississipp... [more]
K1S6C84.917e-6955.28Ras-related protein Rab-28 OS=Crassostrea gigas OX... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB283.656e-6752.31RAB28, member RAS oncogene family [Source:HGNC Sym... [more]
rab132.210e-2737.20RAB13, member RAS oncogene family [Source:NCBI gen... [more]
rab11a7.296e-2632.98RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
rab6a2.394e-2535.67RAB6A, member RAS oncogene family [Source:NCBI gen... [more]
RAB103.304e-2535.37RAB10, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a3.132e-2632.20RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab11ba3.921e-2534.97RAB11B, member RAS oncogene family, a [Source:ZFIN... [more]
RAB2B2.765e-2431.00RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2B1.056e-2334.15RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
rab2a1.717e-2332.93RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC47.735e-2634.25Rab family GTPase; essential for vesicle-mediated ... [more]
YPT61.133e-2339.71Rab family GTPase; required for endosome-to-Golgii... [more]
YPT312.673e-2334.29Rab family GTPase; involved in the exocytic pathwa... [more]
YPT324.255e-2334.64Rab family GTPase involved in the exocytic pathway... [more]
YPT19.203e-2230.96Rab family GTPase; involved in the ER-to-Golgi ste... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO431647.232e-7250.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431661.592e-7150.47pep supercontig:ASM20922v1:NEMVEscaffold_51:826520... [more]
EDO409801.214e-2633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410182.248e-2635.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331713.160e-2633.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000746.21.378e-6753.43RAB28, member RAS oncogene family [Source:NCBI gen... [more]
RAB263.854e-2634.30RAB26, member RAS oncogene family [Source:NCBI gen... [more]
rab11al4.259e-2635.00ras-related protein Rab-11A [Source:NCBI gene;Acc:... [more]
rab6bb5.112e-2635.93ras-related protein Rab-6B [Source:NCBI gene;Acc:1... [more]
ENSORLT00000015272.26.582e-2632.56ras-related protein Rab-37 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of ras-related protein Rab-28-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007738.15.603e-15799.60SMESG000007738.1[more]
SMESG000007738.12.383e-15699.60SMESG000007738.1[more]
SMESG000007739.11.376e-13799.32SMESG000007739.1[more]
SMESG000007738.11.243e-13299.48SMESG000007738.1[more]
SMESG000076068.13.975e-2633.33SMESG000076068.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015413 ID=SMED30015413|Name=ras-related protein Rab-28-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2367bp
TAACGTCGTAGAATACCAAATTTTATTTACAGATTTTTCCAATAATCATC
TACTCTCTGTGTTTTCCGTTTTCAGTTGATTTTCATTATTTGTGGAAAAC
TTTAATTTAGATTTTTTAAAATGTCAGACGACGAACGAAGAGAAAGTATC
AGCGAAGAAGGTGGAAAATCAGAAGCTCAAATTAAGATGGAAGCTGACGC
CAAGCGAAGGAAAGAGAAGGCCGACGAAGAATGGAAGGAATATGAAGAAA
TGAGAAAATCTGAAAAGGAAAAGGAAGCTGAAGAAATACTACAATTGCGT
GAAAGACGAGAACAACGAAAAAAAGAACGTGCGGCTGAGGAACAGCGATT
AGCGGAATTAAGAGCCGTTGAAGAACAAAAACGTCGAGCTGAAGATGAAG
AAAGACAACGTCGAAAACGAGAGGAAGAACAAAAGAAACGAGAAGAGAGG
GAACTTAAAAATAAAGAAGCTGAAGAAAGATCTAAAACTTCCAAAAGACC
GAATTTTGTAATAAATAAACGTGCTAATGATGAGTTGGTAAGTGATGAGC
CAACAAAAGAAGAAGTTGCAAAATCGAAAGAACAATTAGAGGCAGAAAGG
AAAGCTACTTTGGAACAAAGAATTCAAGCATTAGCAATTGATGGGTTTGA
TTTGAATAAACTTAAAGAAAAAGCTAAAGAGCTTCATCAAAATATTTATA
AATTGGAAAGTGAGAAATATGACTTGGAACAACAGTTTCAAAGACAAACT
TTAGATTTGATGGAATTAGCTGAAAGGGCTCGTCAAATGAATAAAGGTGG
CAAAGGACAAAAGGTTAATGTGTCGCAAACGGATGCTTTGCCGACTAAAA
TGTCAAGAGCTCCACCTAAAGTAGTTATGTATAGTCAATATGAAAGAGTA
AAAGATCCAAGAAGCTTCGTAGACAGATCTACAGTGTTTAAAGGACCTTT
GTATTCAGATTACTTTACAAAAATTGAACCCCGCTTTAAAGTTCAAATGG
GAGAACAAGGTGGAGAAGTTATTATGGGAGACGGATTACACAACGATCAC
GACGCCGTAGCTTCATCTGAAGTAACTGCTGAAGCTTAATTAATCCCTTT
TTCAAATTATGATATGATATCAAATATCTGTGTACGATAGATAGTAATAA
CTTTCCCATTCTTTCGATAATGCATGTTTATTGATTAAAAAGGTTTTTTT
CGAATGGCTTTGAAAATATAAGGTTATTGAAATTCAAAAGTTATATTATT
GTTTCTACAATAAAATATAATTGTGTTTAATTTATTATTGTTAAATGATT
ATCTATAAAAATGTGTTTTCAAAGTTTGTTTAGTTGATTCAATATAATTT
TCTAAATTGTGTTTTAGCAACCTTGAATTATTTGTTAAATTAATTGAGTT
AAAATAGTGTATTAATAACAATTGTTATTTAATGTAATATGGCTGATTCT
GAAGAAGAATTTGAAGAAAAATGCATTAAAATAGTAGTTGTTGGAGATGG
TTCTGCTGGAAAAACTTCGATTGTGAATCGTTTCGTGAATTCATTTTTTA
ATAAAGATTATAGACAAACTATTGGGATTGATTTTTTTAGTAATATTATA
AATTTACCAGGCATTAGTGTCAAAGTAAATTTATGGGATATCGGTGGTCA
AACACTTGGTGGTTCTTTACTGAACGGTTATATATACAGTGCAGATGGAA
TTTTATTTGTTTATGATATAACCAACAACAATAGTTTTGAAAACATTGTT
GATTGGTTAGAAACAGTCAAGAAAATATTTGAAAGTGAAAATAAAAAAAT
CCCATATATGGCTTTAGTTGGAAATAAAGTTGACCTTGAACATTCGAGAG
CGGTTAGAATTGATAAACATGAAAAATTTGCCCACGATTCTGGAATGTCT
AGTCATTTTGTTTCAGCCCGTACGGATGATTCGGTAAGTCTTTGTTTGTA
CAGTATTACCGCTGAAATTTGTGGGATTCGATTGACACAAGCAGAATTAA
ATCGCCAAAAAACAGTAGTTAAGGCGGGCATTCAAAGTTTTACTAATTCC
CGTTCTTCAGGATTGAAAGCGCCAGATTATCAAAGTGTTCTACCTAAAGT
CCCAATTAGTATCAACAGTGAGGGGATAAATAACAATAACTCAATTAGTG
ATCAAAATAATAGTCAAGCTTGTTCGATTTTATAGTCTACTTATGAAGAT
TTTTTTCTGACTTTTAAATTATTTTTTATTTTACACAGATTTACTGATAG
TTTGCTTGTGTATAATAAATTATTTATTTTTGTAAATTGAAGTCTTTATT
GATAATATTTACTGTAAAAGACAATTGTGTTGAAATGTGTATATTTCCTA
AAATTTTGATAAACGCG
back to top

protein sequence of SMED30015413-orf-1

>SMED30015413-orf-1 ID=SMED30015413-orf-1|Name=SMED30015413-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MADSEEEFEEKCIKIVVVGDGSAGKTSIVNRFVNSFFNKDYRQTIGIDFF
SNIINLPGISVKVNLWDIGGQTLGGSLLNGYIYSADGILFVYDITNNNSF
ENIVDWLETVKKIFESENKKIPYMALVGNKVDLEHSRAVRIDKHEKFAHD
SGMSSHFVSARTDDSVSLCLYSITAEICGIRLTQAELNRQKTVVKAGIQS
FTNSRSSGLKAPDYQSVLPKVPISINSEGINNNNSISDQNNSQACSIL*
back to top

protein sequence of SMED30015413-orf-2

>SMED30015413-orf-2 ID=SMED30015413-orf-2|Name=SMED30015413-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MSDDERRESISEEGGKSEAQIKMEADAKRRKEKADEEWKEYEEMRKSEKE
KEAEEILQLRERREQRKKERAAEEQRLAELRAVEEQKRRAEDEERQRRKR
EEEQKKREERELKNKEAEERSKTSKRPNFVINKRANDELVSDEPTKEEVA
KSKEQLEAERKATLEQRIQALAIDGFDLNKLKEKAKELHQNIYKLESEKY
DLEQQFQRQTLDLMELAERARQMNKGGKGQKVNVSQTDALPTKMSRAPPK
VVMYSQYERVKDPRSFVDRSTVFKGPLYSDYFTKIEPRFKVQMGEQGGEV
IMGDGLHNDHDAVASSEVTAEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0019003GDP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR038077Troponin_sf
IPR027707TNNT
IPR027417P-loop_NTPase
IPR001978Troponin
IPR001806Small_GTPase
Vocabulary: biological process
TermDefinition
GO:0006937regulation of muscle contraction
GO:0007264small GTPase mediated signal transduction
GO:1901998toxin transport
Vocabulary: cellular component
TermDefinition
GO:0005861troponin complex
GO:0005575cellular_component
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0016020membrane
GO:0035253ciliary rootlet
GO:0036064ciliary basal body
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 24..125
NoneNo IPR availableCOILSCoilCoilcoord: 146..166
NoneNo IPR availableCOILSCoilCoilcoord: 178..205
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 136..154
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..126
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 301..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..154
NoneNo IPR availablePANTHERPTHR11521:SF1TROPONIN T, SKELETAL MUSCLEcoord: 11..282
IPR038077Troponin domain superfamilyGENE3DG3DSA:1.20.5.350coord: 141..236
e-value: 6.9E-26
score: 92.4
IPR038077Troponin domain superfamilySUPERFAMILYSSF90250Troponin coil-coiled subunitscoord: 145..282
IPR001978TroponinPFAMPF00992Troponincoord: 145..238
e-value: 1.3E-9
score: 38.5
IPR027707Troponin TPANTHERPTHR11521TROPONIN Tcoord: 11..282