Diaphanous, putative

Overview
NameDiaphanous, putative
Smed IDSMED30015407
Length (bp)3096
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Diaphanous, putative (SMED30015407) t-SNE clustered cells

Violin plots show distribution of expression levels for Diaphanous, putative (SMED30015407) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Diaphanous, putative (SMED30015407) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Diaphanous, putative (SMED30015407) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015407

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30015407SMESG000036976.1 SMED30015407smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
X1 cellSMED30015407SMESG000036976.1 SmedASXL_014893SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30015407SMESG000036976.1 dd_Smed_v4_18017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30015407SMESG000036976.1 dd_Smed_v4_18017_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Diaphanous, putative vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 303.138 bits (775), Expect = 1.322e-85
Identity = 173/469 (36.89%), Postives = 281/469 (59.91%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRKKRL 2945
            P+ PFG+  K   KP+  +++ NW+K+  + L ++C W K+ +     NE+  +L   FS +    K   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++D+Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S +F  +LE+ L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N YP ++ F +E ++++KA++VS E +   + +MKK  +D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+ +Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+  L
Sbjct:  761 PVLPFGLTPKKLYKPEVQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQDNL 1223          

HSP 2 Score: 116.701 bits (291), Expect = 8.582e-29
Identity = 85/306 (27.78%), Postives = 158/306 (51.63%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E+++  +  F  +  +ED Y+ K  L+ +    D    V+Q+L  T+  +  +    SIL+HL++++ D   R   ++LI + IS+++LH +G   DP       Q++   L D + +K           EL++K +  L  +HE +V++  +E+
Sbjct:  218 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGT---TIALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVFD-EQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECISQIVLHKNGA--DPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLDSELTARHELQVEMKKMES 507          

HSP 3 Score: 32.3426 bits (72), Expect = 8.582e-29
Identity = 27/108 (25.00%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPS---NYINTLVDIVERQWAIE--KIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ   +S+   S   +  + ++ I E +  +    ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   86 DVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 193          
BLAST of Diaphanous, putative vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 302.753 bits (774), Expect = 1.514e-85
Identity = 172/466 (36.91%), Postives = 280/466 (60.09%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K+  + L ++C W K+ +     NE+  +L   FS +    K   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++D+Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S +F  +LE+ L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N YP ++ F +E ++++KA++VS E +   + +MKK  +D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+ +Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  752 PVLPFGLTPKKLYKPEVQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1211          

HSP 2 Score: 117.472 bits (293), Expect = 5.922e-29
Identity = 85/306 (27.78%), Postives = 158/306 (51.63%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E+++  +  F  +  +ED Y+ K  L+ +    D    V+Q+L  T+  +  +    SIL+HL++++ D   R   ++LI + IS+++LH +G   DP       Q++   L D + +K           EL++K +  L  +HE +V++  +E+
Sbjct:  209 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGT---TIALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVFD-EQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECISQIVLHKNGA--DPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLDSELTARHELQVEMKKMES 498          

HSP 3 Score: 32.3426 bits (72), Expect = 5.922e-29
Identity = 27/108 (25.00%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPS---NYINTLVDIVERQWAIE--KIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ   +S+   S   +  + ++ I E +  +    ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   77 DVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 184          
BLAST of Diaphanous, putative vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 303.138 bits (775), Expect = 1.566e-85
Identity = 172/466 (36.91%), Postives = 280/466 (60.09%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K+  + L ++C W K+ +     NE+  +L   FS +    K   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++D+Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S +F  +LE+ L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N YP ++ F +E ++++KA++VS E +   + +MKK  +D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+ +Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  761 PVLPFGLTPKKLYKPEVQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1220          

HSP 2 Score: 117.472 bits (293), Expect = 5.777e-29
Identity = 85/306 (27.78%), Postives = 158/306 (51.63%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E+++  +  F  +  +ED Y+ K  L+ +    D    V+Q+L  T+  +  +    SIL+HL++++ D   R   ++LI + IS+++LH +G   DP       Q++   L D + +K           EL++K +  L  +HE +V++  +E+
Sbjct:  218 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGT---TIALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVFD-EQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECISQIVLHKNGA--DPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLDSELTARHELQVEMKKMES 507          

HSP 3 Score: 31.9574 bits (71), Expect = 5.777e-29
Identity = 27/108 (25.00%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPS---NYINTLVDIVERQWAIE--KIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ   +S+   S   +  + ++ I E +  +    ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   86 DVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 193          
BLAST of Diaphanous, putative vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 300.442 bits (768), Expect = 9.357e-85
Identity = 171/466 (36.70%), Postives = 280/466 (60.09%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K+  + L ++C W K+ +     NE+  +L   FS +    +   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++D+Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S +F  +LE+ L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N YP ++ F +E ++++KA++VS E +   + +MKK  +D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+ +Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  717 PVLPFGLTPKKLYKPEVQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKNSQAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTIFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1176          

HSP 2 Score: 116.701 bits (291), Expect = 8.872e-29
Identity = 85/306 (27.78%), Postives = 158/306 (51.63%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E+++  +  F  +  +ED Y+ K  L+ +    D    V+Q+L  T+  +  +    SIL+HL++++ D   R   ++LI + IS+++LH +G   DP       Q++   L D + +K           EL++K +  L  +HE +V++  +E+
Sbjct:  174 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGT---TIALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVFD-EQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECISQIVLHKNGA--DPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLDSELTARHELQVEMKKMES 463          

HSP 3 Score: 31.9574 bits (71), Expect = 8.872e-29
Identity = 27/108 (25.00%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPS---NYINTLVDIVERQWAIE--KIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ   +S+   S   +  + ++ I E +  +    ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   42 DVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 149          
BLAST of Diaphanous, putative vs. Ensembl Human
Match: DIAPH1 (diaphanous related formin 1 [Source:HGNC Symbol;Acc:HGNC:2876])

HSP 1 Score: 298.901 bits (764), Expect = 4.533e-84
Identity = 171/466 (36.70%), Postives = 279/466 (59.87%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K+  + L ++C W K+ +     NE+  +L   FS +        D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++D+Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S +F  +LE+ L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N YP ++ F +E ++++KA++VS E +   + +MKK  +D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+ +Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  761 PVLPFGLTPKKLYKPEVQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTLLAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1220          

HSP 2 Score: 117.087 bits (292), Expect = 6.983e-29
Identity = 85/306 (27.78%), Postives = 158/306 (51.63%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E+++  +  F  +  +ED Y+ K  L+ +    D    V+Q+L  T+  +  +    SIL+HL++++ D   R   ++LI + IS+++LH +G   DP       Q++   L D + +K           EL++K +  L  +HE +V++  +E+
Sbjct:  218 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGT---TIALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVFD-EQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECISQIVLHKNGA--DPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLDSELTARHELQVEMKKMES 507          

HSP 3 Score: 31.9574 bits (71), Expect = 6.983e-29
Identity = 27/108 (25.00%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPS---NYINTLVDIVERQWAIE--KIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ   +S+   S   +  + ++ I E +  +    ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   86 DVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 193          
BLAST of Diaphanous, putative vs. Ensembl Celegans
Match: cyk-1 (CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q7JP75])

HSP 1 Score: 193.356 bits (490), Expect = 7.257e-50
Identity = 132/437 (30.21%), Postives = 232/437 (53.09%), Query Frame = 3
Query: 1566 LEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLD--RNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVL-DSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRM--QDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSK-HNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFT-NEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAR-EEQLRREMEKTERHTRQCKATQ 2852
            + P+ P  +  K   K  G M+K  W    I   D  R   W   N+ ++ ++ M   L  KF+T+       + ++ +L       KKVK  +V+ D K  Q L IL GS K+   E+K  ILE++E +LT   +E L  ++P +++L    R   +  +E + E EQF   L  I+ L  RL+  LFKM+FSE ++++KPA+    +A  E+R S  F   L+L+L  GNFM  ++K ++   AF +  L +L+DTKD  N  TL+  ++ +++   P    F   +F +  ++++V+ + I  T+   +     LE  LK YK Q + D +   M+ F     ++ + +S M   +++ +  + KY +F+ +KYPMEEFF DI+ F + +  A KE++   + E +R++A  E Q R++++++++  +  +  Q
Sbjct:  796 MAPVIPDYLPPKKVPKVDGPMRKFPWGAHTINPRDIPRESFWVGTNEEQLTSDRMFDRLRTKFATKP------AANSGTLGGVLNSKKKVKTAQVIHDDKLLQKLGILQGSIKMSHSELKLAILEVNEKVLTVGFLEQLRSAMPVEKELIDKLRAVNKAQFEEMPEGEQFVTRLLQIQGLPLRLDLVLFKMRFSEVLNELKPAMSSVMEACEEVRASEGFRTFLKLVLATGNFMGGATKNYSSAYAFDMRMLTRLVDTKDVDNRHTLLHHLIEEMKRIDPRRARFALTDFHHCIESSRVNADEIRKTVQLTENNIKKLENCLKVYKIQGERDLFDEKMRPFHEKAVKEFSTVSSMCGKMKNDWESLVKYYAFNDKKYPMEEFFADIRTFSEQYSNAWKELD--AEAEAKRKEAEFETQKRKQLQQSQQERKPLQERQ 1224          
BLAST of Diaphanous, putative vs. Ensembl Celegans
Match: cyk-1 (CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q7JP75])

HSP 1 Score: 193.356 bits (490), Expect = 7.462e-50
Identity = 132/437 (30.21%), Postives = 232/437 (53.09%), Query Frame = 3
Query: 1566 LEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLD--RNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVL-DSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRM--QDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSK-HNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFT-NEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAR-EEQLRREMEKTERHTRQCKATQ 2852
            + P+ P  +  K   K  G M+K  W    I   D  R   W   N+ ++ ++ M   L  KF+T+       + ++ +L       KKVK  +V+ D K  Q L IL GS K+   E+K  ILE++E +LT   +E L  ++P +++L    R   +  +E + E EQF   L  I+ L  RL+  LFKM+FSE ++++KPA+    +A  E+R S  F   L+L+L  GNFM  ++K ++   AF +  L +L+DTKD  N  TL+  ++ +++   P    F   +F +  ++++V+ + I  T+   +     LE  LK YK Q + D +   M+ F     ++ + +S M   +++ +  + KY +F+ +KYPMEEFF DI+ F + +  A KE++   + E +R++A  E Q R++++++++  +  +  Q
Sbjct:  796 MAPVIPDYLPPKKVPKVDGPMRKFPWGAHTINPRDIPRESFWVGTNEEQLTSDRMFDRLRTKFATKP------AANSGTLGGVLNSKKKVKTAQVIHDDKLLQKLGILQGSIKMSHSELKLAILEVNEKVLTVGFLEQLRSAMPVEKELIDKLRAVNKAQFEEMPEGEQFVTRLLQIQGLPLRLDLVLFKMRFSEVLNELKPAMSSVMEACEEVRASEGFRTFLKLVLATGNFMGGATKNYSSAYAFDMRMLTRLVDTKDVDNRHTLLHHLIEEMKRIDPRRARFALTDFHHCIESSRVNADEIRKTVQLTENNIKKLENCLKVYKIQGERDLFDEKMRPFHEKAVKEFSTVSSMCGKMKNDWESLVKYYAFNDKKYPMEEFFADIRTFSEQYSNAWKELD--AEAEAKRKEAEFETQKRKQLQQSQQERKPLQERQ 1224          
BLAST of Diaphanous, putative vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 129.028 bits (323), Expect = 4.634e-30
Identity = 111/458 (24.24%), Postives = 223/458 (48.69%), Query Frame = 3
Query: 1596 IKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKE--FKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGL-LTQTNVENLLKSLPPQEQLAKLSRMQDDYEN---LNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDN-QNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQS----------DNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQ-KYPM-EEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAF 2912
            +K+  +P G MK  NW ++ +    R  VW  I+D ++     L EL+  F+  +   KD  +D  +L  Y T+ ++ ++    V+D +  QN  I+    K+  +EIK+ ++ +DE   L +  +E +LK +P +E+L +++     + +   L  A+++   +S+I     RL        F +R+  + P I    +A +  + +  F +IL +IL  GN++N   ++     F +  + KL D K+  +N+  L+ F+VN +  KYP L  F  +F+ + +AA+ S    ++ I  +++    + +EL   +  +          +ND + LV + F+     +   + +M + +++ F + AKY  +      P+ EEFF  I  F + F + ++++   ++ E   +K + + + R     +  TR+ +  +E D    + L+  L SG+ F
Sbjct:  523 LKNVPEPPGNMKTLNWQRLTLDKT-RGTVWDGIDDEKIYKQLDLTELSGCFAASSSH-KD--EDTDTL--YGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQLWAEVEEE---EKIKRQTIARSFLAKKSTTRRKENHKERD---FEQLISALQSGDIF 968          
BLAST of Diaphanous, putative vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 129.028 bits (323), Expect = 4.634e-30
Identity = 111/458 (24.24%), Postives = 223/458 (48.69%), Query Frame = 3
Query: 1596 IKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKE--FKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGL-LTQTNVENLLKSLPPQEQLAKLSRMQDDYEN---LNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDN-QNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQS----------DNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQ-KYPM-EEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAF 2912
            +K+  +P G MK  NW ++ +    R  VW  I+D ++     L EL+  F+  +   KD  +D  +L  Y T+ ++ ++    V+D +  QN  I+    K+  +EIK+ ++ +DE   L +  +E +LK +P +E+L +++     + +   L  A+++   +S+I     RL        F +R+  + P I    +A +  + +  F +IL +IL  GN++N   ++     F +  + KL D K+  +N+  L+ F+VN +  KYP L  F  +F+ + +AA+ S    ++ I  +++    + +EL   +  +          +ND + LV + F+     +   + +M + +++ F + AKY  +      P+ EEFF  I  F + F + ++++   ++ E   +K + + + R     +  TR+ +  +E D    + L+  L SG+ F
Sbjct:  523 LKNVPEPPGNMKTLNWQRLTLDKT-RGTVWDGIDDEKIYKQLDLTELSGCFAASSSH-KD--EDTDTL--YGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQLWAEVEEE---EKIKRQTIARSFLAKKSTTRRKENHKERD---FEQLISALQSGDIF 968          
BLAST of Diaphanous, putative vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 127.872 bits (320), Expect = 7.872e-30
Identity = 110/453 (24.28%), Postives = 220/453 (48.57%), Query Frame = 3
Query: 1611 KPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKE--FKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGL-LTQTNVENLLKSLPPQEQLAKLSRMQDDYEN---LNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDN-QNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQS----------DNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQ-KYPM-EEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAF 2912
            +P G MK  NW ++ +    R  VW  I+D ++     L EL+  F+  +   KD  +D  +L  Y T+ ++ ++    V+D +  QN  I+    K+  +EIK+ ++ +DE   L +  +E +LK +P +E+L +++     + +   L  A+++   +S+I     RL        F +R+  + P I    +A +  + +  F +IL +IL  GN++N   ++     F +  + KL D K+  +N+  L+ F+VN +  KYP L  F  +F+ + +AA+ S    ++ I  +++    + +EL   +  +          +ND + LV + F+     +   + +M + +++ F + AKY  +      P+ EEFF  I  F + F + ++++   ++ E   +K + + + R     +  TR+ +  +E D    + L+  L SG+ F
Sbjct:  359 EPPGNMKTLNWQRLTLDK-TRGTVWDGIDDEKIYKQLDLTELSGCFAASSSH-KD--EDTDTL--YGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQLWAEVEEE---EKIKRQTIARSFLAKKSTTRRKENHKERD---FEQLISALQSGDIF 799          
BLAST of Diaphanous, putative vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0081410)

HSP 1 Score: 279.641 bits (714), Expect = 1.859e-78
Identity = 169/484 (34.92%), Postives = 276/484 (57.02%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAI-LSGSFK-VPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYK-QQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKA---NKEIEIAIQNEHRRQKAREEQLRREMEKTERHTR----QCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKK-TENIVVINRSRSR 2990
            P+ P G++ K     K  MK+ANW  +    +     W K  + ++  ++ L EL  KFS++  +     +   +++  +TL KK  + +VLDSK+ QNLAI L GS K +  E+IK  +L  D  +L+   ++ L++ LPP E L +L  ++   E L   EQF  T+  IK L  RL++  FK+ +++ + DIKP IV  T A  EIR+S  F KILELIL+ GN+MN+ SK+     F I++L KL +TKD  N+ TL+ ++ + V  K+P  +NF ++ S+++KA++V+ + I   + +M     +LE +L++ K  Q D+D +  VM +F     +Q+ ++ +M   ++  ++++++Y +FD  KY MEEFF DIK FKD FQ A   N  +   ++ + R Q+ARE+  R + E+ +R           TQE    V+D+LL  L +G+AFG R    +++     E    ++RSRSR
Sbjct:  593 PVLPHGLKPKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVK----KEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEG---VMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSR 1069          

HSP 2 Score: 86.2705 bits (212), Expect = 4.302e-24
Identity = 79/281 (28.11%), Postives = 137/281 (48.75%), Query Frame = 3
Query:  423 GLNKLVIVLSHYIDNA---EISLHCLKCLRAFGNCGYGLLTLINNKE--ALLYVSLCLNAQYPNLMCLAIELLTLFTF-YSFESHANVMEALY-LGAQMQNHIQRFIPIINGLDVG-IHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNI----DDENIKQYILAF-QTDTDDEDEYNNKIELEVLLQNRDAV--YQLLNRTLCQTNCDSSLTSILKHLVIIKDT-PIRYNLFRLINDVISELILHSDGMCLDP 1217
            G+  +  +L+   +NA   +I    ++CL+A  N  +GL  ++N  +   +L ++  L+ + P  MC A++LL  F   Y    +  V+ A+  + A      +RF PI++ L      + + +L    L FIN + N     T T    DL +R+HLR E +  GL   LD  + I    ++EN++Q+   F +   DD +E+  + +  V     DA   + +L   +  T  +    SIL+HL+ I+D    R   ++LI + IS+++ H  G C DP
Sbjct:  164 GIGTIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQQDPKRDLACHSLIFINTLTN-----TPT----DLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQQHFKIFNEIREDDFEEFVQRFD-NVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECISQIVFHK-GYC-DP 432          

HSP 3 Score: 46.2098 bits (108), Expect = 4.302e-24
Identity = 31/99 (31.31%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  130 MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLS---QIHSSSETSPSNYINTLVDIVE----RQWAIEKIIVKLDSLRVYLNSSPLSRVKEL 405
            ++ +E +  F + +++MNI  DKR PLL +S E+++K++    +  +S E S ++     +D VE     + +  K+   ++SLRV L S+P+S +KE 
Sbjct:   62 LSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEKPIDYVEYLQNGEHSTHKVYQCVESLRVALTSNPISWIKEF 160          
BLAST of Diaphanous, putative vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0335145)

HSP 1 Score: 279.641 bits (714), Expect = 1.859e-78
Identity = 169/484 (34.92%), Postives = 276/484 (57.02%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAI-LSGSFK-VPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYK-QQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKA---NKEIEIAIQNEHRRQKAREEQLRREMEKTERHTR----QCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKK-TENIVVINRSRSR 2990
            P+ P G++ K     K  MK+ANW  +    +     W K  + ++  ++ L EL  KFS++  +     +   +++  +TL KK  + +VLDSK+ QNLAI L GS K +  E+IK  +L  D  +L+   ++ L++ LPP E L +L  ++   E L   EQF  T+  IK L  RL++  FK+ +++ + DIKP IV  T A  EIR+S  F KILELIL+ GN+MN+ SK+     F I++L KL +TKD  N+ TL+ ++ + V  K+P  +NF ++ S+++KA++V+ + I   + +M     +LE +L++ K  Q D+D +  VM +F     +Q+ ++ +M   ++  ++++++Y +FD  KY MEEFF DIK FKD FQ A   N  +   ++ + R Q+ARE+  R + E+ +R           TQE    V+D+LL  L +G+AFG R    +++     E    ++RSRSR
Sbjct:  593 PVLPHGLKPKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVK----KEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEG---VMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSR 1069          

HSP 2 Score: 86.2705 bits (212), Expect = 4.302e-24
Identity = 79/281 (28.11%), Postives = 137/281 (48.75%), Query Frame = 3
Query:  423 GLNKLVIVLSHYIDNA---EISLHCLKCLRAFGNCGYGLLTLINNKE--ALLYVSLCLNAQYPNLMCLAIELLTLFTF-YSFESHANVMEALY-LGAQMQNHIQRFIPIINGLDVG-IHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNI----DDENIKQYILAF-QTDTDDEDEYNNKIELEVLLQNRDAV--YQLLNRTLCQTNCDSSLTSILKHLVIIKDT-PIRYNLFRLINDVISELILHSDGMCLDP 1217
            G+  +  +L+   +NA   +I    ++CL+A  N  +GL  ++N  +   +L ++  L+ + P  MC A++LL  F   Y    +  V+ A+  + A      +RF PI++ L      + + +L    L FIN + N     T T    DL +R+HLR E +  GL   LD  + I    ++EN++Q+   F +   DD +E+  + +  V     DA   + +L   +  T  +    SIL+HL+ I+D    R   ++LI + IS+++ H  G C DP
Sbjct:  164 GIGTIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQQDPKRDLACHSLIFINTLTN-----TPT----DLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQQHFKIFNEIREDDFEEFVQRFD-NVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECISQIVFHK-GYC-DP 432          

HSP 3 Score: 46.2098 bits (108), Expect = 4.302e-24
Identity = 31/99 (31.31%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  130 MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLS---QIHSSSETSPSNYINTLVDIVE----RQWAIEKIIVKLDSLRVYLNSSPLSRVKEL 405
            ++ +E +  F + +++MNI  DKR PLL +S E+++K++    +  +S E S ++     +D VE     + +  K+   ++SLRV L S+P+S +KE 
Sbjct:   62 LSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEKPIDYVEYLQNGEHSTHKVYQCVESLRVALTSNPISWIKEF 160          
BLAST of Diaphanous, putative vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0081411)

HSP 1 Score: 279.641 bits (714), Expect = 1.859e-78
Identity = 169/484 (34.92%), Postives = 276/484 (57.02%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAI-LSGSFK-VPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYK-QQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKA---NKEIEIAIQNEHRRQKAREEQLRREMEKTERHTR----QCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKK-TENIVVINRSRSR 2990
            P+ P G++ K     K  MK+ANW  +    +     W K  + ++  ++ L EL  KFS++  +     +   +++  +TL KK  + +VLDSK+ QNLAI L GS K +  E+IK  +L  D  +L+   ++ L++ LPP E L +L  ++   E L   EQF  T+  IK L  RL++  FK+ +++ + DIKP IV  T A  EIR+S  F KILELIL+ GN+MN+ SK+     F I++L KL +TKD  N+ TL+ ++ + V  K+P  +NF ++ S+++KA++V+ + I   + +M     +LE +L++ K  Q D+D +  VM +F     +Q+ ++ +M   ++  ++++++Y +FD  KY MEEFF DIK FKD FQ A   N  +   ++ + R Q+ARE+  R + E+ +R           TQE    V+D+LL  L +G+AFG R    +++     E    ++RSRSR
Sbjct:  593 PVLPHGLKPKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVK----KEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEG---VMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSR 1069          

HSP 2 Score: 86.2705 bits (212), Expect = 4.302e-24
Identity = 79/281 (28.11%), Postives = 137/281 (48.75%), Query Frame = 3
Query:  423 GLNKLVIVLSHYIDNA---EISLHCLKCLRAFGNCGYGLLTLINNKE--ALLYVSLCLNAQYPNLMCLAIELLTLFTF-YSFESHANVMEALY-LGAQMQNHIQRFIPIINGLDVG-IHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNI----DDENIKQYILAF-QTDTDDEDEYNNKIELEVLLQNRDAV--YQLLNRTLCQTNCDSSLTSILKHLVIIKDT-PIRYNLFRLINDVISELILHSDGMCLDP 1217
            G+  +  +L+   +NA   +I    ++CL+A  N  +GL  ++N  +   +L ++  L+ + P  MC A++LL  F   Y    +  V+ A+  + A      +RF PI++ L      + + +L    L FIN + N     T T    DL +R+HLR E +  GL   LD  + I    ++EN++Q+   F +   DD +E+  + +  V     DA   + +L   +  T  +    SIL+HL+ I+D    R   ++LI + IS+++ H  G C DP
Sbjct:  164 GIGTIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQQDPKRDLACHSLIFINTLTN-----TPT----DLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQQHFKIFNEIREDDFEEFVQRFD-NVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECISQIVFHK-GYC-DP 432          

HSP 3 Score: 46.2098 bits (108), Expect = 4.302e-24
Identity = 31/99 (31.31%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  130 MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLS---QIHSSSETSPSNYINTLVDIVE----RQWAIEKIIVKLDSLRVYLNSSPLSRVKEL 405
            ++ +E +  F + +++MNI  DKR PLL +S E+++K++    +  +S E S ++     +D VE     + +  K+   ++SLRV L S+P+S +KE 
Sbjct:   62 LSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEKPIDYVEYLQNGEHSTHKVYQCVESLRVALTSNPISWIKEF 160          
BLAST of Diaphanous, putative vs. Ensembl Fly
Match: dia (gene:FBgn0011202 transcript:FBtr0305961)

HSP 1 Score: 279.641 bits (714), Expect = 1.956e-78
Identity = 169/484 (34.92%), Postives = 276/484 (57.02%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAI-LSGSFK-VPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYK-QQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKA---NKEIEIAIQNEHRRQKAREEQLRREMEKTERHTR----QCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKK-TENIVVINRSRSR 2990
            P+ P G++ K     K  MK+ANW  +    +     W K  + ++  ++ L EL  KFS++  +     +   +++  +TL KK  + +VLDSK+ QNLAI L GS K +  E+IK  +L  D  +L+   ++ L++ LPP E L +L  ++   E L   EQF  T+  IK L  RL++  FK+ +++ + DIKP IV  T A  EIR+S  F KILELIL+ GN+MN+ SK+     F I++L KL +TKD  N+ TL+ ++ + V  K+P  +NF ++ S+++KA++V+ + I   + +M     +LE +L++ K  Q D+D +  VM +F     +Q+ ++ +M   ++  ++++++Y +FD  KY MEEFF DIK FKD FQ A   N  +   ++ + R Q+ARE+  R + E+ +R           TQE    V+D+LL  L +G+AFG R    +++     E    ++RSRSR
Sbjct:  600 PVLPHGLKPKKKWDVKNPMKRANWKAIVPAKMSDKAFWVKCQEDKLAQDDFLAELAVKFSSKPVK----KEQKDAVDKPTTLTKKNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNTKDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFADIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQTQEG---VMDSLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSR 1076          

HSP 2 Score: 86.2705 bits (212), Expect = 4.302e-24
Identity = 79/281 (28.11%), Postives = 137/281 (48.75%), Query Frame = 3
Query:  423 GLNKLVIVLSHYIDNA---EISLHCLKCLRAFGNCGYGLLTLINNKE--ALLYVSLCLNAQYPNLMCLAIELLTLFTF-YSFESHANVMEALY-LGAQMQNHIQRFIPIINGLDVG-IHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNI----DDENIKQYILAF-QTDTDDEDEYNNKIELEVLLQNRDAV--YQLLNRTLCQTNCDSSLTSILKHLVIIKDT-PIRYNLFRLINDVISELILHSDGMCLDP 1217
            G+  +  +L+   +NA   +I    ++CL+A  N  +GL  ++N  +   +L ++  L+ + P  MC A++LL  F   Y    +  V+ A+  + A      +RF PI++ L      + + +L    L FIN + N     T T    DL +R+HLR E +  GL   LD  + I    ++EN++Q+   F +   DD +E+  + +  V     DA   + +L   +  T  +    SIL+HL+ I+D    R   ++LI + IS+++ H  G C DP
Sbjct:  171 GIGTIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQQDPKRDLACHSLIFINTLTN-----TPT----DLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQQHFKIFNEIREDDFEEFVQRFD-NVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDDFYFRPAYYQLIEECISQIVFHK-GYC-DP 439          

HSP 3 Score: 46.2098 bits (108), Expect = 4.302e-24
Identity = 31/99 (31.31%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  130 MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLS---QIHSSSETSPSNYINTLVDIVE----RQWAIEKIIVKLDSLRVYLNSSPLSRVKEL 405
            ++ +E +  F + +++MNI  DKR PLL +S E+++K++    +  +S E S ++     +D VE     + +  K+   ++SLRV L S+P+S +KE 
Sbjct:   69 LSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGKNSLERSANSRFEKPIDYVEYLQNGEHSTHKVYQCVESLRVALTSNPISWIKEF 167          
BLAST of Diaphanous, putative vs. Ensembl Fly
Match: DAAM (gene:FBgn0025641 transcript:FBtr0342731)

HSP 1 Score: 142.895 bits (359), Expect = 3.623e-34
Identity = 130/491 (26.48%), Postives = 222/491 (45.21%), Query Frame = 3
Query: 1611 KPKGLMKKANWNKV-DIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKE--FKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTN-VENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEG-TLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQS---DNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKA---NKEIEIAIQNEHRRQKAREEQLRREME---KTERHTRQCK----------------ATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSRR 2993
            +P   +K  NW+K+ D KL  +  VW ++++S++  N  L  +++ FS  A++   VS  + S        K  K+    V+D +  QN  IL    K+   EI + IL +D     Q + VE LLK  P  E+ A L    +D E+L  A++F   +S I H   RL S  +K +F   I+D+ P I    +A  E+  S    K+LEL+L  GN+MN  ++ N +  F +  L +L DTK +  +G TL+ ++V  +  K+  L+   ++  ++ +A+KVS   +   I  ++    D+ RE++ ++        D +  VM+EF    + +   + +  + +++ F    +    D      +EFF     F   F +A   N+      + E +R K   E  +R +E   KT   T   +                A   D+K   D+L+  L +G+ FG             E++    RSR  R
Sbjct:  645 QPTNPLKSFNWSKLPDAKL--QGTVWSELDESKLYNNMELESIDKLFS--AYQKNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLSKLKMSDMEISKAILSMDSNEQLQLDMVEQLLKFTPSAEERALLDEHSEDIESLARADRFLYEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNRGARGNAS-GFRLASLNRLADTKSSAAKGTTLLHYLVQVIERKFKDLLKLEDDIPHVREASKVSLGEMDKDIQMLRTGLADVAREIEFHRSSGPAQQGDRFLPVMREFHAQASVRFAELEDKFQDMKTRFDRAVRLFGEDGSVLQPDEFFGIFDSFLAAFAEARHDNESFRRRQEEEEKRAKQEAELKKRTIERKNKTGLMTSVARNLGLKSGSSNGDPDSPAKGGDNKGEFDDLISALRTGDVFG-------------EDMAKFKRSRKAR 1117          

HSP 2 Score: 56.9954 bits (136), Expect = 9.300e-8
Identity = 46/212 (21.70%), Postives = 94/212 (44.34%), Query Frame = 3
Query:  459 IDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSN--LLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQ-TDTDDEDEYNNKIELE-VLLQNRDAVYQLLNRTLCQTNC 1082
            + N+ +    + C++A  N   G   ++ +  A+  ++  L A        A+E+L          H  V++A+           RF  I+N LD   +  + N  L    + F+N ++N            +L +R+HLR EF+  G+   +D L   ++E + +++  F+    +DE E+  + + E V  ++  ++++LL R L  +  
Sbjct:  178 VANSPLHTSLIGCIKALMNNSMGRAHVLAHPTAIDTIARSLAADNIRTKIAALEILGAVCLVP-GGHRKVLQAMLHFQVFATERTRFQSIVNDLDRSTYAYRDNVNLKTALMSFVNAVLN------YGPGQENLEFRLHLRYEFLMLGIQPVIDKLRTHENETLDRHLDFFEMVRAEDEKEFARRFKEEHVDTKSAGSMFELLRRKLSHSPA 382          
BLAST of Diaphanous, putative vs. Ensembl Zebrafish
Match: diaph3 (diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-GENE-040801-144])

HSP 1 Score: 280.411 bits (716), Expect = 1.279e-81
Identity = 172/505 (34.06%), Postives = 279/505 (55.25%), Query Frame = 3
Query: 1575 IFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLV-MQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA-------TQEDDKKVLDNLLVTLNSGNAFGNRK----------------DPRKKRLKKT--ENI-VVINRSRSRRDFDKN 3008
            I PFG++ K   KP   MK+ NW+K+  + L  NC W    +      ++L  L+  F T+    ++  D    L     + K+VKE KVLD K  QNL+I  GSF++P EEI+R ILE+DE  LT+  ++NL+K LP QEQL  L + + +Y NL+E EQFG  +S++K L  RLNS LFK++F E+++ ++P I+    A +E+R S +F ++LELIL+ GNFMNA S++ Q+  ++++ L KL DTK    + TL+ F+      K+P ++ F ++  ++D+A++VS E +  ++ +M+K    LE++L  +    D  + F   M  F     +Q   +  M+  + + +  M +Y + D +K  +EE F D+  F+  F +A KE    I+ +   +K R+ ++ +E  + E+  RQ K        T+ D   V+D LL  L SG AF +R+                 P++  LK    EN+   + RSRSR++ + N
Sbjct:  112 ILPFGLKPKKEFKPDTSMKRLNWSKISPQELSENCFWVIAKEDRYENEDLLTRLSVTFGTQRVARREEED----LEEKKCIKKRVKELKVLDPKIAQNLSIFLGSFRMPYEEIRRMILEVDEDQLTEPMIQNLVKHLPEQEQLNALVKYKSEYANLSEPEQFGVVMSSVKRLRPRLNSILFKLQFEEQVNHLRPDIMAVNAACDEVRKSKSFSRLLELILLTGNFMNAGSRNAQSFGYNLSSLCKLKDTKSTDQKSTLLHFLAEICEEKFPEVLKFVDDLQHVDRASRVSAENLEKSLKQMEKHLLQLEKDLDTFSSTDDQQDLFHSKMASFSTQARDQYQKLVVMHSNMVTLYLNMLEYFAIDPKKTSVEELFTDLSNFRAMFMQAMKE---NIRRKEAEEKQRKARIAKEKAEREKKERQMKKKRLLEVNTENDQTGVMDCLLEALQSGAAFRDRRKRAPRPRGEPTQTFSPSPQRPVLKDCHHENMKASLQRSRSRQNINLN 609          
BLAST of Diaphanous, putative vs. Ensembl Zebrafish
Match: diaph3 (diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-GENE-040801-144])

HSP 1 Score: 277.33 bits (708), Expect = 1.233e-77
Identity = 162/465 (34.84%), Postives = 265/465 (56.99%), Query Frame = 3
Query: 1575 IFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLV-MQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA-------TQEDDKKVLDNLLVTLNSGNAFGNRKD--PRKK 2939
            I PFG++ K   KP   MK+ NW+K+  + L  NC W    +      ++L  L+  F T+    ++  D    L     + K+VKE KVLD K  QNL+I  GSF++P EEI+R ILE+DE  LT+  ++NL+K LP QEQL  L + + +Y NL+E EQFG  +S++K L  RLNS LFK++F E+++ ++P I+    A +E+R S +F ++LELIL+ GNFMNA S++ Q+  ++++ L KL DTK    + TL+ F+      K+P ++ F ++  ++D+A++VS E +  ++ +M+K    LE++L  +    D  + F   M    ++  +Q   +  M+  + + +  M +Y + D +K  +EE F D+  F+  F +A KE    I+ +   +K R+ ++ +E  + E+  RQ K        T+ D   V+D LL  L SG AF +R+   PR +
Sbjct:  595 ILPFGLKPKKEFKPDTSMKRLNWSKISPQELSENCFWVIAKEDRYENEDLLTRLSVTFGTQRVARREEED----LEEKKCIKKRVKELKVLDPKIAQNLSIFLGSFRMPYEEIRRMILEVDEDQLTEPMIQNLVKHLPEQEQLNALVKYKSEYANLSEPEQFGVVMSSVKRLRPRLNSILFKLQFEEQVNHLRPDIMAVNAACDEVRKSKSFSRLLELILLTGNFMNAGSRNAQSFGYNLSSLCKLKDTKSTDQKSTLLHFLAEICEEKFPEVLKFVDDLQHVDRASRVSAENLEKSLKQMEKHLLQLEKDLDTFSSTDDQQDLFHSKMAISFLHARDQYQKLVVMHSNMVTLYLNMLEYFAIDPKKTSVEELFTDLSNFRAMFMQAMKE---NIRRKEAEEKQRKARIAKEKAEREKKERQMKKKRLLEVNTENDQTGVMDCLLEALQSGAAFRDRRKRAPRPR 1052          

HSP 2 Score: 103.99 bits (258), Expect = 1.180e-29
Identity = 80/306 (26.14%), Postives = 153/306 (50.00%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFE-SHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDT-DDEDEYNNKIELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN-----QLDGYNLTDV-FEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKM 1379
            ++CL+AF N  YGL  ++  + +L  ++  ++   P +M   ++LL+       E +   V+EA+    + +  + RF PI+ GL V    R   L + C+Q IN +V          S  +L +R+H+R EF+ CGL   L SLS + ++ +   +  F+    +D  E+++++E   +  +   V+ +L  ++  +  +S   SIL+HL++++ D   R   F++I + +S+++LH  G   DP         +D  +L +V  EK     +    +EL +K ++    + E E +L   E K+
Sbjct:  222 IQCLKAFMNNKYGLERILGEETSLALLAQAIDPCQPAMMTDVVKLLSAICIVGEENTLEKVLEAITTATEGRG-VARFNPIVQGLSV----RSVQLQVACMQLINALVT---------SPDELDFRLHIRNEFMRCGLREILPSLSVVKNDALDIQLKVFEEHKEEDMIEFSHRLEDIRMHTDIGDVFNVLYCSVKDSAAESYFLSILQHLLLVRNDYFTRPQYFKIIEECVSQIVLHRSGT--DPDFGYRKRLDVDFSHLLEVCVEKARTEEFELRASELAQKLDEEFLGRQEAEAQLLKREEKI 511          

HSP 3 Score: 47.3654 bits (111), Expect = 1.180e-29
Identity = 31/99 (31.31%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  133 TESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ----------IHSSSETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVK 399
            +E E   +F K M++MN+  +K+ PL  + +  KR+++ Q          + SSS+ SP  +++ L    +     E++   LDSLRV L S+P+S V+
Sbjct:   93 SEKEILALFEKMMEDMNLNEEKKAPLREKDLNTKREMVLQYVVTAAKTGSLRSSSQISPQEFLSEL----KSGATDERLFACLDSLRVSLTSNPVSWVQ 187          
BLAST of Diaphanous, putative vs. Ensembl Zebrafish
Match: diaph2 (diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-GENE-090115-1])

HSP 1 Score: 270.396 bits (690), Expect = 2.591e-75
Identity = 150/454 (33.04%), Postives = 270/454 (59.47%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA----TQEDDKKVLDNLLVTLNSGNAFGNRK 2924
             P+G+  K   KP  +MK+ NW+K+  + +  NC W K+ +      +M  EL+  FS+++       DD       +   KK KE ++LD+K+ QNL+I  GSF++P EEI+  +L++DE  L++  ++NL+K+LP Q++L+ L+ ++++YE L E+EQFG  +S++K L  RLN  LFK+ F E++++I+P I+  T A  E++ S  F  +LE++L+ GN+MN+ S++ QT  F+I+FL KL DTK      TL+ F+  +   KYP ++ F +E  +++ A+KV+ +T+ +++  M++    LE +++++ +  D  + F+  M  F  +  EQ   +S M+K +Q  +  +  Y +FD     +E+FF D+  F++ F  A +E     + E + ++A+  + + E EK ER  ++ +      + D+  V+D+L+  L SG AF +R+
Sbjct:  591 LPYGLAPKKTYKPDSIMKRVNWSKIVPQEMAENCFWLKVKEERFENTDMFSELSLSFSSKS------RDDR-----MTQFKKKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSEALIQNLIKNLPEQKELSNLAELKNEYEELCESEQFGIVMSSVKMLRPRLNGILFKLTFEEQVNNIRPDIMNVTFACEEVKKSEGFHMLLEMVLLVGNYMNSGSRNAQTFGFNISFLCKLRDTKSTDQNTTLLHFLAEKCEEKYPEMLKFPDELEHVESASKVAAQTLKASLDIMERHIQRLENDIQNFPKTDDKQDKFVEKMSGFSKHSREQYEKLSTMHKNMQKLYENLGSYFAFDPHTVSIEDFFGDLANFRNLFMDAVRENHKKREMEEKIKRAKIAKEKAEREKIERQQKKKQLIDMNKEGDETGVMDSLMEALQSGAAFRDRR 1033          

HSP 2 Score: 110.153 bits (274), Expect = 1.835e-28
Identity = 82/317 (25.87%), Postives = 163/317 (51.42%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN-VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKI-ELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQ---LDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQ 1418
            ++CL+AF N  YGL  ++ ++ +LL ++  ++ +  N+M   +++L+       E+  + ++ A+ + A+ +N+ +RF PI+ GL+   ++    L + C+Q IN +V          S  DL +R+HLR EF+ CGL   L  L   ++ +I+  +   +   +D  E ++++ ++   + +   VY LL+  +  T  +    SIL+HL++I+ D  IR   +++I + +S+++LH  GM  D    +   +D  +L D   +K       Q   E  +K+++    + E + +L   E K+    S+I   Q Q
Sbjct:  197 IQCLKAFMNNKYGLQRILGDERSLLLLARAIDPKQTNMMTEIVKILSAVCIIGEENILDKILAAMTIAAE-RNNKERFAPIVEGLE---NHEAQQLQVACMQLINALV---------TSPDDLDFRIHLRNEFLRCGLKKILPELKETEELDIQLKVFN-ENKEEDSIELSHRLDDIRAEMDDMGEVYHLLSNMVKDTGSEPYFLSILQHLLLIRNDYYIRPQYYKVIEECVSQIVLHRSGMDPDFAYRERLDVDFSHLIDQCVDKAKVDESEQRAAEFSKKFDEEFSARQEAQAELQKQEEKIKAFESQINTLQAQ 499          

HSP 3 Score: 37.3502 bits (85), Expect = 1.835e-28
Identity = 40/153 (26.14%), Postives = 73/153 (47.71%), Query Frame = 1
Query:    1 DNMKNVFEFFKSMDKKKIFSLKSKENDKKFTEVSL-LNTPVRDD----MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETS-----------PSNYINTL-----VDIVERQWAIEKIIVKLDSLRVYLNSSPLSRV 396
            D+M++    F+    KK   L     D   T+  L +  P  D+    ++E E  ++F K M++MN+  +++ PL  + +  KR+++ Q  S++  S            S +  TL     V  +    + +K++  L+SLRV L S+P+S V
Sbjct:    9 DDMRDRITSFRKQGMKKEKPLIQHPTDPISTQTELPVPQPFFDERSMNLSEKEIVDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGISEDKLLNCLESLRVSLTSNPVSWV 161          
BLAST of Diaphanous, putative vs. Ensembl Zebrafish
Match: diaph2 (diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-GENE-090115-1])

HSP 1 Score: 234.572 bits (597), Expect = 1.004e-63
Identity = 115/325 (35.38%), Postives = 208/325 (64.00%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL 2552
             P+G+  K   KP  +MK+ NW+K+  + +  NC W K+ +      +M  EL+  FS+++   KDV + +  +  +    KK KE ++LD+K+ QNL+I  GSF++P EEI+  +L++DE  L++  ++NL+K+LP Q++L+ L+ ++++YE L E+EQFG  +S++K L  RLN  LFK+ F E++++I+P I+  T A  E++ S  F  +LE++L+ GN+MN+ S++ QT  F+I+FL KL DTK      TL+ F+  +   KYP ++ F +E  +++ A+KV+ +T+ +++  M++    LE +++++ +  D  + F+
Sbjct:  605 LPYGLAPKKTYKPDSIMKRVNWSKIVPQEMAENCFWLKVKEERFENTDMFSELSLSFSSKSRVKKDVEETDDRMTQFK---KKAKELRILDAKTAQNLSIFLGSFRLPYEEIRDIVLQVDEERLSEALIQNLIKNLPEQKELSNLAELKNEYEELCESEQFGIVMSSVKMLRPRLNGILFKLTFEEQVNNIRPDIMNVTFACEEVKKSEGFHMLLEMVLLVGNYMNSGSRNAQTFGFNISFLCKLRDTKSTDQNTTLLHFLAEKCEEKYPEMLKFPDELEHVESASKVAAQTLKASLDIMERHIQRLENDIQNFPKTDDKQDKFV 926          

HSP 2 Score: 108.997 bits (271), Expect = 5.280e-28
Identity = 83/319 (26.02%), Postives = 163/319 (51.10%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN-VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKI-ELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN-----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQ 1418
            ++CL+AF N  YGL  ++ ++ +LL ++  ++ +  N+M   +++L+       E+  + ++ A+ + A+ +N+ +RF PI+ GL+   ++    L + C+Q IN +V          S  DL +R+HLR EF+ CGL   L  L   ++ +I+  +   +   +D  E ++++ ++   + +   VY LL+  +  T  +    SIL+HL++I+ D  IR   +++I + +S+++LH  GM  DP         +D  +L D   +K       Q   E  +K+++    + E + +L   E K+    S+I   Q Q
Sbjct:  211 IQCLKAFMNNKYGLQRILGDERSLLLLARAIDPKQTNMMTEIVKILSAVCIIGEENILDKILAAMTIAAE-RNNKERFAPIVEGLE---NHEAQQLQVACMQLINALVT---------SPDDLDFRIHLRNEFLRCGLKKILPELKETEELDIQLKVFN-ENKEEDSIELSHRLDDIRAEMDDMGEVYHLLSNMVKDTGSEPYFLSILQHLLLIRNDYYIRPQYYKVIEECVSQIVLHRSGM--DPDFAYRERLDVDFSHLIDQCVDKAKVDESEQRAAEFSKKFDEEFSARQEAQAELQKQEEKIKAFESQINTLQAQ 513          

HSP 3 Score: 36.965 bits (84), Expect = 5.280e-28
Identity = 27/110 (24.55%), Postives = 55/110 (50.00%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPSN--------------------YINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRV 396
            +++E E  ++F K M++MN+  +++ PL  + +  KR+++ Q  S++  S +                     Y++ L   +      +K++  L+SLRV L S+P+S V
Sbjct:   70 NLSEKEIVDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSITGSKVAGGLRNSKHECTLSSQEYVHELRSGISE----DKLLNCLESLRVSLTSNPVSWV 175          
BLAST of Diaphanous, putative vs. Ensembl Zebrafish
Match: CABZ01057928.1 (protein diaphanous homolog 1-like [Source:NCBI gene;Acc:101882228])

HSP 1 Score: 204.527 bits (519), Expect = 9.803e-59
Identity = 109/287 (37.98%), Postives = 177/287 (61.67%), Query Frame = 3
Query: 1911 IKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDY-KQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQ--KANKEIEIAIQN 2762
            +K  ILE++E LLT+  V++LLK LP QEQL  LS M+D+YE L E+EQFG  +S++K L  RL + LFK++F E+++++KP +V  T A  E+R S +F K+LE+ L+ GNF+NA S++ +   F +++L KL DTK    + TL+ F+    + +YP ++ F  E  +++KA+KVS ET+  ++ +M K    LE++++ +   QSD D +   M  F+    E    +  +++ ++  + ++ KY  FD +K   EEFF D+  F+  FQ    NK + I I N
Sbjct:    1 MKTVILEVNETLLTENMVQSLLKLLPEQEQLNTLSEMKDEYEELAESEQFGVVISSVKRLKPRLTAILFKLQFEEQVNNVKPDVVAVTAACEELRKSESFAKLLEITLLLGNFLNAGSRNAKAFGFSVSYLCKLRDTKSADQKQTLLHFLAETCQEQYPEVMTFPEELIHVEKASKVSAETLQKSLDQMGKQIKSLEKDIETFPPPQSDKDKFVEKMTSFVSTARENFEKLQLLHENMEKQYEDLGKYFVFDPKKMTPEEFFGDLNNFRTMFQVRPINKIVNIYILN 287          
BLAST of Diaphanous, putative vs. Ensembl Xenopus
Match: DIAPH2 (diaphanous related formin 2 [Source:NCBI gene;Acc:100485481])

HSP 1 Score: 286.189 bits (731), Expect = 9.921e-81
Identity = 165/466 (35.41%), Postives = 278/466 (59.66%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDY-KQQSDNDNYFLVMQEFLV--NVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA----TQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKT 2954
             PFGM+ K   KP+  MK+ NW+KV+ + +   C+W K  +      E+   L++ F+T     K  + + +  N  + + KKVKE +VLDSK+ QNL+I  GS+++  EEIK  ILE+DE  L+++ ++NL+K+LP Q++L+ LS+++ +YE+L E EQFG  +STIK L +RLN  LFK+ F E IS+IKP I+  T A  E++ S +F KI+EL+L+ GN+MN+ S++ Q++ F+++FL K+ DTK +  + TL+ F+      ++  ++ F +E  +++ A+KVS + + S++  M+     LE ++K++ K  + ND +   M  ++      EQ   +S M   +   +  +  YL+FD +   +EEFF D+  F+  F +A KE     + E + ++A+  + + E EK ER  ++ +      + D+  V+D+LL  L SG AF +    R+KR  KT
Sbjct:  571 LPFGMKPKKIYKPETNMKRINWSKVEPQDITETCIWVKAKEDHFENPEIFTRLSQMFATHMKAKK--ATEQAEENKPTLIKKKVKELRVLDSKTAQNLSIFLGSYRMSYEEIKSMILEVDEEKLSESLIQNLIKNLPEQKELSALSQLKSEYEDLCEPEQFGVVMSTIKMLRSRLNGILFKLTFDEHISNIKPDIIAVTLACEELKKSESFKKIVELVLLVGNYMNSGSRNAQSLGFNVSFLCKIRDTKSSDQKTTLLHFLAEICEERFKEILKFPDELEHVESASKVSAQNLKSSLDAMEHQIKRLEGDIKNFTKTDNPNDKFVEKMTTYIFAKGAREQYEKLSNMYNHMNKLYDNLGDYLTFDAKAVSVEEFFGDLSSFRTLFLEAVKENNKRREMEEKMKRAKIAKEKAEREKLERQHKKKQLIDINKEGDETGVMDSLLEALQSGAAFRD----RRKRTPKT 1030          

HSP 2 Score: 92.8189 bits (229), Expect = 8.917e-24
Identity = 86/331 (25.98%), Postives = 163/331 (49.24%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN-VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDA--------VYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN-----QLDGYNLTDV-FEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQPQTVN 1433
            ++CL+AF N  YGL  +++   +LL ++  ++ +  N+M   +++L+       ++  + ++EA+   A++ N  +RF PI+  L+   ++    L   C+QFIN ++          S  +L +R+HLR EF+ CGL   L  L   ++E +   +  F     DE++  + +EL   L++  A        +Y LL   L  T  ++   SIL+H ++I+ D  IR   +++I++ + +++L   GM  DP         +D  +L D   +K       +  +E  +K+++    + E + +L  LE K  IKA E    Q + Q +N
Sbjct:  193 IQCLKAFMNNKYGLQRILSEDRSLLLLARAIDPKQANMMTEILKILSAICIIGEDNILDKLLEAITTAAEIHNK-ERFAPIVEALE---NHEAFQLQASCMQFINALLT---------SPEELDFRIHLRNEFLRCGLKQILPELKEKENEELDIQLKVF-----DENKEEDLLELSHRLRDIRAEMEYPFIQLYHLLYNMLKDTASETYFQSILQHFLLIRNDYYIRPQYYKVIDECVGQVVLQCSGM--DPDFRYRGRLDIDFSHLIDACVDKAKVEESEKKASEFSKKFDEEFTARQEAQAELQKLEEK--IKALETENQQLKTQVIN 501          

HSP 3 Score: 39.2762 bits (90), Expect = 8.917e-24
Identity = 30/99 (30.30%), Postives = 56/99 (56.57%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSP----SNYINTLVD---IVERQWAI--EKIIVKLDSLRVYLNSSPLSRV 396
            +++E E  ++F K M++MN+  +++ PL  + +  K +++ Q  S++  S     S +  TL     + E +  I  EK++  L+SLRV L S+P+S V
Sbjct:   59 NLSEKEIMDLFEKMMEDMNLNEERKAPLRQKDLTRKHEMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGITDEKLLNCLESLRVSLTSNPVSWV 157          
BLAST of Diaphanous, putative vs. Ensembl Xenopus
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:733754])

HSP 1 Score: 280.026 bits (715), Expect = 1.218e-80
Identity = 166/465 (35.70%), Postives = 267/465 (57.42%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL--VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
             PFG+  K N KP+  +K+ NW+K+    L     W +  +      E+  ++   FS++  + K   D +   +  +   KK KE KVLDSK+ QNL+I  GSF++P EEIK  IL+++E +LT++ V NL+K LP  +QL  L+  +++Y++L E EQFG  + ++  L  RLN+ LFK+ F+E+I +IKP IV  T A  E++   +F  +LE+ L+ GNFMNA S++     F I+FL KL DTK    + TL+ F+V    N YP ++ F +E  +++KA++VS ET+   + +MKK   DL+R++  +    D  + F+  +   F   + +  T +  M++ + S F+++ KY  FD +K  +EEFF D++ F++ F  A KE      N+ RR   +K +  +L +E  + ER  +Q K  Q        D+  V+D+LL  LNSG AF  ++ PR+
Sbjct:  229 LPFGLAPKKNYKPEVQLKRPNWSKITPAELSEKSFWTQTKEDRFEKEELFAKITLTFSSQ-IKSKKAEDGD---DKKAAQKKKTKELKVLDSKTAQNLSIFLGSFRMPYEEIKNVILQVNEEVLTESMVSNLIKQLPEPDQLQMLTEFKNEYKDLAEPEQFGVVMCSVPRLRPRLNAILFKLLFNEQIENIKPDIVSVTAACEEVQKCQSFASLLEITLLVGNFMNAGSRNADAYGFDISFLCKLKDTKSADQKTTLLHFLVETCENDYPDVLKFPDEMVHVEKASRVSAETLQKNLDQMKKQIADLQRDIDSFPPTEDEKDKFVEKMTISFYYKLIKIYTKLCMMHENMLSLFQDLGKYFVFDPKKTSIEEFFADLQNFRNMFLHALKE------NQKRREAEEKMKRAKLAKEKAEKERLEKQQKKEQLIDMNAEGDETGVMDSLLEALNSGAAFRRKRGPRQ 683          
BLAST of Diaphanous, putative vs. Ensembl Xenopus
Match: DIAPH2 (diaphanous related formin 2 [Source:NCBI gene;Acc:100485481])

HSP 1 Score: 285.419 bits (729), Expect = 1.424e-80
Identity = 162/463 (34.99%), Postives = 276/463 (59.61%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA----TQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKT 2954
             PFGM+ K   KP+  MK+ NW+KV+ + +   C+W K  +      E+   L++ F+T     K  + + +  N  + + KKVKE +VLDSK+ QNL+I  GS+++  EEIK  ILE+DE  L+++ ++NL+K+LP Q++L+ LS+++ +YE+L E EQFG  +STIK L +RLN  LFK+ F E IS+IKP I+  T A  E++ S +F KI+EL+L+ GN+MN+ S++ Q++ F+++FL K+ DTK +  + TL+ F+      ++  ++ F +E  +++ A+KVS + + S++  M+     LE ++K++ +  + ++ F+          EQ   +S M   +   +  +  YL+FD +   +EEFF D+  F+  F +A KE     + E + ++A+  + + E EK ER  ++ +      + D+  V+D+LL  L SG AF +    R+KR  KT
Sbjct:  561 LPFGMKPKKIYKPETNMKRINWSKVEPQDITETCIWVKAKEDHFENPEIFTRLSQMFATHMKAKK--ATEQAEENKPTLIKKKVKELRVLDSKTAQNLSIFLGSYRMSYEEIKSMILEVDEEKLSESLIQNLIKNLPEQKELSALSQLKSEYEDLCEPEQFGVVMSTIKMLRSRLNGILFKLTFDEHISNIKPDIIAVTLACEELKKSESFKKIVELVLLVGNYMNSGSRNAQSLGFNVSFLCKIRDTKSSDQKTTLLHFLAEICEERFKEILKFPDELEHVESASKVSAQNLKSSLDAMEHQIKRLEGDIKNFTKTDNPNDKFVEKMSISFLYREQYEKLSNMYNHMNKLYDNLGDYLTFDAKAVSVEEFFGDLSSFRTLFLEAVKENNKRREMEEKMKRAKIAKEKAEREKLERQHKKKQLIDINKEGDETGVMDSLLEALQSGAAFRD----RRKRTPKT 1017          

HSP 2 Score: 92.8189 bits (229), Expect = 8.560e-24
Identity = 86/331 (25.98%), Postives = 163/331 (49.24%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN-VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDA--------VYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN-----QLDGYNLTDV-FEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQPQTVN 1433
            ++CL+AF N  YGL  +++   +LL ++  ++ +  N+M   +++L+       ++  + ++EA+   A++ N  +RF PI+  L+   ++    L   C+QFIN ++          S  +L +R+HLR EF+ CGL   L  L   ++E +   +  F     DE++  + +EL   L++  A        +Y LL   L  T  ++   SIL+H ++I+ D  IR   +++I++ + +++L   GM  DP         +D  +L D   +K       +  +E  +K+++    + E + +L  LE K  IKA E    Q + Q +N
Sbjct:  183 IQCLKAFMNNKYGLQRILSEDRSLLLLARAIDPKQANMMTEILKILSAICIIGEDNILDKLLEAITTAAEIHNK-ERFAPIVEALE---NHEAFQLQASCMQFINALLT---------SPEELDFRIHLRNEFLRCGLKQILPELKEKENEELDIQLKVF-----DENKEEDLLELSHRLRDIRAEMEYPFIQLYHLLYNMLKDTASETYFQSILQHFLLIRNDYYIRPQYYKVIDECVGQVVLQCSGM--DPDFRYRGRLDIDFSHLIDACVDKAKVEESEKKASEFSKKFDEEFTARQEAQAELQKLEEK--IKALETENQQLKTQVIN 491          

HSP 3 Score: 39.2762 bits (90), Expect = 8.560e-24
Identity = 30/99 (30.30%), Postives = 56/99 (56.57%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSP----SNYINTLVD---IVERQWAI--EKIIVKLDSLRVYLNSSPLSRV 396
            +++E E  ++F K M++MN+  +++ PL  + +  K +++ Q  S++  S     S +  TL     + E +  I  EK++  L+SLRV L S+P+S V
Sbjct:   49 NLSEKEIMDLFEKMMEDMNLNEERKAPLRQKDLTRKHEMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGITDEKLLNCLESLRVSLTSNPVSWV 147          
BLAST of Diaphanous, putative vs. Ensembl Xenopus
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:733754])

HSP 1 Score: 245.743 bits (626), Expect = 1.851e-66
Identity = 153/467 (32.76%), Postives = 249/467 (53.32%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL--VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRKKR 2942
             PFG+  K N KP+  +K+ NW+K+    L     W +  +                           D      S     + VK++      +G   +I  GSF++P EEIK  IL+++E +LT++ V NL+K LP  +QL  L+  +++Y++L E EQFG  + ++  L  RLN+ LFK+ F+E+I +IKP IV  T A  E++   +F  +LE+ L+ GNFMNA S++     F I+FL KL DTK    + TL+ F+V    N YP ++ F +E  +++KA++VS ET+   + +MKK   DL+R++  +    D  + F+  +   F   + +  T +  M++ + S F+++ KY  FD +K  +EEFF D++ F++ F  A KE      N+ RR   +K +  +L +E  + ER  +Q K  Q        D+  V+D+LL  LNSG AF  ++ PR+ +
Sbjct:  712 LPFGLAPKKNYKPEVQLKRPNWSKITPAELSEKSFWTQTKE---------------------------DPKIPCISCVLFLRSVKKW------AG---SIFLGSFRMPYEEIKNVILQVNEEVLTESMVSNLIKQLPEPDQLQMLTEFKNEYKDLAEPEQFGVVMCSVPRLRPRLNAILFKLLFNEQIENIKPDIVSVTAACEEVQKCQSFASLLEITLLVGNFMNAGSRNADAYGFDISFLCKLKDTKSADQKTTLLHFLVETCENDYPDVLKFPDEMVHVEKASRVSAETLQKNLDQMKKQIADLQRDIDSFPPTEDEKDKFVEKMTISFYYKLIKIYTKLCMMHENMLSLFQDLGKYFVFDPKKTSIEEFFADLQNFRNMFLHALKE------NQKRREAEEKMKRAKLAKEKAEKERLEKQQKKEQLIDMNAEGDETGVMDSLLEALNSGAAFRRKRGPRQGK 1136          

HSP 2 Score: 92.8189 bits (229), Expect = 1.804e-18
Identity = 93/370 (25.14%), Postives = 180/370 (48.65%), Query Frame = 3
Query:  402 INNESNNGLNKLVIVLSHYIDNAEISLH-------CLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFY--SFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTD-DEDEYNNKIELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTDVF-EKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEI------LQTQKQPQTVNQTSM 1445
            + N    GL+ L+ +L   I + + SL         ++CL+AF N  +G+  ++  ++ +L ++  ++   P +M  +++LL+         + H  V+EAL         ++RF P+++GL++        L + C+Q IN ++       S    LD  YR+H+R E +  GL   L  L N ++E++K  +  F   ++ D D+   +++ ++LL N          T+  ++ +    SIL+HL++I+ D   R   ++LI++VIS++IL  +G   DP        ++  NL D F +K           +L +K +  L  +HE +V++ + E+   +K +E+      L  +KQ  T ++  M
Sbjct:  129 VQNFGAEGLSCLLEILKR-IQDEQASLRDVRSEHEIIRCLKAFMNNNFGIKAMLGTEDGILLLARAVDRSVPAMMIDSLKLLSALCILPQPEDMHERVLEALTE-RAEMEEMERFKPLLDGLNIA---SPVALKVSCMQLINAVI-------SQGEELD--YRVHIRSELMRSGLAKLLKELRNTENEDLKVQLGIFDEHSELDSDDLRGRLD-DILLLN----------TVKDSSAEPLFLSILQHLLLIRNDYDARPQYYKLIDEVISQIILQKNGA--DPDFKCKHVNIEIENLIDHFIDKKKVETSESKARDLVKKLDLELTARHELQVEMKAKESDFELKITELQGEKESLDAEKQEITADKQKM 471          
BLAST of Diaphanous, putative vs. Ensembl Xenopus
Match: atrn (attractin [Source:Xenbase;Acc:XB-GENE-953934])

HSP 1 Score: 244.588 bits (623), Expect = 2.326e-66
Identity = 156/478 (32.64%), Postives = 264/478 (55.23%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLD-----SKSGQNLAILS----GSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLV-NVNEQLTLISE-MNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLR----REMEKTERHTRQCKAT-------QEDDKKVLDNLLVTLNSGNAFGNRKD--PRKK 2939
             PFG++ K   KP+ +MK+ NW K+    +  +C W    +      E+  +L   FS +                +    KK   FK+L+        G  L+++     GS+++P EEIK+ ILE+DE  L+++ V+NL+K++P Q QL  L+ ++ +Y +L+E EQFG  +S++K L  RLN+ LF+++F E++++IKP I+  ++A  EI+ S +F K+LE++L+ GN+MNA S++ QT  F ++ L KL DTK      TL+ F+ +    ++P +  F  +   +DKA+KVS E +  T+ +M++    LE++L+ +    D  + F+    F+V    E+L+ + E M+K+ Q     + +Y   D +K  +EEFF D+  F+  F +A+KE         RR++A E+Q R    +EM + E+  RQ K         + ++  V+D+LL  L SG AF +R+   PR K
Sbjct:  546 LPFGLKPKKEFKPEVVMKRLNWQKITPNEMTESCFWLTAKEEGYEDKELFFQLENTFSCQ----------RKGGYCFIITEKKEISFKILNYVIKMESMGDRLSVIRTIFLGSYRLPYEEIKKIILEIDETQLSESMVQNLIKNMPAQTQLNSLANLKSEYLSLSEPEQFGVVMSSVKKLIPRLNAILFRLQFEEQVNNIKPDIMAVSEACEEIKKSKSFGKLLEIVLLIGNYMNAGSRNAQTFGFCLSSLCKLKDTKSADQNTTLLHFLADICDKRFPDIKIFVEDVQTVDKASKVSAENLEKTMKQMERQLQQLEKDLETFPLSDDAHDKFVTKISFVVCWYEEKLSRMYENMDKLYQG----LMEYYVLDSKKVSVEEFFTDVNNFRTMFMQASKE-------NIRRKEAEEKQKRVKQAKEMAEKEKLERQLKKKRLLEKNREGEETGVMDSLLEALQSGAAFRDRRKRTPRPK 1002          

HSP 2 Score: 79.7221 bits (195), Expect = 5.609e-22
Identity = 62/234 (26.50%), Postives = 114/234 (48.72%), Query Frame = 3
Query:  522 YGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFE-SHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDP 1217
            YGL  ++  + +L  ++  ++ +  N+M   ++LL+       E +   V+EA+   A+ +  I RF PI+ GL    H+    L + C+Q IN +V          S  DL +R+H+R EF+  GL   L  L ++ ++ +   +  F+ +  +ED       L+ +    +  Y         TN +    SIL+HL++I+ D   +   F++I + IS+++LH  G  +DP
Sbjct:  195 YGLERILGEERSLSLLAKAMDPKQANMMTDVVKLLSAICIVGEENTLEKVLEAITAAAE-ERGIIRFSPIVGGL----HHNLIQLQVACMQLINALVT---------SPDDLDFRLHIRNEFMRSGLKEILPQLKHVKNDALDIQLRVFE-EHKEEDMIEFSHRLDDIRSEMEYPY---------TNAEGYFLSILQHLLLIRNDYFAKPQYFKIIEESISQIVLHRSG--IDP 402          

HSP 3 Score: 46.595 bits (109), Expect = 5.609e-22
Identity = 31/100 (31.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:  130 MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ----------IHSSSETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVK 399
            ++E E   +F K M++MN+  +K+ PL  +    K++++ Q          + SS + SP  +I+ L    +   A E+++  LDSLRV L S+P+S V+
Sbjct:   63 LSEKEVLPLFEKMMEDMNLNEEKKAPLREKDFATKKEMVLQYISTASKAGSLRSSRQISPQEFIHEL----KSGAADERLVSYLDSLRVSLTSNPVSWVE 158          
BLAST of Diaphanous, putative vs. Ensembl Mouse
Match: Diaph1 (diaphanous related formin 1 [Source:MGI Symbol;Acc:MGI:1194490])

HSP 1 Score: 302.753 bits (774), Expect = 9.395e-86
Identity = 172/466 (36.91%), Postives = 278/466 (59.66%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K   + L ++C W K+ +     NE+  +L   FS +    K   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++++Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S NF  +LEL L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N +P ++ F +E ++++KA++VS E +  ++ +MKK   D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+  Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  709 PVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1168          

HSP 2 Score: 122.865 bits (307), Expect = 2.665e-31
Identity = 87/306 (28.43%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E++K  +  F  +  DED ++ K  L+ +    D    V+Q++  T+  +  +    SIL+HL++++ D   R   ++LI + +S+++LH +G   DP       Q+D   L D + +K          TEL++K +  L  +HE +V++  +EN
Sbjct:  174 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGTS---IALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFD-EQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGT--DPDFKCRHLQIDIERLVDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMEN 463          

HSP 3 Score: 34.2686 bits (77), Expect = 2.665e-31
Identity = 30/112 (26.79%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSS--------SETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ +H+S        S  S   YI  L   +        ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   42 DISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMH----LLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 149          
BLAST of Diaphanous, putative vs. Ensembl Mouse
Match: Diaph1 (diaphanous related formin 1 [Source:MGI Symbol;Acc:MGI:1194490])

HSP 1 Score: 301.982 bits (772), Expect = 1.957e-85
Identity = 172/466 (36.91%), Postives = 278/466 (59.66%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K   + L ++C W K+ +     NE+  +L   FS +    K   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++++Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S NF  +LEL L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N +P ++ F +E ++++KA++VS E +  ++ +MKK   D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+  Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  744 PVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1203          

HSP 2 Score: 122.865 bits (307), Expect = 2.776e-31
Identity = 87/306 (28.43%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E++K  +  F  +  DED ++ K  L+ +    D    V+Q++  T+  +  +    SIL+HL++++ D   R   ++LI + +S+++LH +G   DP       Q+D   L D + +K          TEL++K +  L  +HE +V++  +EN
Sbjct:  209 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGTS---IALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFD-EQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGT--DPDFKCRHLQIDIERLVDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMEN 498          

HSP 3 Score: 34.2686 bits (77), Expect = 2.776e-31
Identity = 30/112 (26.79%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSS--------SETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ +H+S        S  S   YI  L   +        ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   77 DISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMH----LLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 184          
BLAST of Diaphanous, putative vs. Ensembl Mouse
Match: Diaph1 (diaphanous related formin 1 [Source:MGI Symbol;Acc:MGI:1194490])

HSP 1 Score: 301.982 bits (772), Expect = 2.026e-85
Identity = 172/466 (36.91%), Postives = 278/466 (59.66%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K   + L ++C W K+ +     NE+  +L   FS +    K   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++++Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S NF  +LEL L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N +P ++ F +E ++++KA++VS E +  ++ +MKK   D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+  Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  753 PVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1212          

HSP 2 Score: 122.865 bits (307), Expect = 2.535e-31
Identity = 87/306 (28.43%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E++K  +  F  +  DED ++ K  L+ +    D    V+Q++  T+  +  +    SIL+HL++++ D   R   ++LI + +S+++LH +G   DP       Q+D   L D + +K          TEL++K +  L  +HE +V++  +EN
Sbjct:  218 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGTS---IALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFD-EQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGT--DPDFKCRHLQIDIERLVDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMEN 507          

HSP 3 Score: 34.2686 bits (77), Expect = 2.535e-31
Identity = 30/112 (26.79%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSS--------SETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ +H+S        S  S   YI  L   +        ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   86 DISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMH----LLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 193          
BLAST of Diaphanous, putative vs. Ensembl Mouse
Match: Diaph1 (diaphanous related formin 1 [Source:MGI Symbol;Acc:MGI:1194490])

HSP 1 Score: 299.286 bits (765), Expect = 1.217e-84
Identity = 171/466 (36.70%), Postives = 277/466 (59.44%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K   + L ++C W K+ +     NE+  +L   FS +        D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++++Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S NF  +LEL L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N +P ++ F +E ++++KA++VS E +  ++ +MKK   D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+  Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  709 PVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSLAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1168          

HSP 2 Score: 122.479 bits (306), Expect = 2.847e-31
Identity = 87/306 (28.43%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E++K  +  F  +  DED ++ K  L+ +    D    V+Q++  T+  +  +    SIL+HL++++ D   R   ++LI + +S+++LH +G   DP       Q+D   L D + +K          TEL++K +  L  +HE +V++  +EN
Sbjct:  174 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGTS---IALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFD-EQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGT--DPDFKCRHLQIDIERLVDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMEN 463          

HSP 3 Score: 34.2686 bits (77), Expect = 2.847e-31
Identity = 30/112 (26.79%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSS--------SETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ +H+S        S  S   YI  L   +        ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   42 DISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMH----LLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 149          
BLAST of Diaphanous, putative vs. Ensembl Mouse
Match: Diaph1 (diaphanous related formin 1 [Source:MGI Symbol;Acc:MGI:1194490])

HSP 1 Score: 298.901 bits (764), Expect = 2.032e-84
Identity = 171/466 (36.70%), Postives = 277/466 (59.44%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K   + L ++C W K+ +     NE+  +L   FS +        D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++++Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S NF  +LEL L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N +P ++ F +E ++++KA++VS E +  ++ +MKK   D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+  Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  744 PVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSLAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1203          

HSP 2 Score: 122.865 bits (307), Expect = 2.776e-31
Identity = 87/306 (28.43%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E++K  +  F  +  DED ++ K  L+ +    D    V+Q++  T+  +  +    SIL+HL++++ D   R   ++LI + +S+++LH +G   DP       Q+D   L D + +K          TEL++K +  L  +HE +V++  +EN
Sbjct:  209 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGTS---IALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFD-EQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGT--DPDFKCRHLQIDIERLVDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMEN 498          

HSP 3 Score: 34.2686 bits (77), Expect = 2.776e-31
Identity = 30/112 (26.79%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSS--------SETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ +H+S        S  S   YI  L   +        ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   77 DISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMH----LLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 184          
BLAST of Diaphanous, putative vs. UniProt/SwissProt
Match: sp|O60610|DIAP1_HUMAN (Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2)

HSP 1 Score: 303.138 bits (775), Expect = 7.522e-85
Identity = 172/466 (36.91%), Postives = 280/466 (60.09%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K+  + L ++C W K+ +     NE+  +L   FS +    K   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++D+Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S +F  +LE+ L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N YP ++ F +E ++++KA++VS E +   + +MKK  +D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+ +Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  761 PVLPFGLTPKKLYKPEVQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1220          

HSP 2 Score: 117.472 bits (293), Expect = 2.567e-28
Identity = 85/306 (27.78%), Postives = 158/306 (51.63%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E+++  +  F  +  +ED Y+ K  L+ +    D    V+Q+L  T+  +  +    SIL+HL++++ D   R   ++LI + IS+++LH +G   DP       Q++   L D + +K           EL++K +  L  +HE +V++  +E+
Sbjct:  218 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGT---TIALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVFD-EQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECISQIVLHKNGA--DPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLDSELTARHELQVEMKKMES 507          

HSP 3 Score: 31.9574 bits (71), Expect = 2.567e-28
Identity = 27/108 (25.00%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPS---NYINTLVDIVERQWAIE--KIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ   +S+   S   +  + ++ I E +  +    ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   86 DVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 193          
BLAST of Diaphanous, putative vs. UniProt/SwissProt
Match: sp|O08808|DIAP1_MOUSE (Protein diaphanous homolog 1 OS=Mus musculus OX=10090 GN=Diaph1 PE=1 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 1.369e-84
Identity = 172/466 (36.91%), Postives = 278/466 (59.66%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K   + L ++C W K+ +     NE+  +L   FS +    K   D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++++Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S NF  +LEL L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+     N +P ++ F +E ++++KA++VS E +  ++ +MKK   D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+  Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  744 PVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1203          

HSP 2 Score: 122.865 bits (307), Expect = 1.694e-30
Identity = 87/306 (28.43%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  I++E++K  +  F  +  DED ++ K  L+ +    D    V+Q++  T+  +  +    SIL+HL++++ D   R   ++LI + +S+++LH +G   DP       Q+D   L D + +K          TEL++K +  L  +HE +V++  +EN
Sbjct:  209 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEM-DEVERFQPLLDGLKSGTS---IALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFD-EQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGT--DPDFKCRHLQIDIERLVDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMEN 498          

HSP 3 Score: 34.2686 bits (77), Expect = 1.694e-30
Identity = 30/112 (26.79%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSS--------SETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ +H+S        S  S   YI  L   +        ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   77 DISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMH----LLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 184          
BLAST of Diaphanous, putative vs. UniProt/SwissProt
Match: sp|F1M775|DIAP1_RAT (Protein diaphanous homolog 1 OS=Rattus norvegicus OX=10116 GN=Diaph1 PE=1 SV=3)

HSP 1 Score: 296.204 bits (757), Expect = 1.627e-82
Identity = 170/466 (36.48%), Postives = 275/466 (59.01%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P+ PFG+  K   KP+  +++ NW+K   + L ++C W K+ +     NE+  +L   FS +        D        S   KKVKE KVLDSK+ QNL+I  GSF++P +EIK  ILE++E +LT++ ++NL+K +P  EQL  LS ++++Y++L E+EQFG  + T+  L  RLN+ LFK++FSE++ +IKP IV  T A  E+R S NF  +LEL L+ GN+MNA S++     F+I+FL KL DTK    + TL+ F+       +P ++ F +E ++++KA++VS E +   + +MKK   D+ER+++++   +D  + F+  M  F+ +  EQ   +  M+  +++ ++E+  Y  FD +K  +EEFF D+  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  754 PVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSLAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCETDHPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKE------NQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 1213          

HSP 2 Score: 121.709 bits (304), Expect = 3.994e-30
Identity = 86/306 (28.10%), Postives = 159/306 (51.96%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN--VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN----QLDGYNLTD-VFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLEN 1373
            ++CL+AF N  +G+ T++  +E +L +   ++   PN+M  A +LL+           N  V+EA+   A+M+  ++RF P+++GL  G       L + CLQ IN ++ P          LD  +R+H+R E +  GL+  L  L  ID+++++  +  F  +  DED ++ K  L+ +    D    V+Q++  T+  +  +    SIL+HL++++ D   R   ++LI + +S+++LH +G   DP       Q+D   L D + +K          TEL++K +  L  +HE +V++  +EN
Sbjct:  218 IRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEME-EVERFQPLLDGLKSGTS---IALKVGCLQLINALITP-------AEELD--FRVHIRSELMRLGLHQVLQELREIDNDDMRVQLNVFD-EQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGT--DPDFKCRHLQIDIEGLVDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMEN 507          

HSP 3 Score: 33.8834 bits (76), Expect = 3.994e-30
Identity = 30/112 (26.79%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSS--------SETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            D+++ +   +F + + +MN+  +K+ PL  + I  KR+++SQ +H+S        S  S   YI  L   +        ++  L+SLRV LN++P+S V+      +  L++
Sbjct:   86 DISDDQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMH----LLSCLESLRVSLNNNPVSWVQTFGAEGLASLLD 193          
BLAST of Diaphanous, putative vs. UniProt/SwissProt
Match: sp|O70566|DIAP2_MOUSE (Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2)

HSP 1 Score: 290.426 bits (742), Expect = 3.018e-81
Identity = 172/482 (35.68%), Postives = 283/482 (58.71%), Query Frame = 3
Query: 1572 PI-FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFST--RAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDY-KQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA----TQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTEN-IVVINRSRSR 2990
            PI  P+GM+ K   KP   MK+ NW+K++ K L  NCVW K+ + +    ++  +L   F +  +  R  + +++N S        KKVKE ++LD+K+ QNL+I  GS+++P EEIK  ILE++E +L++  ++NL+K LP Q  L +L++++ +Y++L E EQFG  +ST+K L  RL S LFK+ F E +++IKP+I+  T A  E++ S +F ++LELIL+ GN+MN+ S++ Q++ F INFL K+ DTK    + TL+ F+      KY  ++ F +E  +++ A KVS + + S +V M++    LE+ +K++   +S +D +   M  F  N  EQ   +S M+  +   +  + +Y  FD     MEEFF D+  F+  F +A KE     + E + ++A+  + + E EK ER  ++ +      + D+  V+DNLL  L SG AF   +D RK+  +  +N    + RSRSR
Sbjct:  616 PIELPYGMKQKKLYKPDIPMKRINWSKIEPKELSENCVWLKLKEEKYENADLFAKLALTFPSQMKGQRNTEAAEENRS----GPPKKKVKELRILDTKTAQNLSIFLGSYRMPYEEIKNIILEVNEEMLSEALIQNLVKYLPDQNALRELAQLKSEYDDLCEPEQFGVVMSTVKMLRPRLTSILFKLTFEEHVNNIKPSIIAVTLACEELKKSESFKRLLELILLVGNYMNSGSRNAQSLGFKINFLCKIKDTKSADQKSTLLHFLAEICDEKYRDILKFPDELEHVESAGKVSAQILKSNLVAMEQSILHLEKNIKNFPPAESHHDKFVEKMMSFTQNAREQYDKLSTMHSNMLKLYESLGEYFIFDPNTVNMEEFFGDLNTFRTLFLEALKENHKRKEMEEKSRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDETGVMDNLLEALQSGAAF---RDRRKRIPRNPDNRRPPLERSRSR 1090          

HSP 2 Score: 122.479 bits (306), Expect = 7.237e-27
Identity = 94/356 (26.40%), Postives = 178/356 (50.00%), Query Frame = 3
Query:  402 INNESNNGLNKLVIVLSHYIDNAEIS-------LHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLG---AQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDE-DEYNNKI-ELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFE----KFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQ 1418
            +NN    GL  L+ VL   +D  +            ++CL+AF N  +GL  ++ ++ +LL ++  ++ +  N+M   +++L+       E   N+++ L  G   A   N+ +RF PI+ GL+   +N   +L + C+QFIN +V          S  DL +R+HLR EF+ CGL   L +L  I++E +   +  F+ + +D+  E ++++ ++   + + + VY LL   L  T  +  L SIL+H ++I+ D  IR   +++I + +S+++LH  GM  D    Q   ++ T + +    K       Q   E  +K+++    + E + +L   + K+    +EI Q + Q
Sbjct:  197 VNNFGYEGLGVLLDVLEKLLDKKQQENIDKKNQYKVIQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQQNMMTEIVKILSAICIVGEE---NILDKLLGGITAAAELNNRERFSPIVEGLE---NNEALHLQVACMQFINALV---------TSPYDLDFRIHLRNEFLRCGLKAMLPTLKEIENEGLDIQLRVFEENKEDDLSELSHRLNDIRAEMDDINEVYHLLYNMLKDTAAEPYLLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLHCSGMDPDFKYRQRIDFDFTHLLDACVNKAKVEENEQKAMEFSKKFDEEFTARQEAQAELQKRDEKIKELETEIQQLRGQ 537          
BLAST of Diaphanous, putative vs. UniProt/SwissProt
Match: sp|O60879|DIAP2_HUMAN (Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 8.649e-80
Identity = 170/485 (35.05%), Postives = 282/485 (58.14%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLP--KKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQ-QSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTEN-IVVINRSRSR 2990
             P+GM+ K   KP+  MK+ NW+K++   L  NC W ++ + +    ++  +L   F+T+      V  +  +L    T P  KKVKE ++LD K+ QNL+I  GS+++P E+I+  ILE++E +L++  ++NL+K LP Q+ L +L+ ++++Y++L E EQFG  +S++K L  RL+S LFK+ F E I++IKP+I+  T A  E++ S +F ++LEL+L+ GN+MN+ S++ Q++ F INFL K+ DTK    + TL+ FI +    KY  ++ F  E  +++ A+KVS + + S +  M++    LER++K + Q ++ +D +   M  F     EQ   +S M+  +   +  + +Y  FD +   +EEFF D+  F+  F +A +E      N  RR   +K R  +L +E  + E+  RQ K  Q        D+  V+DNLL  L SG AF   +D RK+  +  +N  V + RSRSR
Sbjct:  622 LPYGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRVKEDKFENPDLFAKLALNFATQI----KVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIFLGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQFGVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLVGNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEHVESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTSFTKTAREQYEKLSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRE------NNKRREMEEKTRRAKLAKEKAEQEKLERQKKKKQLIDINKEGDETGVMDNLLEALQSGAAF---RDRRKRIPRNPDNRRVPLERSRSR 1093          

HSP 2 Score: 115.546 bits (288), Expect = 1.697e-30
Identity = 84/326 (25.77%), Postives = 167/326 (51.23%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQS-NLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAF-QTDTDDEDEYNNKI-ELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFE----KFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQPQTVNQTS 1442
            ++CL+AF N  +GL  ++ ++ +LL ++  ++ + PN+M   +++L+       E+  + +      A  +N+ +RF PI+ GL+    N+++  L + C+QFIN +V          S  +L +R+HLR EF+  GL T L  L   +++ +   +  F +   DD  E ++++ ++   + + + VY LL   L  T  ++   SIL+H ++I+ D  IR   +++I + +S+++LH  GM  D    Q    +LT + +    K       Q   E  +K+++    + E + +L   + K+    +EI Q + Q Q ++ +S
Sbjct:  234 IQCLKAFMNNKFGLQRILGDERSLLLLARAIDPKQPNMMTEIVKILSAICIVGEENILDKLLGAITTAAERNNRERFSPIVEGLE----NQEALQLQVACMQFINALV---------TSPYELDFRIHLRNEFLRSGLKTMLPDLKEKENDELDIQLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTAAENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLHCSGMDPDFKYRQRLDIDLTHLIDSCVNKAKVEESEQKAAEFSKKFDEEFTARQEAQAELQKRDEKIKELEAEIQQLRTQAQVLSSSS 546          

HSP 3 Score: 41.2022 bits (95), Expect = 1.697e-30
Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSP----SNYINTL-----VDIVERQWAIEKIIVKLDSLRVYLNSSPLSRV 396
            +++E E  ++F K M++MN+  +K+ PL  +    KR+++ Q  S++  S     S +  TL     V  +    + EK++  L+SLRV L S+P+S V
Sbjct:  100 NLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDEKLLNCLESLRVSLTSNPVSWV 198          
BLAST of Diaphanous, putative vs. TrEMBL
Match: A0A564YK29 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7230 PE=4 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 9.349e-144
Identity = 305/904 (33.74%), Postives = 482/904 (53.32%), Query Frame = 3
Query:  396 KGINNESNNGLNKLVIVLSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQM-QNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTD-DEDEYNNKIEL-EVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIKDTPIRYNLFRLINDVISELILHSDGMCLDPTLNQL----DGYNLTDVFEKF--NDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQPQTVNQTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYS--------TLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYP-YLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQ------CKATQEDDKKVLDNLLVTLNSGNAFGNR------KDPRKKRLKKTENIVV--------INRSRSRR 2993
            K  NN+ N GLN L+  L+    N  I+   L+C+RA GNCGYGL  L+++  A  ++S CLN     LM  ++ELL+     S + H  V+E L   ++   NH  RF P+I GL         +L   CLQ INV+V+  F    T   + L +R+HLR+E  + GLN  L  L    D N+  ++  ++   + D  E   + ++    L + + VY+L+ R++  T  +    SIL+HL+ I++ P R + + L+N ++++++L +DG+ +DP L  L    +G  +  + E +  +D        ELQ+K ++ L+EK E E  L +L++ M  +   +   ++   ++      PP        P                         +P+ +P  P              MKKANW+KVD K L  + VW K+ +SE+ ++++L  L E F+T   +PK  +    S+             + +K K  KVLD K+ Q L+IL GS KVP +E++RRI+E+DE LLT   VE LLK+LP QE + ++  +  DY+ L EAEQF C + TIK L  RL S LFKM+F ER+ +IKP IV  T+AL E+R S + ++ +EL+L+ GN++NA S++ Q++ FH++FL KL DTKD   + TL+ F++  + NK+P  +   TN+ SY+D+A+  S +  ++ I EMK+    LE +L+ Y      DNY  VM++FL    +Q+ +I  M K +   + E+AKY +FD  KYP+E   +D+  F  +F++A  EI+   + E ++++  EE+ RRE EK +  T         +   EDD  V+DNL+ +L SG AFG        + PR + +    N+          + R RSRR
Sbjct:  167 KEFNNKDNGGLNLLLEFLAP-TQNRTITYLSLRCVRALGNCGYGLYALVDHDTASTFISRCLNVHDVPLMECSLELLSTMAMCSLKGHEKVLEGLTFCSEFTPNHPPRFEPLIQGLS------NPDLACACLQLINVLVSARFLSEET---IVLDHRIHLRLELANLGLNQCLSELDKSTDPNVINHVGIYRRFAEADNIELCERFDVARADLNDLEQVYRLIQRSVSNTPSEKIFLSILQHLLFIREEPYRQHYYNLLNGIVAQVVLQTDGVDIDPALGTLRLDIEG-TVNALMEAYKQSDGGSGAKVEELQKKLDQALQEKQELEATLENLKSNMASRGG-VSTGEEMGGSIPPPPGVPPMFSGVSASPPLPFGMKA-----------------KPVYKPKLP--------------MKKANWDKVDQKDLAEDSVWVKMQESELASDDLLASLTENFNT---KPKKFAGSGDSVAGEGDQSSAGAAAIARKAKHLKVLDGKTAQALSILLGSLKVPYDELRRRIVEIDEALLTPGIVEQLLKALPEQEVINQVVELSGDYDELAEAEQFLCKVGTIKKLLPRLKSILFKMRFQERVDEIKPDIVAVTEALKELRQSKHLVRGIELVLLFGNYLNAGSRNAQSLGFHLSFLPKLTDTKDIVGKSTLLHFLIRVLENKFPDSVFGLTNDLSYIDRASHFSEDATAAAIAEMKRSADALENDLRTYITTDPKDNYSTVMKQFLTEAQQQIEVIESMFKRVNERYTEVAKYFAFDPNKYPIESLLNDMSKFLYSFKRAVTEIQEQKEFEEKQKRLLEERQRREEEKAQLRTTDKVPGGITRKPTEDDGNVIDNLIESLKSGAAFGADGFGAPVRRPRNRHIPPGANMSPAAVALRQNLVRQRSRR 1024          
BLAST of Diaphanous, putative vs. TrEMBL
Match: A0A410SF40 (Diaphonous OS=Bradybaena similaris OX=145626 GN=diaph PE=2 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 8.017e-124
Identity = 297/916 (32.42%), Postives = 470/916 (51.31%), Query Frame = 3
Query:  417 NNGLNKLVIVLSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTD-DEDEYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIKDTPI-RYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVF--------------EKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQ-TQKQPQTVNQT-------SMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPIF---------PFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSD-NDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA------TQEDDKKVLDNLLVTLNSGNAF--------GNRKDPRKKRLKKTENIVVINRSRSRRDFDKNLIQ 3017
            N  LN +  + +    +   +  C++CL+AF N  +GL  ++ + EAL  +SL L+   P  M  A+  L        + H  V+  +     +  H  RF PII GL +        + + C+Q +NVIV       +T  +LD  +R+HLR EF+  GL+  ++SLS   DE +   +  F      D DE+ ++ + + +  ++  A ++L+  T+  T  +    SIL+HL+ I+D    R   ++LI + +++++LH +G   DP       + LT  F               K  D    ++  E+  K    L  K E E K   LE K+     E+LQ  + + Q +          S     +  +  PP           + PPPPP        P   P+F         PFGM  K         K+ NWNKV+ K LD+  +W  + + E  + EM  +L E FST+    K++++   ++    T  KK KE KVLD K+GQNL+IL  S K+  EEIK+RIL +DEG LT   +  L+K +P  E L KL+ ++D Y +L E EQF   +S+IK L  RL+S LFKM+F E +SDIKP +V AT+AL EI++S  F K+LEL+L+ GN++NA S++ Q+V F ++FL KL +TK +    T++ F+   +  KYP ++ F +E  ++DKAA++S E+I   I  M +   DLE +L++  + +D ND +  VM+ FL     Q  L+S M K L++ +   AKYL+FD +KY MEEFF DIK FK+  ++A +  + A   E + +  R  + R + +K  R  + C+A      T E  + V+D+L   L +G+AF        G R+ PR       E    + R+ S+++F+ + ++
Sbjct:  158 NAILNSMASICNKNFYDPRAAYECVRCLKAFMNNTFGLKRILEHAEALSILSLALDHTDPPTMLEAVRCLAAICLVPPDGHDKVLGGITTAGDIL-HQDRFQPIIMGLKM---RDNPAMQVACIQLVNVIV-------TTPDDLD--FRLHLRNEFIRTGLDKVIESLSKFADEELNTQLHIFHEHRQHDSDEFMHRYDNVRLAFEDPYACFRLIMNTVRDTVAEPYFLSILQHLLYIRDDIFARPQYYKLIEECVTQIVLHRNGY--DPD------FRLTKRFPLEVEPLLSNLARCSKVEDTRAEKSIAEMTLKLEAALTAKQEAEAKAIGLEGKVQQYEMELLQLKEGKKQNIGDNISKALIRSPGNAASGASAQPPPAPPLPPLHAGLLPPPPPLPGMSPCVPAPPPLFAASPPTTQLPFGMAPKKKYSTNTQTKRLNWNKVNPKNLDKGSLWVNVREGEFESPEMFKKLEEMFSTKPPAKKELTE---AIEKRPT--KKSKELKVLDIKTGQNLSILLSSVKLSYEEIKQRILAVDEGNLTPGLLAQLIKCIPEPEVLKKLAALKDCYSDLAEPEQFAVVMSSIKRLVPRLSSILFKMRFPELVSDIKPDVVSATEALEEIKNSRRFAKLLELLLVMGNYLNAGSRNAQSVGFDVSFLSKLENTKSHDGNNTMLHFLAEILEKKYPDILGFLDETIHMDKAARISVESIQKNITSMGRQLKDLELDLRNLGKSADPNDKFGDVMKSFLKEAQSQHELLSAMYKKLENLYDNTAKYLAFDSKKYTMEEFFGDIKAFKNGLERALR--DNAKVREFQEKNRRALEAREKSDKERREKKLCQAAILDMTTDETQEGVMDSLFEILKTGSAFTVTREKRDGRRRTPRA---AGAERRAQLTRNLSKQNFENSALK 1042          
BLAST of Diaphanous, putative vs. TrEMBL
Match: A0A3Q0CRV1 (LOW QUALITY PROTEIN: protein diaphanous homolog 3 OS=Mesocricetus auratus OX=10036 GN=Diaph3 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 4.173e-112
Identity = 277/882 (31.41%), Postives = 465/882 (52.72%), Query Frame = 3
Query:  414 SNNGLNKLVIVLSHYIDNAEISLHCLK--------CLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFES-HANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDA-------VYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFND----PNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEI--LQTQKQPQTVNQTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPI-FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSD-NDNYFLVMQEFLVNVNEQLTLISE-MNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKE---IEIAIQNEHRRQKAREEQLRREMEKTERHTRQCK----ATQEDDKKVLDNLLVTLNSGNAFGNRKD--PRKKRLKKT 2954
             + GL  L+ +L   I N +I    +K        CL+A  N  YGL  +++ + +L  ++  ++ + P++M   ++LL+       ES    V+EAL    + +  I RF  I+ GL    HN    L + C+Q IN +V          S  DL +R+H+R EF+ CGL   L +L     + IK  +L  Q    DE +  + IEL   L++  A       VY ++  T+ QT  +    SIL+HL++++ D  IR   F+LI++ +S+++LH DGM  D T  +    +LT   +   D      Y +  +EL +K+ K   +  ET+ +L   E  +    +E+   ++   P  +   +MP     P PPP                               P+  PFG++ K   KP+  M++ NW+K+    +  NC W K+N+++    ++L +L   F  +    + V  + +       + K++KE K LD K  QNL+I   SF++P EEIK+ ILE+DE  L+++ ++NLLK LP +EQL  LS+ + DY NL E EQF  T+S +K L  RL++ LFK++F E++++IKP I+  + A  EI+ S++F K+LEL+L+ GN+MNA S++ QT  F ++ L KL D K    + TL+ F+V+    KYP +++F ++F++LDKA++VS E +   + +M +    LE+ L+ +    D +D + + M  F+ +  EQ   +SE ++ + Q     MA Y + D++K  +E+FF+D+  F+  F +A KE      A++ E R + A+E   R E E+ ER   + +     T+ D+  V+D+LL  L SG AF +R+   P++K ++++
Sbjct:  194 GHEGLGLLLDILEKLI-NGQIQERVVKKSQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAMDPKQPSMMADVVKLLSAVCIVGEESILEEVLEALTSAGE-ERKIDRFFFIVEGLR---HN-SVQLQVACMQLINALVT---------SPDDLDFRLHIRNEFMRCGLKEILPNL-----KCIKNDVLDIQLKVFDEHKEEDLIELSHRLEDIRAELDEASDVYSMVWDTVKQTRAEGYFVSILQHLLLVRNDQFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLTQFVDACIDQAKLEEYEEKASELCKKFEKEFTDHQETQAQLQKKEAMINELQAELQAFKSXAPPPPLPGMAMPFGGPVPPPPPLGQR-------------------------FPPLNLPFGLKPKKEFKPEISMRRLNWSKIGPNEMSENCFWVKVNENKYENTDLLCKLENTFCCQ----QKVKMNTNDFEEKKVIKKRIKELKFLDPKIAQNLSIFLSSFRMPYEEIKKMILEVDETQLSESLIQNLLKHLPDEEQLNSLSQFKSDYNNLCEPEQFAVTMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSNSFSKLLELVLLMGNYMNAGSRNAQTFGFDLSSLCKLKDIKSADQKTTLLHFLVDICEEKYPDILHFVDDFAHLDKASRVSVEMLEKNLKQMGRQLQQLEKNLETFPPPEDLHDKFVIKMSSFVTDTKEQYASLSELLDSMTQLHHSAMA-YYAVDMKKVSVEDFFNDLNNFRTTFMQALKENIKKREAVEKEKRARIAKE---RAEKERLERQLEKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKRKDIRQS 1022          
BLAST of Diaphanous, putative vs. TrEMBL
Match: A0A402FED2 (Uncharacterized protein OS=Paroedura picta OX=143630 GN=parPi_0017013 PE=4 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 8.306e-108
Identity = 262/877 (29.87%), Postives = 456/877 (52.00%), Query Frame = 3
Query:  402 INNESNNGLNKLVIVL-----------SHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFES--HANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQT-DTDDEDEYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNT----TELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQPQTVNQTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPK-DVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRR---QKAREEQLRREMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            + N    GLN L+ +L           SHY  +  I    ++CL+AF N  +G+ T++  +E +L ++  ++ + P++M  A++LL+           H  V+ AL   A+M + ++RF P+++GL  G       L + CLQ IN ++ P          LD  +RMH+R E +  GL   L  L + D+E +K  +  F+    +D  E   ++E + + + +   ++Q+L  T+  +  +    S+L+HL++I+ D   R   F+LI + IS+++L  +G+  D     +D  N+  + +   D   +  +     EL++K    L  +HE +V++   E+    K  E+LQ ++  +T  +                 +N+ +                +      P  PFG+  K   KP+  +++ NW+K+  + L ++C W K  +     +E+  +L   FS    + K     +N    S S   KKVKE +VLDSK+ QNL+I  GSF++P EEIK  ILE++E +LT++ V+NL+K +P  ++L  ++ M+++Y  L E EQFG  +S++  L  RLN+ LFK++F+E++ +IKP IV  T A  E+R S +F  +L +IL+ GN+MNA S +     F+I+FL KL DTK    + TL+ F+ +    KYP ++ F +E  +++KA +VS E +   +  MKK  +D+ R++ D+   ++  + F+  M  F+    EQ   +  M+  +++ ++E+ +Y  FD  K  +EEFF ++  F++ F +A KE      N+ RR   +K R  +L +E  + ER  +Q K  Q        D+  V+D+LL  L SG AF  ++ PR+
Sbjct:  137 VQNFGVEGLNCLLDILKSLHDEKEEASSHY--DTRIKHEVIRCLKAFMNNKFGIKTMLETEEGVLLLARAVDPKVPSMMTDAVKLLSALCILPHHEALHERVLGALTDRAEM-DEVERFKPLLDGLKSGTS---VVLKVACLQLINALIIP-------ADELD--FRMHIRSELMRSGLQQILKDLHSQDNEELKVQLSVFEEYGEEDSAELRGRLEDIRIEMDDFGEIFQILLNTVKDSKAEQHFLSLLQHLLLIRNDYDARPQYFKLIEECISQIVLQKNGVDPDFKCKHID-LNVEGLIDNLVDQTKVAKSEAKAIELEKKLESELTARHELQVEMKKKESDFEQKIQEMLQEKEVLET--EKRQIVSEKQSLENASSALNDEMAVLKKALEDAKKEMEQIAAASAAPALPFGLAPKRVYKPEVQLRRTNWSKITAQELSQDCFWVKTKEDRFEDDELFAKLTHTFSVAQSKSKTKKQQENGEEKSQSK--KKVKELRVLDSKNAQNLSIFLGSFRMPYEEIKSVILEVNEAVLTESMVQNLIKLMPEPDKLKMIAEMKEEYSELAEPEQFGVVMSSVPRLRPRLNAILFKLQFNEQVENIKPEIVAVTAACEEVRKSESFSNLLTIILLVGNYMNAGSMNAGAFGFNISFLCKLRDTKSADQKMTLLHFLADICELKYPDVLKFPDELIHVEKAGQVSGENLRKNLDLMKKQISDVRRDVADFPSATEEKDKFVEKMTSFVKEAEEQYEKLRMMHSNMENLYKELGQYFLFDTNKNLIEEFFTNLHNFRNMFLQALKE------NQKRRETEEKMRRAKLAKEKAEKERQEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQ 987          
BLAST of Diaphanous, putative vs. TrEMBL
Match: A0A5N3X0W1 (Uncharacterized protein (Fragment) OS=Muntiacus reevesi OX=9886 GN=FD755_021094 PE=4 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 2.065e-107
Identity = 269/850 (31.65%), Postives = 463/850 (54.47%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFES-HANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAF-QTDTDDEDEYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQ---LDGYNLTDV-FEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQ----------PQTVNQTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLV-MQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCK-------ATQEDDKKVLDNLLVTLNSGNAFGNRKD--PRKKRLKKT 2954
            ++CL+A  N  YGL  +++ + +L  ++  ++ + P +M   ++LL+       ES    V+EAL    + +  I RF  I+ GL    HN    L + C+Q IN +V          S  DL  R+H+R EF+ CGL   L +L +I ++ +   +  F +   +D  E+++++E +       + +Y +L  T+ +T  +    SIL+HL++I+ D  IR   F+LI++ +S+++LH DGM  D T  +   LD     D+  ++     + +  +EL +K+ K   +  ET+ +L   E ++    +E+   + Q          P +    + PP P PP PPPP      L   P+PPPPP G+      P L P  PFG++ K   K +  M++ NW K+  + +  +C W + N+++  + ++L +L   F  +         +         + K++KE K LDSK+ QNL+I   SF+VP EEIK  ILE+DE  L ++ ++NL+K LP QEQL  LS+ Q +Y NL E EQF   +S++K L  RL++ LFK++F E+++ IKP I+  + A  ++R S  F K+LEL+L+ GN+MNA S++ QT  F+++ L KL DTK    + TL+ F+V     K+P ++NF ++  +LDKA+KVS ET+   + +M +    LE++LK +    D+ + F+  M  F+++  EQ   +S++++ +   ++ +  Y + D++K  +E+F  D+  F+  F +A KE     + E + ++AR   + +E+ + ER  RQ K        T+ D+  V+D+LL  L SG AF +R+   P+ K ++++
Sbjct:   97 IQCLKALMNTQYGLERIMSEERSLSLLARAIDPEQPGMMMDVVKLLSAMCIVGEESILEEVLEALTTAGE-ERRIDRFSSIVEGLG---HN-SVQLQVACMQLINALVT---------SPDDLDVRLHIRNEFMRCGLKEILPNLKHIKNDGLDIQLKVFDEHKEEDLMEFSHRLEDIRAEFDEANDLYNMLWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLSQFVDICIDEAKLEEFEEKASELNKKFEKEFTDHQETQAQLQKKEAEINELQAELQAFKSQFGALPPGTCLPPSDGNGTGPPAPPPPPPPPPPGPPPPLGGGPVPPPPPLGLLSGQAAP-LPPTLPFGLKPKKEFKLETSMRRLNWLKIRPQEMTEDCFWVQANENKYESVDLLCKLENTFCCQP----KEKREEEDFEEKKAIKKRIKELKFLDSKTAQNLSIFLSSFRVPYEEIKMMILEVDEARLAESMIQNLIKHLPDQEQLNSLSQYQSEYSNLCEPEQFAVVMSSVKRLRPRLSAVLFKLQFEEQVNSIKPDIMAVSTACEDLRRSRGFSKLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKHPDILNFVDDLEHLDKASKVSVETLEKNLKQMGRQLQQLEKDLKIFPPPEDSHDKFVTKMSSFVISAKEQYEKLSKLHENMDKLYQNIMAYYAIDVKKVSIEDFLTDLNNFRTMFMQAMKENFKKREEEEKEKRAR---IAKELAEKERLERQQKKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKPKDIRQS 924          
BLAST of Diaphanous, putative vs. Ensembl Cavefish
Match: diaph2 (diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-GENE-090115-1])

HSP 1 Score: 263.077 bits (671), Expect = 5.271e-73
Identity = 151/483 (31.26%), Postives = 272/483 (56.31%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKAT------------QEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSR 2990
             P+G+Q K   KP   MK+ NW+K+  + +  NC W K+ + +    ++  EL+  FS++     +       L  ++   KK KE ++LD+K+ QNL+I  GSF++  EEI+  +LE+DE  L++  ++NL+K+LP Q++L+ L+ ++ +YE L E+EQFG  +S++K L  RLN  LFK+ F E++++I+P I+  T A  E++ S  F K+LE+IL+ GN+MN+ S++ QT  F+I+FL K+ DTK      TL+ F+  +    +P ++ F +E  +++ A+KVS + + +++  M++    LE +++++ +  D  + F+   E +    EQ   +S M+K +Q  +  +  Y +FD     +E+FF D+  F+  F  A K        E+ +++  EE+++R     E+  R+ +              + D+  V+D+L+  L SG AF +R+  R  R  K+   V     R++
Sbjct:  564 LPYGLQPKKTYKPDAAMKRINWSKIVPQEMAENCFWIKVKEEKFENPDLFTELSLSFSSKTRGRAEF------LFYFAQFKKKAKELRILDAKTAQNLSIFLGSFRLRYEEIRDIVLEVDEERLSEALIQNLIKNLPEQKELSSLAELKGEYEELCESEQFGIVMSSVKLLRPRLNGILFKLTFEEQVNNIRPDIMNVTFACEEVKKSEGFSKLLEMILLVGNYMNSGSRNAQTFGFNISFLCKIRDTKSADQNTTLLHFLAEKCEENFPEILKFPDELEHVENASKVSAQILKASLDTMERHIQRLENDIQNFPKTDDKQDKFV---EKIKYSREQYEKLSTMHKNMQKLYESLGSYFAFDPHAVSIEDFFGDLANFRMLFLDAVK--------ENHKKREMEEKIKRAKLAKEKAEREKQERQQKKKQLIDMNKEGDETGVMDSLMEALQSGAAFRDRRK-RTPRTGKSPATVYTPPYRTQ 1028          

HSP 2 Score: 105.916 bits (263), Expect = 4.133e-29
Identity = 82/317 (25.87%), Postives = 166/317 (52.37%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHAN-VMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDED--EYNNKIE-----LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYL----QNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEI 1400
            ++CL+AF N  YGL  ++ ++ +LL ++  ++ + P++M   +++L+       E+  + ++ A+ + A+ +N+ +RF PI+ GL+   ++    L   C+Q IN +V          S  DL +R+HLR EF+ CGL   L  L   ++ +I+  +    T+  +ED  E +++++     L  L  +   VY LL+  +  T+ ++   SIL+HL++I+ D  IR   ++++ + +S+++LH  GM  D    +    + T + ++  D   +    Q   E  +K+++    + E + ++   E K  IKA E+
Sbjct:  181 IQCLKAFMNNKYGLQRILGDERSLLLLARAIDPKQPSMMTEIVKILSAICIIGEENILDKILAAMTIAAE-RNNKERFAPIVEGLE---NHEAQQLQTACMQLINALVT---------SPDDLDFRIHLRNEFLRCGLKKIL-PLKETEELDIQLKVF---TENKEEDSIELSHRLDDIRLFLNSLCTDMGEVYHLLSNMVKDTSSETYFLSILQHLLLIRNDYIIRPQYYKVVEECVSQIVLHRSGMDPDFGYRERLDVDFTHLIDQCVDKAKVEESEQRAAEFSKKFDEEFSARQEAQAEMQKQEEK--IKALEM 478          

HSP 3 Score: 43.5134 bits (101), Expect = 4.133e-29
Identity = 32/99 (32.32%), Postives = 57/99 (57.58%), Query Frame = 1
Query:  127 DMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSP----SNYINTLVD---IVERQWAI--EKIIVKLDSLRVYLNSSPLSRV 396
            +++E E  ++F K M++MN+  D++ PL  + +  KR+++ Q  S++  S     S +  TL     + E +  I  EK++  L+SLRV L S+P+S V
Sbjct:   47 NLSEKEIVDLFEKMMEDMNLNEDRKAPLRGKDLSTKREMVVQYISATAKSGGLRNSKHECTLSSQEYVHELRSGITEEKLLNCLESLRVSLTSNPVSWV 145          
BLAST of Diaphanous, putative vs. Ensembl Cavefish
Match: ENSAMXT00000048841.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000111.1:974094:1004784:1 gene:ENSAMXG00000043629.1 transcript:ENSAMXT00000048841.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.32 bits (560), Expect = 6.349e-63
Identity = 131/387 (33.85%), Postives = 222/387 (57.36%), Query Frame = 3
Query: 1911 IKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDY-KQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRR-------EMEKTERHTRQCKATQ-------EDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSRRDFDKNLIQVTP 3026
            +K  ILE++E +L++  V++LLK LP QEQL+ LS M+D+Y++L E+EQFG  +S++K L  RL++ LF+++F E++++IKP +V  T A  E+  S NF K+LE+IL+ GN+MNA S++ +   F I++L KL DTK    + TL+ F+ +  +  YP +++F +E  +L+KA++VS ET+   + +M K    LE++++ +   Q++ D +   M  F+    EQ   +  M+  +Q  +  +  Y  FD +K   EE F D+  FK+ FQ+A       I+N+ RR+   EE++R+         ++ E   ++  A Q        D+  ++D LL  L SG AF  ++ PR+   ++     V N         K L+Q +P
Sbjct:    1 MKNVILEVNETMLSENMVQSLLKLLPEQEQLSVLSEMKDEYDDLAESEQFGVVISSVKKLKQRLSAILFRLQFEEQVNNIKPDVVAITAACEELVQSQNFSKLLEIILLVGNYMNAGSRNAKAFGFSISYLCKLRDTKSADQKQTLLHFLADTCQENYPDVMHFPDELIHLEKASRVSAETLQKNLDQMGKQIKSLEKDIETFPPPQNEKDKFVEKMTSFVATAREQFEKLEMMHSNMQKEYENLGTYFVFDPKKMSPEELFGDLNNFKNMFQQA------VIENQKRRET--EEKMRKAKLAREKAEKEKEERQKKMSAGQILDINDDGDETGIMDGLLEALQSGAAFRRKRGPRQAANRRGAGQAVTNI------LAKELLQESP 373          
BLAST of Diaphanous, putative vs. Ensembl Cavefish
Match: daam1b (disheveled-associated activator of morphogenesis 1 [Source:NCBI gene;Acc:103042845])

HSP 1 Score: 164.851 bits (416), Expect = 5.117e-41
Identity = 139/467 (29.76%), Postives = 232/467 (49.68%), Query Frame = 3
Query: 1611 KPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGL-LTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEG-TLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLEREL--KDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKE--IEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRK-KRLKKTENIVVINRSRSR 2990
            +P   +K  NW K+    L+   VW +++DS +     L ++ + FS    + K+  DD  +L+S     KKVKE  V+D +  QN  IL    K+  EE+KR IL +DE   L +  +E +LK +P +  +  L   + + + + +A++F   +S I H   RL S  FK KF+ERI++IKP +   T+A  E+  S N  ++LE++L  GN+MN   + N    F ++ L K+ DTK + ++  TL+ +++  +  KYP ++ F+ +   + +AAKV+   +   I  ++     +E EL  +  + Q   D +  V+ +F+   +   + + +     +  F +  K+   D  K   +EFF     F  +F +A +E       + E  R+   E QL+ + EK ER  R+ K   EDD    D+L+  L SG  F   KD  K KR +K  N       R R
Sbjct:  609 QPSNPLKSFNWAKLSENKLE-GTVWAEMDDSRVFKILDLTDIEKTFSAYQRQQKEAEDD--ALSS-----KKVKELSVIDGRRAQNCNILLSRLKLSNEEMKRAILTMDEQEDLPKDMLEQMLKFIPEKSDVDLLEEHKHELDRMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALTRASKEMLQSRNLKQLLEVVLAFGNYMNKGQRGN-AYGFKVSSLNKIADTKSSIDKNITLLHYLITILEKKYPKVMQFSEDLQNVPEAAKVNMTELEKEINNLRSGLKSVESELDFQKKRPQEVGDKFVSVVSQFVTLASFSFSDVEDSLNEAKELFEKAVKHFGEDSGKMQPDEFFGIFDQFLQSFTEARQENENMRRRKEEEERRARMEAQLKEQREK-ERKARKAKENGEDDGGEFDDLVSALRSGEVFD--KDLSKMKRNRKRINSQTTETGRER 1063          

HSP 2 Score: 76.2554 bits (186), Expect = 1.424e-13
Identity = 66/318 (20.75%), Postives = 147/318 (46.23%), Query Frame = 3
Query:  468 AEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLD--VGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQT-DTDDEDEYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVII----KDTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASE 1397
            ++I    + C++A  N   G   ++++ E++  ++  L  +        +E++          H  V+EA+    +  +   RF  ++N LD   G +  + +L    + FIN +++    +TS      L +R+HLR EF+  G+   +D L + ++  + +++  F+    DDE   + + E + +  ++   V+ L+ + +  T+      S+L H +++        ++Y L  L++ ++ +++L +D    DP +  L+ +N+ +V     + N ++   E  EK  K   + HE + K+   E +   K  E
Sbjct:  175 SQIHTSLIGCIKALMNNSQGRAHVLSHPESINIIAQSLATENIKTKVAVLEIMGAVCLVP-GGHKKVLEAMLHYQRFASERTRFQMLLNDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGETS------LEFRVHLRYEFLMLGIQPIIDKLRSHENSTLDRHLDYFEMLRNDDELTVSRRFESVHIDTKSASQVFDLIRKKMTHTDAYPHFMSVLHHCLLMPHKRSGNTVQYWL--LLDRIVQQMVLQNDK-GHDPDVTPLENFNVKNVVRMLVNENEVKQWKEQAEKMRK---DHHELQQKMEKKERECDAKTQE 479          
BLAST of Diaphanous, putative vs. Ensembl Cavefish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:NCBI gene;Acc:103039904])

HSP 1 Score: 160.229 bits (404), Expect = 1.677e-39
Identity = 125/473 (26.43%), Postives = 224/473 (47.36%), Query Frame = 3
Query: 1590 MQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGL-LTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEG-TLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQ---QSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIE-IAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSR 2990
            ++ KS  +P   +K  NW K+    +    +W  I+D        L E+ + FS    + K+      S++      +KVKE  V+D +  QN  IL    K+  EEIKR ILE+DE   L +  +E LLK +P +  +  L   + + E +  A++F   +S I H   RL S  FK KF+ER+++ KP +     A  E+  S    +ILE++L  GNFMN   + N    F ++ L K+ DTK + +   T++ +++      YP  +N   +   +  AAKV+   +   +  +K     LE EL+ Y+Q   +   D +  V+ +F+   +   + + ++    +  F +  K+   +  +   +EFF     F  +F +A +++E +  + E   ++AR E + ++  + ER  ++      ++    D+L+  L SG  F       K+  K++ N +V +  R R
Sbjct:  596 LRTKSIPQPSHPLKSFNWAKLGENKIT-GTIWHDIDDLRAFKVLDLKEIEKMFSAYQRQQKETG----SMDDLYLTSRKVKELSVIDGRRAQNCVILLSKLKMSNEEIKRAILEMDEREELAKDMLEQLLKFVPEKSDIDLLEEHKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFAERLAETKPKVEAILHASRELVRSKRLTQILEVVLAFGNFMNKGQRGN-AYGFKVSSLNKIADTKSSIDRSITMLHYLIMIFEKNYPDTLNIPQDLLSVPDAAKVNLAELEKEVYSIKSGLKGLEAELQ-YQQARVRDRGDKFVPVVSDFITVASFSFSELEDLLNEAKEKFMKALKHFGEEQGRMQPDEFFGIFDTFLQSFSEARQDLENMQRRKEEEEKRARMEAMLKDQRERERRAKKSAGGVSEEVGEFDDLVSALRSGEVFDKDLSKLKRNRKRSVNQLVESGGRER 1061          

HSP 2 Score: 72.0182 bits (175), Expect = 2.582e-12
Identity = 58/291 (19.93%), Postives = 134/291 (46.05%), Query Frame = 3
Query:  468 AEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLD--VGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQ-TDTDDEDEYNNKIEL-EVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVII--KDTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNTTELQEKYNK 1322
            + I    + C++A  N   G   ++ + +++  +S  L           +E+L        + H  V++A+    +      RF  ++N LD   G +  + NL    + FIN ++N    +       +L +R+HLR EF+  G+   +D L   ++  + +++  F+    +D+ E   + ++  V  ++   +++L+ + L  ++    L SIL+H + +  K        ++L++ ++ +++L  D    DP ++ LD +N+ ++     + N ++   +  EK+ K
Sbjct:  171 SRIHTSIIGCIKALMNNSQGRAHVLAHPQSINTISQSLRQDNIKTKVAVLEILGAVCLVP-DGHKKVLQAMAHYQKYAAERTRFQTLLNELDRSTGRYRDEVNLKTAIMSFINAVLNAGAGED------NLEFRLHLRYEFLMLGIQPVIDKLRGHENATLDRHLDFFEMVRNEDDSELAKRFDMTHVDTKSAGQMFELIKKKLSHSDAYPHLLSILQHCLQMPYKRGAGGIQQWQLLDRILQQIVLQDDK-GEDPDVSPLDNFNVKNIIRMLVNENEVKQWRDQAEKFRK 453          
BLAST of Diaphanous, putative vs. Ensembl Cavefish
Match: daam1b (disheveled-associated activator of morphogenesis 1 [Source:NCBI gene;Acc:103042845])

HSP 1 Score: 159.073 bits (401), Expect = 2.746e-39
Identity = 133/446 (29.82%), Postives = 222/446 (49.78%), Query Frame = 3
Query: 1674 NCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGL-LTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEG-TLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLEREL--KDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKE--IEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRK-KRLKKTENIVVINRSRSR 2990
              VW +++DS +     L ++ + FS    + K+  DD  +L+S     KKVKE  V+D +  QN  IL    K+  EE+KR IL +DE   L +  +E +LK +P +  +  L   + + + + +A++F   +S I H   RL S  FK KF+ERI++IKP +   T+A  E+  S N  ++LE++L  GN+MN   + N    F ++ L K+ DTK + ++  TL+ +++  +  KYP ++ F+ +   + +AAKV+   +   I  ++     +E EL  +  + Q   D +  V+ +F+   +   + + +     +  F +  K+   D  K   +EFF     F  +F +A +E       + E  R+   E QL+ + EK ER  R+ K   EDD    D+L+  L SG  F   KD  K KR +K  N       R R
Sbjct:  494 GTVWAEMDDSRVFKILDLTDIEKTFSAYQRQQKEAEDD--ALSS-----KKVKELSVIDGRRAQNCNILLSRLKLSNEEMKRAILTMDEQEDLPKDMLEQMLKFIPEKSDVDLLEEHKHELDRMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALTRASKEMLQSRNLKQLLEVVLAFGNYMNKGQRGN-AYGFKVSSLNKIADTKSSIDKNITLLHYLITILEKKYPKVMQFSEDLQNVPEAAKVNMTELEKEINNLRSGLKSVESELDFQKKRPQEVGDKFVSVVSQFVTLASFSFSDVEDSLNEAKELFEKAVKHFGEDSGKMQPDEFFGIFDQFLQSFTEARQENENMRRRKEEEERRARMEAQLKEQREK-ERKARKAKENGEDDGGEFDDLVSALRSGEVFD--KDLSKMKRNRKRINSQTTETGRER 928          

HSP 2 Score: 58.5362 bits (140), Expect = 3.975e-8
Identity = 47/252 (18.65%), Postives = 116/252 (46.03%), Query Frame = 3
Query:  468 AEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLD--VGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQT-DTDDEDEYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVII----KDTPIRYNLFRLINDVISELILHSD 1199
            ++I    + C++A  N   G   ++++ E++  ++  L  +        +E++          H  V+EA+    +  +   RF  ++N LD   G +  + +L    + FIN +++    + S         ++HLR EF+  G+   +D L + ++  + +++  F+    DDE   + + E + +  ++   V+ L+ + +  T+      S+L H +++        ++Y L  L++ ++ +++L +D
Sbjct:  175 SQIHTSLIGCIKALMNNSQGRAHVLSHPESINIIAQSLATENIKTKVAVLEIMGAVCLVP-GGHKKVLEAMLHYQRFASERTRFQMLLNDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGEVSYVR------KVHLRYEFLMLGIQPIIDKLRSHENSTLDRHLDYFEMLRNDDELTVSRRFESVHIDTKSASQVFDLIRKKMTHTDAYPHFMSVLHHCLLMPHKRSGNTVQYWL--LLDRIVQQMVLQND 417          
BLAST of Diaphanous, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000125.1 (pep scaffold:Pmarinus_7.0:GL476709:11284:97599:-1 gene:ENSPMAG00000000108.1 transcript:ENSPMAT00000000125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.182 bits (718), Expect = 2.857e-79
Identity = 155/465 (33.33%), Postives = 264/465 (56.77%), Query Frame = 3
Query: 1572 PIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL--VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA--------TQEDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P  PFG+Q K   KP+   K+ANW K+  +    N  W K  +      ++L +L + F+ +A + +   +            KK+KE KVLD KSGQNL+I  G+ K+P  EIK+ ILE++E  +T++ ++NL+K LP  +QL  L+  +D+Y++L EAEQF   + ++  L +RL +  F ++F E++S +KP +V  T A  E++ S  F ++LE++L+ GN+MNA S++ QT  F+I++L KL DTK    + TL+ F+      +YP ++ FT + S+++KA++VS E +   + +M+     LE++++ +    D ++ F+  +   F+    EQ   ++ M   +Q+ F  + +Y  F+ +K  +EEFF D+  F+  F +A K+     + E + QKA   QL +E  + ER  +Q K         T  D+  V+D+L+  L SG AF  ++ PR+
Sbjct:  731 PGLPFGLQPKKEYKPEISTKRANWAKIRPEEFKENSFWTKAKEERFENPDVLSKLAQTFAAQAAKVRAQKEQEGVEKDKPPSKKKIKELKVLDQKSGQNLSIFLGTLKMPYTEIKKIILEVNEEKITESMIQNLIKQLPEADQLEALAGFKDEYDDLAEAEQFSVVIGSVTRLRSRLTAIQFMLQFEEQVSSVKPDVVAVTAACEEVQQSDAFSRLLEIVLLFGNYMNAGSRNAQTFGFNISYLCKLRDTKSADQKQTLLHFLAEVCEAEYPEVLKFTEDLSHVEKASRVSAENLQKNLKQMENQIEQLEKDIQSFPSTEDKNDKFVEKMTISFMRKAREQYGRLALMFDNMQTLFDGLGEYFVFNTKKVSVEEFFGDLTNFRSMFMQAVKDNVRRREAEEKIQKA---QLAKERAEKERLEKQNKKRLLLLKMHTDGDETGVMDSLMEALQSGAAFKRKRAPRQ 1192          

HSP 2 Score: 107.457 bits (267), Expect = 2.387e-30
Identity = 79/264 (29.92%), Postives = 131/264 (49.62%), Query Frame = 3
Query:  474 ISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFT------FYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQS-NLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDA--------VYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDP 1217
            I L  ++CLRAF N   GL  ++     +L ++  +  ++P++M  A+ LL+  +      F   +  + V++AL   A++    +RF PI+ GLDV    +QS +L I C   IN +V          +  DL +R+HLR EF+  GL   L  L  I +E ++  +  F     DE    +  +    LQ+  A        VY  L+ T+  T  +    SI++HL++I+ D  +R   FRLI + +S+++LH  G  +DP
Sbjct:  176 IQLEIVRCLRAFMNNKVGLRAMLATHNGVLLLARAVEPRHPSMMVEAVRLLSALSILDEDHFDGAKPSSRVLDALAECAEICEQ-ERFQPIVEGLDV----KQSLSLKIACFILINALVE---------TPEDLEFRIHLRNEFMRNGLGKALTHLREIQNEQLEVQLRVF-----DEGREGDFQDFSQRLQDIRAFVCTDINDVYAFLSNTVKDTQAEQPFLSIMQHLLLIRNDFLVRPQYFRLIEECVSQVVLHRGG--VDP 418          

HSP 3 Score: 43.5134 bits (101), Expect = 2.387e-30
Identity = 34/117 (29.06%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  124 DDMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSSSET----------SPSNYINTLVDI--VERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            DD+TE +    F K +++MN+    + PL  +  + KR ++ Q + SSS+T          S  +YI  L  +  +E     E+++  L+SLRV L S+P+S V+      + +L++
Sbjct:   42 DDLTEDQIHTFFEKMLEDMNLSEAHKAPLRHKDEKTKRDMVLQYMASSSKTGGTHKRDTALSGKDYITELTGLRKMEHDSDQERLLSCLESLRVSLTSNPVSWVELFGDEGLKILLD 158          
BLAST of Diaphanous, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001778.1 (pep scaffold:Pmarinus_7.0:GL479130:173791:184898:-1 gene:ENSPMAG00000001611.1 transcript:ENSPMAT00000001778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.734 bits (478), Expect = 1.762e-54
Identity = 89/227 (39.21%), Postives = 151/227 (66.52%), Query Frame = 3
Query: 1872 AILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL 2552
            AI  GSF++  +EIK  IL +DE  +T++ +++L+  LP  EQL+ L+ ++++YE+L E EQFG  +S++K L  RLN+ LF+++F E+++++KP IV  + A  EIR S +F K+LEL+L+ GN+MNA S++ QT  F + FL KL DTK N  + TL+ F+      K+P ++ FT E ++++KA+ V+ E +  ++ +M+K    LE +L+ +    D+ + F+
Sbjct:    1 AIFLGSFRMDYQEIKSIILSVDEERITESMIQSLINQLPEPEQLSALASLKNEYEDLCEPEQFGVVISSVKRLRPRLNAILFRLQFDEQVANLKPDIVAVSAACEEIRRSDSFSKLLELVLLMGNYMNAGSRNAQTFGFQMGFLCKLKDTKSNDQKLTLLHFLAQMCEEKHPDVLRFTEELTHVEKASTVAAENLQKSLKQMEKQVQQLEGDLRAFSTTDDDTDKFV 227          
BLAST of Diaphanous, putative vs. Ensembl Sea Lamprey
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 131.724 bits (330), Expect = 1.810e-31
Identity = 104/398 (26.13%), Postives = 195/398 (48.99%), Query Frame = 3
Query: 1821 KKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGL-LTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGT-LMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVS----NETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEI--EIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSR 2990
            K+ KE  V+D +  QN  IL    K+  EEIKR ++ +DE   L +  +E LLK +P +  +  L   + + E +  A++F   +S I H   RL +  FK KF+ER+ + KP +     A  E+  S    ++LEL+L  GN+MN   + N    F I+ L K+ DTK + ++   L+ +++  V  K+P ++  +++  ++ +AAKV+     + I++  + +K ++ +L  E +     +  D +  VM +F+   +   + + ++    +  F +   +   +  +   EEFF     F   F  +  E+      + E  R+   E QL+ + E+ ER  ++ +    ++    D+L+  L SG  F       K+  K++ NI +++ SR R
Sbjct:  560 KRAKELSVIDGRRAQNCVILLSKLKMSNEEIKRALMRMDEQEELPKDMLEQLLKFVPEKSDVDVLEEHRHEIERMARADRFLFDMSRIPHYQQRLQALFFKKKFAERLGECKPKVEAILLASREVSRSRRLRQLLELVLALGNYMNKGQRGN-AYGFKISSLNKIADTKSSTDKNINLLHYLIIVVEKKFPDVLGISDDLQHVPEAAKVNLTEMEKEINNIKIGLKAVEAEL--EFQRTHASAIGDRFISVMSDFITVASFSFSELEDLLSEAKEKFNKSVSHFGEEGGRTQPEEFFGMFDAFLSAFGDSRLELEAMRRRKEEEERRARVEAQLKEQRER-ERRAKKARQGSTEEGGEFDDLVSALRSGEVFDKDLSKLKRNRKRSGNI-LLDASRER 952          

HSP 2 Score: 63.929 bits (154), Expect = 1.657e-10
Identity = 61/295 (20.68%), Postives = 138/295 (46.78%), Query Frame = 3
Query:  462 DNAEISLH--CLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLD--VGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQ-TDTDDEDEYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVII--KDTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNTTELQEKYNK 1322
            + AE  +H   + C++A  N   G   ++ + E++  +S  L+++    + + +E+L          H  V++A+    Q          +I  LD   G +  + +L    + FIN I+N      +     +L +R+HLR EF+  G+ + +D L + ++  + +++  F+    +DE E   + + + +  ++   ++ ++ R L  T     L SIL H + +  K + +    ++L++ ++ +++L S+    DP +  L+ +N+ ++     + N ++   E  EK  K
Sbjct:   25 ETAESQIHTSVIGCIKALMNNSQGRAHVLAHPESINVISQSLSSENATKVAV-LEILGAVCLVP-GGHRKVLQAMLRYQQHAAERTLLQTLITELDRNTGKYRDEVSLKTAIMSFINAILN------AGTGQENLEFRVHLRYEFLMLGIQSLVDKLRSHENATLDRHLDFFEMIRNEDEAELAKRFDMMHIDTKSAGQMFDVIKRKLKFTEAYPHLMSILYHCLHMPYKKSSVMVQHWQLLDRILQQIVLQSE-RGDDPDVAPLENFNVKNIVRMLVNENEVKQWKEQAEKMRK 310          
BLAST of Diaphanous, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010867.1 (pep scaffold:Pmarinus_7.0:GL477036:280430:297830:1 gene:ENSPMAG00000009847.1 transcript:ENSPMAT00000010867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 1.888e-28
Identity = 79/271 (29.15%), Postives = 142/271 (52.40%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFE-SHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQS-NLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDE-----DEYNN-KIELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLN-----QLDGYNLTDVF 1259
            ++CL+AF N  YGL+ +++ ++ +L ++  +   YP +M  A++LL+       E +H  ++EAL    + +N  +RF  I+ GL      RQ   L + C+Q IN ++       ++   LD  +R+HLR EF+ CGL   L  L   +DE     +  F+ + +D+       Y + + ELE   +    V+Q+++  +  T  +    SIL+HL++I+ D  +R   ++LI + +S++ILH +G  +DP        QL+  +L DV 
Sbjct:  177 VRCLKAFMNNKYGLMRMLSEEQGILLLARAIEPAYPPMMADAVKLLSALCILEEERTHERILEALTQCGEQENR-ERFSTIVKGLG----QRQGLQLKVGCMQLINALL-------TSVDELD--FRLHLRNEFMRCGLVDILQDLIVSNDEPQDVQLRVFEENREDDFVELSHRYEDIRFELEYPFE----VFQIVSNIVKDTLAEPYFLSILQHLLLIRNDYFVRPQYYKLIEECVSQIILHRNG--VDPDFRHGKRFQLEVEHLVDVL 427          

HSP 2 Score: 39.6614 bits (91), Expect = 1.888e-28
Identity = 31/114 (27.19%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  130 MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQ-IHSSSE-----------TSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLIN 435
            ++E E   +F K M++MN+    + PL  + +  KR+++ Q I+++++           TS   YI+ L   ++     E+++  L+SLRV LNS+P+S V+      + +L++
Sbjct:   45 LSEKEVLALFEKMMEDMNLNETHKAPLRQKDLVIKREMVMQYINAAAKSGLKSRSDHALTSSQEYIHELRAGIQD----ERLLGCLESLRVSLNSNPVSWVENFGHEGLGLLLD 154          
BLAST of Diaphanous, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010834.1 (pep scaffold:Pmarinus_7.0:GL476428:81056:119857:-1 gene:ENSPMAG00000009817.1 transcript:ENSPMAT00000010834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 6.624e-27
Identity = 108/406 (26.60%), Postives = 192/406 (47.29%), Query Frame = 3
Query: 1587 GMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNE---AEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQ 2795
             ++IK  +K K  M   NW  +    ++   V+ +++D ++     + E  E F TRA      +  +  L+    + K   +  +L++   +NLAI      +  EEI R I   D   L    VE L + LP + ++  L + + + + L+E    ++F    S I+ L  R+   +F   F+E +  + P +     A   I+ S    KILE+IL  GN+MN SSK      F +  L  LI+TK    + TL+ +I N V++KYP L+ F NE  Y++KAA VS E +   + E+++     +RE   ++  +       +++EFL     +L  +    K  Q ++  + +Y   + +  P   FF  +      F KA K+ E+  + + R+++A +E+
Sbjct:  616 AVRIKKPIKTKFRMPVFNWVALKPNQIN-GTVFNELDDEKILEELDMDEFEEMFKTRA----QGATVDLCLSKIKMVHKTQNKVTLLETNRAKNLAITLRKGGLTTEEICRAIQMFDLQTLRLDFVECLTRFLPSEAEVKLLRQYERERKPLDELADEDRFMLQFSKIERLTQRMTIMIFIGNFTENVQMLTPQLNAIIAASMSIKSSHKIKKILEIILAFGNYMN-SSKRGAVYGFKLQSLDLLIETKSTDRKLTLLHYISNIVQHKYPDLVTFYNELRYIEKAAAVSMENVLQDVRELQRGMDLTKREFSMHESNT-------LLREFLAPSEARLERLLSDTKTAQEAYNTVVQYFGENPKTTPPSVFFPLLV----RFVKAYKQAELDNEMKRRQEEALKEK 1004          

HSP 2 Score: 62.3882 bits (150), Expect = 5.050e-10
Identity = 43/162 (26.54%), Postives = 79/162 (48.77%), Query Frame = 3
Query:  486 CLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNL--LIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAF 965
            C+ CLRA  N  YG   ++ + + +  ++L LN + P    L +ELL          H  ++ A     ++    QRF  ++        N  SN+  ++ C+QFIN++V+         S  D+ +R+HL+ EF    L++YL+ L + + + ++  I A+
Sbjct:  187 CIMCLRAIMNYQYGFNMVMAHPQCVNEIALSLNNKNPRTKALVLELLAAVCLVR-GGHEIILSAFDNFKEVCGEKQRFERLMEYF----RNEDSNIDFMVACMQFINIVVH---------SVDDMNFRVHLQYEFTKLALDSYLEKLKHTESDKLQVQIQAY 334          
BLAST of Diaphanous, putative vs. Ensembl Yeast
Match: BNI1 (Formin; polarisome component; nucleates the formation of linear actin filaments, involved in cell processes such as budding and mitotic spindle orientation which require the formation of polarized actin cables; recruited to the division site in a Glc7p/Ref2p dependent manner following release of Bnr1p; functionally redundant with BNR1 [Source:SGD;Acc:S000005215])

HSP 1 Score: 59.6918 bits (143), Expect = 2.678e-9
Identity = 80/348 (22.99%), Postives = 145/348 (41.67%), Query Frame = 3
Query: 1959 NVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERE-----LKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFRE-MAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHR----RQKAREEQLRREMEKTER----HTRQCKATQEDD----KKVLDNLLVTL-NSGNAFGNRKDPRKKRL 2945
             V NL  + PP++    L R    Y  L         ++   +  +R+ +      +    +++   +    +A++ ++ S N   +  +IL  GNFMN +SK  Q   F ++ L +L   KD  N  T + ++   VR  YP   +F +E   +    KVS E + +   +  +   ++ER      L D  +    D   +     L    ++  L+ +  K+    F   M  Y      K+    FF     F + ++KA  +  +A + E R     +K  EEQ +R  EK ++    ++   +  +ED+    + V+D LL  L N+G A  +    RK+ L
Sbjct: 1490 GVRNLEDAKPPEKDPNDLQRADQIYLQL--------MVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQ--GFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQ-NLAAEEEERLYIKHKKIVEEQQKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSDPSSARKRAL 1826          
BLAST of Diaphanous, putative vs. Ensembl Nematostella
Match: EDO35335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLQ1])

HSP 1 Score: 283.878 bits (725), Expect = 1.166e-80
Identity = 181/483 (37.47%), Postives = 274/483 (56.73%), Query Frame = 3
Query: 1578 FPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLI-NFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDN--DNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKE-------IEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKR--LKKTENIVVINRSRSR 2990
             P G   K   KP+  MK+ANW K++ + +  NC WKK+N+ ++   +ML EL   F+ ++  PK + D+       S   KK KE KVLD KS QNL+I  GS K   EEIK  IL  D+  L+++ +E+LLK LP  EQ+ +LS M+D    L+E EQF   +S IK L  RLN  LF+ +F E +SD KP +V AT A  E++ S  F K+LELIL+ GN+MN  S++  T+ F I++L KL  TK    +  L+ FI + V NKY   I  F NE  +++ A KVS E +  +I  M      +E+EL + KQQ+ N  D +   M+EF  +  +Q+ ++ EM+K + + F+++ ++   D +K  MEEFF D+K F D + +  KE        E   + + R +K +E + R E EK++R+        ++ + VLD L+  L +G+AF +   P +K+   KK      ++RSR+R
Sbjct:  490 LPPGFAPKKKYKPEAQMKRANWTKINNRNITDNCFWKKVNEEKLEREDMLAELTRTFAAKS-APKKL-DNPDGEEKKSVAKKKAKELKVLDPKSAQNLSIFLGSLKSSHEEIKSHILHCDQEKLSESAIESLLKYLPSPEQMEQLSNMKDQISELSEPEQFAVHISDIKKLEQRLNCLLFRTRFPEEMSDTKPGVVNATAACREVKTSPKFAKLLELILLMGNYMNTGSRNEGTIGFEISYLTKLSSTKSVDGQRNLLHFIADAVENKYSSEIAGFENELGHVEAAGKVSEEILGKSISNMSANLRKIEKEL-EAKQQNTNPEDRFHDAMKEFYSSAKDQVDVLVEMHKNMVTMFKDVLEFFCMDPKKTSMEEFFGDLKTFMDQYSQCKKENMKRQEKEEKEKRAKERAEKEKERKSRMENEKSKRNPLVDMNADDNQEGVLDGLMQALQTGSAFRDPTRPARKKNPAKKGTRPANLSRSRTR 969          

HSP 2 Score: 111.694 bits (278), Expect = 5.485e-25
Identity = 72/252 (28.57%), Postives = 137/252 (54.37%), Query Frame = 3
Query:  474 ISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNI--DDENIKQYILAFQTDTDDEDEYNNKI-ELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDP 1217
            I   C++CL+A+ N  YGL  ++ +++ L  ++  ++  YP++M   ++++          H   +EA+ +  +++    RF  I++ L    H+  ++L + C+QFIN ++       ST  +LD  +R+HLR EFV  GLN     L ++  DD N++  I     D DD  E+ +++  + V  ++   ++ +LN  +  T  D+   SIL+HL++I+ D   R   ++LI +V+S+++LH  G  +DP
Sbjct:  109 IQHECVRCLKAYMNNKYGLQLMLKSEDGLTLLARSMDPNYPSMMTDVVKVMAAVCLV---KHDRAVEAMTVCGELEEK-GRFSKIVDAL----HDDHTSLKVACIQFINALI-------STPDDLD--FRLHLRNEFVREGLNDAFQDLRDLENDDLNVQLDIWEEHRD-DDASEFQHRLNNIMVNFEDPGEIFSILNNLVQDTAADNLFLSILQHLLLIRDDVYARPQYYKLIEEVVSQVVLHRSG--VDP 340          
BLAST of Diaphanous, putative vs. Ensembl Nematostella
Match: EDO32868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU3])

HSP 1 Score: 157.918 bits (398), Expect = 3.156e-39
Identity = 127/459 (27.67%), Postives = 224/459 (48.80%), Query Frame = 3
Query: 1611 KPKGLMKKANWNKV-DIKLLDRNCVWKKINDSEMNTNEM-LMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGL-LTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEG-TLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDY----KQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKE---------------IEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGN 2918
            KP   +K  NW+K+ D K+  +  VW  I+D+++  NEM L + +  FS  A++ K+    N  +  ++    K KE  ++DS+  QN  IL    K+  EEI + IL +DE   L++  VE LLK +P   +   L+    + +N   A++F   +S I H   RL +  FK KF ER+ D+KP +     A  E+  S     +LE+IL  GN+MN  ++ N T  F +  L +++DTK + N   TL+ ++V  +   YP ++    + + +  AAKV+   + S IV ++K   ++E+EL D+    +++   D +  V+  F+         + E  + L+  F +  K    D +    ++FF    +F  +F +A  +                 +A Q E  RQK+    +++ M   ++ +   K    D++   D+L+  L +G+ FG+
Sbjct:  682 KPSNPLKSFNWSKLPDSKI--KGTVWTDIDDTKV-YNEMDLEDFDRMFS--AYQGKE----NQGIKDFTDSAAKPKELSLIDSRRAQNCGILLTKLKLSDEEITKAILTIDEEEELSKDMVEQLLKYVPTAAEKNLLNENNKEKDNFARADKFLYDMSRIVHYEQRLKALFFKKKFPERMGDLKPKVQAVIMACKEVTRSKRIRTLLEVILAFGNYMNRGARGNAT-GFKLASLNRIVDTKSSANSRITLLNYLVTVLEKSYPDVLKLEEDLANVRTAAKVNLAELESEIVALRKELKEVEKEL-DFQTRKREKIPGDKFVDVIGSFVKVAQFSCCEVEEAWEELKQKFFKAVKLFGEDPKNLSSDQFFGIFNVFLVSFAEAKHQNEEIKKKKEAEERKRRALAEQKERDRQKS---AIKKMMTPDKKQSASQKKVNTDNRGEFDDLISALRTGDVFGD 1126          

HSP 2 Score: 50.8322 bits (120), Expect = 3.394e-6
Identity = 41/216 (18.98%), Postives = 90/216 (41.67%), Query Frame = 3
Query:  447 LSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLD--VGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQ-TDTDDEDEYNNKIELEVL-LQNRDAVYQLLNRTLCQTNC 1082
            + +    ++I    + C +A  N  +G   ++ +   +  ++  L  +        +E+L          H   ++A+    +      RF  ++N LD   G++  + NL I  + FIN  +              L +R+HLR EF+  G+   ++ L  +D+  + +++  F     +DE E   +  +  + L++   + +LL R +  T+ 
Sbjct:  180 MDYETSQSKIHTAVIGCFKALMNSSHGRAHVLAHPTCIDIIAQSLLTENIKTKIQVLEILGAVCLVP-GGHKKALDAMTHFQKFAEERTRFQTLVNDLDRSTGVYKEEFNLKIAIMSFINAALK------YGAGAEYLEFRVHLRFEFLMLGIQPVIEKLRTMDNATLTRHLNFFDMVRNEDEKELARRFGMPYIDLRSASGMLELLRRKVGHTSA 388          
BLAST of Diaphanous, putative vs. Ensembl Nematostella
Match: EDO48258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJG3])

HSP 1 Score: 106.686 bits (265), Expect = 9.769e-24
Identity = 100/382 (26.18%), Postives = 181/382 (47.38%), Query Frame = 3
Query: 1629 KKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFK----VLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQD-DYENLNEAEQFGCTLS-TIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEG-TLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLEREL-KDYKQQSDNDNYFL-VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIE 2747
            ++ +W  V    L++  +WK+++  E+       EL   F  +A  PK               P+  K+      +L+ K   N++I     K+ A+++K+ +L     L +   +E LL+ +P   ++  L R ++ D   L  AE F   ++ T+     R+ + L K +  +RI+ IKP +    +A  EIR+S+     L+++L  GNFMN S    QT  F + FL KL+  K   ++  + +++I  Q+  K P L   T+E  +++KA+KVS  T+   I E+++    LE +L K  K +   D+ F+  ++ F  +   Q   + E+    + SF    +Y   +       +FF  I  F  +F+ A K+I+
Sbjct:  255 RRLSWEIVSHSSLNKETIWKRLSVEEVVDP---YELEMYFGAQATVPK---------------PRHFKKITHRKTILEHKKILNISITLAHSKLSADDVKKCLLSGTSDLPSDV-LEQLLRFVPSPNEIKALKRQEEVDPSALEGAEVFCLEVAKTVPAYEERIRTMLLKAQLQDRINHIKPYLTTVIEANKEIRNSTKLSDYLQMVLTVGNFMNGS----QTAGFRVAFLTKLVFIKSTPDKNVSFLDYITRQIIRKNPELALLTDELLHVEKASKVSFRTLDLDIEELREEVEILEDDLDKIAKTEIHEDSKFMEAIELFTHHARAQFQSLVELRHQAELSFATTLEYFG-EETSISSAQFFGLISTFLCHFKDAVKKIQ 612          
BLAST of Diaphanous, putative vs. Ensembl Nematostella
Match: EDO27387 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9E0])

HSP 1 Score: 94.7449 bits (234), Expect = 2.656e-22
Identity = 60/175 (34.29%), Postives = 90/175 (51.43%), Query Frame = 3
Query: 1842 VLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVN 2366
            +LD K   NL I    FK   EEI   I++ D  +     ++  +K LP   ++  L     D + L  AE+F   L  +K    R+N+ L K +    +  +KP I C  +A+ EI +S    ++L+LILI GNFMN+       +AF I+ L KL+DT+ N+    LM F+VN
Sbjct:    3 LLDPKRSLNLNIFLKQFKKSNEEIISTIVKGDSKVFDVDVLKGFIKLLPDNSEVEMLKGFNGDTKMLGSAEKFLIELIAVKSYELRINAMLQKAELDINLQTLKPNIECMKKAIEEILNSETLPEVLQLILIIGNFMNSGGYAGNAIAFKISSLVKLVDTRANKPRMNLMHFLVN 177          
BLAST of Diaphanous, putative vs. Ensembl Nematostella
Match: EDO36709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHT8])

HSP 1 Score: 93.2041 bits (230), Expect = 3.572e-19
Identity = 80/335 (23.88%), Postives = 161/335 (48.06%), Query Frame = 3
Query: 1824 KVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYEN--LNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLV---MQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFD---IQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRR 2804
            K KE  VLD K  Q + I       P   +K+ I+ +D  ++ +  V+ LL+  P  E+  K+   Q    +  L  AEQF  T++++  L  RL+ + FK+ +     ++   ++   +AL E+  ++ F  IL  +L  GNF+N      +   F +++L K+ + KD  ++ +L+  +   V  K+P   +  +E   L ++++V  E ++     +K +K + +R  +     + +D+   +   M E L +  E++T++  +++ + + FR+M  YL       +K  + EF   I  F   ++   + +    + + +R+K RE  L R
Sbjct: 1052 KRKEIVVLDVKRSQQINIALTKLP-PIRTLKQAIISMDSTVIDREGVDKLLQMQPLPEEKMKIQEAQLANPDVPLGTAEQFLLTMASLNELAPRLHLWAFKLDYEMLEKEVAEPLMDLKEALEELNKNNTFKHILATLLAIGNFLNG----KKVKGFQLDYLSKVPEVKDTVHKQSLLYHLCCMVMEKFPDTTDLYSELGALHRSSRVDFEVVAEN---LKNLKENCKRSWEHLSVVAKHDSTKQLKSKMTELLTDAQERITILKVVHRRVMNRFRKMLLYLGVSASITKKTKVNEFCKIISEFSLEYRTTRERVR---EQKKKREKLRERNLTR 1375          
BLAST of Diaphanous, putative vs. Ensembl Medaka
Match: diaph3 (diaphanous related formin 3 [Source:NCBI gene;Acc:101155017])

HSP 1 Score: 343.199 bits (879), Expect = 2.129e-100
Identity = 253/865 (29.25%), Postives = 459/865 (53.06%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFE-SHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDED--EYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDP----NYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEI--LQTQ-----------KQPQTVNQTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPIFPFGMQIKS--------NLKPK------GLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSD-NDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA----TQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTEN 2960
            ++CL+AF N  YGL  ++  + +L  ++  ++  +  +M   ++LL+       E +   ++EA+    + ++ I+RF PI+ GL     +R   L + C+Q IN +V          S  +L +R+H+R EF+ CGL   L  L  I +E +   +  F+ +  +ED  E+++++E +   L +   V+  +   +  TN +    SIL+HL +I+ D  +R   F++I + IS+++LH  G   D T  +    + + + E   D      + Q  +EL +K+++ L  + E + +L   E K+    +E+   +TQ           +QP + + T++     P  PPPP P       P  P  PPP  PPP       P   FG    S         L+PK        MK+ NW+K+  + +   C W + ++++ +  E+L  +   F ++    + V  +        ++ K+++E KVLD K  QNL+I  GSF++P EEI+R I+E+DE  LT+  ++NL+K LP QEQL  L++ + +Y +L+E EQFG  +ST+K L  RL+  LF+++F E++++++P I+    A  E+R S +F ++LEL+L+ GN+MNA S++ Q+  F ++ L KL DTK    + TL+ F+      ++P +I F ++  ++D+A++VS E +  ++ +M++    LER+L+ +    D +D +F+ M  F     +Q + +  ++  +++S++ + +Y + D +K  +EE F D+  F+  F +A KE     + E ++++AR  + + E EK ER  ++ +      + D+  V+D LL  L SG AF   +D RK+  +  EN
Sbjct:  216 VQCLKAFMNNKYGLDRILGEERSLSLLARVIDPTHSAMMTDVVKLLSAICIVGEENTLEKILEAITTAGEWRS-IERFSPIVRGL----RDRSVQLQVACMQLINALVT---------SPDELDFRLHIRNEFMRCGLKEILPQLGTIRNEALDIQLKVFE-EHKEEDMMEFSHRLEDIRSELDDAGDVFSFVQSMVKDTNAEPYFLSILQHLALIRNDYLVRPQYFKIIEECISQIVLHRSGTDPDFTYRKRLDVDFSHLLEVCTDKARIEEFEQRASELAQKFDEELLRRQEAQAQLGKYEEKIAELQTELQACRTQFGSIPVTFTQGEQPSSSSTTAVAGSSVPGPPPPPPPPPPPPPPPGWPSAPPPPGPPPQFGVPPPPPLVFGGAFGSPTHDTLPYGLRPKKEFKLETGMKRLNWSKIRPQEMSEGCFWVRADENQYSKPELLSRVALTFGSQ----RTVKKEEEDTEDKKSIKKRIRELKVLDPKIAQNLSIFLGSFRMPYEEIRRMIVEVDEEQLTEPMIQNLVKHLPEQEQLNALAKYKSEYSSLSEPEQFGVVMSTVKRLRPRLSHILFRLQFEEQVNNLRPDILAVNAACEEVRRSLSFGRLLELVLLLGNYMNAGSRNAQSYGFDLSSLCKLKDTKSADQKTTLLHFLAQICEEEFPDVIKFVDDLEHVDRASRVSAENVEKSLRQMERQLLQLERDLETFSSPDDQSDMFFVKMASFSKGARDQYSKLVTVHSKMETSYQNILEYFAVDPKKTSVEELFTDLSNFRSMFTQALKENFKQRELEEKQRRARVAKEKAEREKLERQQKKRRLLEVNAENDETGVMDCLLEALQSGAAF---RDRRKRAPRPREN 1058          
BLAST of Diaphanous, putative vs. Ensembl Medaka
Match: diaph3 (diaphanous related formin 3 [Source:NCBI gene;Acc:101155017])

HSP 1 Score: 343.199 bits (879), Expect = 2.129e-100
Identity = 253/865 (29.25%), Postives = 459/865 (53.06%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFE-SHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDED--EYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDP----NYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEI--LQTQ-----------KQPQTVNQTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPIFPFGMQIKS--------NLKPK------GLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSD-NDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA----TQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTEN 2960
            ++CL+AF N  YGL  ++  + +L  ++  ++  +  +M   ++LL+       E +   ++EA+    + ++ I+RF PI+ GL     +R   L + C+Q IN +V          S  +L +R+H+R EF+ CGL   L  L  I +E +   +  F+ +  +ED  E+++++E +   L +   V+  +   +  TN +    SIL+HL +I+ D  +R   F++I + IS+++LH  G   D T  +    + + + E   D      + Q  +EL +K+++ L  + E + +L   E K+    +E+   +TQ           +QP + + T++     P  PPPP P       P  P  PPP  PPP       P   FG    S         L+PK        MK+ NW+K+  + +   C W + ++++ +  E+L  +   F ++    + V  +        ++ K+++E KVLD K  QNL+I  GSF++P EEI+R I+E+DE  LT+  ++NL+K LP QEQL  L++ + +Y +L+E EQFG  +ST+K L  RL+  LF+++F E++++++P I+    A  E+R S +F ++LEL+L+ GN+MNA S++ Q+  F ++ L KL DTK    + TL+ F+      ++P +I F ++  ++D+A++VS E +  ++ +M++    LER+L+ +    D +D +F+ M  F     +Q + +  ++  +++S++ + +Y + D +K  +EE F D+  F+  F +A KE     + E ++++AR  + + E EK ER  ++ +      + D+  V+D LL  L SG AF   +D RK+  +  EN
Sbjct:  216 VQCLKAFMNNKYGLDRILGEERSLSLLARVIDPTHSAMMTDVVKLLSAICIVGEENTLEKILEAITTAGEWRS-IERFSPIVRGL----RDRSVQLQVACMQLINALVT---------SPDELDFRLHIRNEFMRCGLKEILPQLGTIRNEALDIQLKVFE-EHKEEDMMEFSHRLEDIRSELDDAGDVFSFVQSMVKDTNAEPYFLSILQHLALIRNDYLVRPQYFKIIEECISQIVLHRSGTDPDFTYRKRLDVDFSHLLEVCTDKARIEEFEQRASELAQKFDEELLRRQEAQAQLGKYEEKIAELQTELQACRTQFGSIPVTFTQGEQPSSSSTTAVAGSSVPGPPPPPPPPPPPPPPPGWPSAPPPPGPPPQFGVPPPPPLVFGGAFGSPTHDTLPYGLRPKKEFKLETGMKRLNWSKIRPQEMSEGCFWVRADENQYSKPELLSRVALTFGSQ----RTVKKEEEDTEDKKSIKKRIRELKVLDPKIAQNLSIFLGSFRMPYEEIRRMIVEVDEEQLTEPMIQNLVKHLPEQEQLNALAKYKSEYSSLSEPEQFGVVMSTVKRLRPRLSHILFRLQFEEQVNNLRPDILAVNAACEEVRRSLSFGRLLELVLLLGNYMNAGSRNAQSYGFDLSSLCKLKDTKSADQKTTLLHFLAQICEEEFPDVIKFVDDLEHVDRASRVSAENVEKSLRQMERQLLQLERDLETFSSPDDQSDMFFVKMASFSKGARDQYSKLVTVHSKMETSYQNILEYFAVDPKKTSVEELFTDLSNFRSMFTQALKENFKQRELEEKQRRARVAKEKAEREKLERQQKKRRLLEVNAENDETGVMDCLLEALQSGAAF---RDRRKRAPRPREN 1058          
BLAST of Diaphanous, putative vs. Ensembl Medaka
Match: diaph3 (diaphanous related formin 3 [Source:NCBI gene;Acc:101155017])

HSP 1 Score: 343.199 bits (879), Expect = 2.499e-100
Identity = 253/865 (29.25%), Postives = 459/865 (53.06%), Query Frame = 3
Query:  489 LKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFE-SHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDED--EYNNKIE-LEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDP----NYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEI--LQTQ-----------KQPQTVNQTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPIFPFGMQIKS--------NLKPK------GLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSD-NDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKA----TQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTEN 2960
            ++CL+AF N  YGL  ++  + +L  ++  ++  +  +M   ++LL+       E +   ++EA+    + ++ I+RF PI+ GL     +R   L + C+Q IN +V          S  +L +R+H+R EF+ CGL   L  L  I +E +   +  F+ +  +ED  E+++++E +   L +   V+  +   +  TN +    SIL+HL +I+ D  +R   F++I + IS+++LH  G   D T  +    + + + E   D      + Q  +EL +K+++ L  + E + +L   E K+    +E+   +TQ           +QP + + T++     P  PPPP P       P  P  PPP  PPP       P   FG    S         L+PK        MK+ NW+K+  + +   C W + ++++ +  E+L  +   F ++    + V  +        ++ K+++E KVLD K  QNL+I  GSF++P EEI+R I+E+DE  LT+  ++NL+K LP QEQL  L++ + +Y +L+E EQFG  +ST+K L  RL+  LF+++F E++++++P I+    A  E+R S +F ++LEL+L+ GN+MNA S++ Q+  F ++ L KL DTK    + TL+ F+      ++P +I F ++  ++D+A++VS E +  ++ +M++    LER+L+ +    D +D +F+ M  F     +Q + +  ++  +++S++ + +Y + D +K  +EE F D+  F+  F +A KE     + E ++++AR  + + E EK ER  ++ +      + D+  V+D LL  L SG AF   +D RK+  +  EN
Sbjct:  227 VQCLKAFMNNKYGLDRILGEERSLSLLARVIDPTHSAMMTDVVKLLSAICIVGEENTLEKILEAITTAGEWRS-IERFSPIVRGL----RDRSVQLQVACMQLINALVT---------SPDELDFRLHIRNEFMRCGLKEILPQLGTIRNEALDIQLKVFE-EHKEEDMMEFSHRLEDIRSELDDAGDVFSFVQSMVKDTNAEPYFLSILQHLALIRNDYLVRPQYFKIIEECISQIVLHRSGTDPDFTYRKRLDVDFSHLLEVCTDKARIEEFEQRASELAQKFDEELLRRQEAQAQLGKYEEKIAELQTELQACRTQFGSIPVTFTQGEQPSSSSTTAVAGSSVPGPPPPPPPPPPPPPPPGWPSAPPPPGPPPQFGVPPPPPLVFGGAFGSPTHDTLPYGLRPKKEFKLETGMKRLNWSKIRPQEMSEGCFWVRADENQYSKPELLSRVALTFGSQ----RTVKKEEEDTEDKKSIKKRIRELKVLDPKIAQNLSIFLGSFRMPYEEIRRMIVEVDEEQLTEPMIQNLVKHLPEQEQLNALAKYKSEYSSLSEPEQFGVVMSTVKRLRPRLSHILFRLQFEEQVNNLRPDILAVNAACEEVRRSLSFGRLLELVLLLGNYMNAGSRNAQSYGFDLSSLCKLKDTKSADQKTTLLHFLAQICEEEFPDVIKFVDDLEHVDRASRVSAENVEKSLRQMERQLLQLERDLETFSSPDDQSDMFFVKMASFSKGARDQYSKLVTVHSKMETSYQNILEYFAVDPKKTSVEELFTDLSNFRSMFTQALKENFKQRELEEKQRRARVAKEKAEREKLERQQKKRRLLEVNAENDETGVMDCLLEALQSGAAF---RDRRKRAPRPREN 1069          
BLAST of Diaphanous, putative vs. Ensembl Medaka
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:101169616])

HSP 1 Score: 284.648 bits (727), Expect = 9.039e-80
Identity = 171/480 (35.62%), Postives = 283/480 (58.96%), Query Frame = 3
Query: 1560 PMLEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDY-KQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEH---RRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRS 2987
            P   P  PFG+Q K + KP+  +K+ANW+K+  + L     W K  + +   NE+  +L   FS++    K   + +   +      KKVKE K+LDSK+ QNL+I  GSF++P EEIK  IL+++E +LT++ V+NL+K LP  EQL+ L  M+D+Y +L E+EQF   +S++K L  RL +  FK++F E++++IKP +V  T A  E+R S  F K+L++IL+ GN+MNA S++     F I++L KL DTK    + TL+ F+ +    +YP +++F +E ++++KA++VS ETI   + +M +    +E++L+ +   Q+DND +   M       NEQ   +  ++K ++  + ++  Y  FD +K  +EEFF D+  FK+ FQ+A KE +   + E    R + ARE+  + + EK +R       T++D+  ++D LL  L SG AF  ++ PR+  L+    +V+ N   S
Sbjct:  668 PAAPPALPFGLQPKKDYKPEVQLKRANWSKISPEDLSEKSFWIKAQEDQFENNELFAKLTVTFSSQTKS-KSKKEQDDGDDKKQQQKKKVKELKILDSKTSQNLSIFLGSFRLPYEEIKCAILQVNEKVLTESLVQNLIKQLPGPEQLSILGEMKDEYNDLAESEQFAVVISSVKRLMTRLQAIQFKLQFEEQLNNIKPDVVSVTAACEELRKSETFSKLLQIILLVGNYMNAGSRNGSAFGFSISYLCKLRDTKSADLKQTLLHFLADVCEEQYPDVMSFPDELTHVEKASRVSAETIQKNLEQMSRQIKSIEKDLETFPPPQNDNDQFVEKMSISFEFTNEQFEKLDLLHKNMEKQYNDLGDYFVFDPKKISVEEFFSDLNNFKNMFQQAVKENQKRKEAEEKIKRAKLAREKAEKEKEEKLKRSQLPNINTEDDETGIMDGLLEALQSGAAFRRKRGPRQLTLRPCVVLVLWNEQLS 1146          

HSP 2 Score: 102.064 bits (253), Expect = 1.586e-21
Identity = 85/336 (25.30%), Postives = 166/336 (49.40%), Query Frame = 3
Query:  402 INNESNNGLNKLVIVLSHYIDNAEISL-----HCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFES--HANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAF--QTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNT----TELQEKYNKILEEKHETEVKL 1358
            + N  N GL  L+ +L    D+ + +L       ++CL+AF N  YGL +++ ++E +  +   +N Q P++M  A++LL+  +        H  V+E +   A+ QN I+RF P+I+G+     N    L   CL  IN ++       S    LD  +R+H+R E +  GL   L ++  I++E +K  +  F  Q + D ED      ++   L N D    V++++  T+  +  +S   S+++HL++++ D   R + ++LI++ + +++L   G   D     L+  N+  + +   D   ++ +     +L +K    L E+HE + ++
Sbjct:  129 VQNFGNEGLALLLNILRKLQDDKDENLFDCDHEIIRCLKAFMNNKYGLKSMLESEEGITLLVRAINPQKPSMMTDAVKLLSAISILEQPEGLHERVLEVITEEAEKQN-IERFQPLISGM----KNNSLPLRASCLTLINALI-------SRAEELD--FRIHIRSELLRLGLREPLKAVRTIENEELKVQLRVFDEQAEDDSEDLKVRLDDIPFFLLNVDFNYEVFEIVVNTVKDSKAESHFLSLMQHLLLVRNDYLARPHYYKLIDECVGQIVLQKKGADPDFKCRPLE-INVDHLIDNMVDKTKVETSEAKAADLMKKLEAELTERHELKAEM 449          
BLAST of Diaphanous, putative vs. Ensembl Medaka
Match: DIAPH1 (diaphanous related formin 1 [Source:NCBI gene;Acc:101169616])

HSP 1 Score: 282.337 bits (721), Expect = 4.049e-79
Identity = 167/463 (36.07%), Postives = 276/463 (59.61%), Query Frame = 3
Query: 1560 PMLEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDY-KQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEH---RRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRK 2936
            P   P  PFG+Q K + KP+  +K+ANW+K+  + L     W K  + +   NE+  +L   FS++    K   + +   +      KKVKE K+LDSK+ QNL+I  GSF++P EEIK  IL+++E +LT++ V+NL+K LP  EQL+ L  M+D+Y +L E+EQF   +S++K L  RL +  FK++F E++++IKP +V  T A  E+R S  F K+L++IL+ GN+MNA S++     F I++L KL DTK    + TL+ F+ +    +YP +++F +E ++++KA++VS ETI   + +M +    +E++L+ +   Q+DND +   M       NEQ   +  ++K ++  + ++  Y  FD +K  +EEFF D+  FK+ FQ+A KE +   + E    R + ARE+  + + EK +R       T++D+  ++D LL  L SG AF  ++ PR+
Sbjct:  663 PAAPPALPFGLQPKKDYKPEVQLKRANWSKISPEDLSEKSFWIKAQEDQFENNELFAKLTVTFSSQTKS-KSKKEQDDGDDKKQQQKKKVKELKILDSKTSQNLSIFLGSFRLPYEEIKCAILQVNEKVLTESLVQNLIKQLPGPEQLSILGEMKDEYNDLAESEQFAVVISSVKRLMTRLQAIQFKLQFEEQLNNIKPDVVSVTAACEELRKSETFSKLLQIILLVGNYMNAGSRNGSAFGFSISYLCKLRDTKSADLKQTLLHFLADVCEEQYPDVMSFPDELTHVEKASRVSAETIQKNLEQMSRQIKSIEKDLETFPPPQNDNDQFVEKMSISFEFTNEQFEKLDLLHKNMEKQYNDLGDYFVFDPKKISVEEFFSDLNNFKNMFQQAVKENQKRKEAEEKIKRAKLAREKAEKEKEEKLKRSQLPNINTEDDETGIMDGLLEALQSGAAFRRKRGPRQ 1124          

HSP 2 Score: 103.605 bits (257), Expect = 6.146e-22
Identity = 83/331 (25.08%), Postives = 163/331 (49.24%), Query Frame = 3
Query:  402 INNESNNGLNKLVIVLSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFES--HANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAF--QTDTDDEDEYNNKIELEVLLQNRD---AVYQLLNRTLCQTNCDSSLTSILKHLVIIK-DTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNT----TELQEKYNKILEEKHETEVKL 1358
            + N  N GL  L+ +L     + +     ++CL+AF N  YGL +++ ++E +  +   +N Q P++M  A++LL+  +        H  V+E +   A+ QN I+RF P+I+G+     N    L   CL  IN ++       S    LD  +R+H+R E +  GL   L ++  I++E +K  +  F  Q + D ED      ++   L N D    V++++  T+  +  +S   S+++HL++++ D   R + ++LI++ + +++L   G   D     L+  N+  + +   D   ++ +     +L +K    L E+HE + ++
Sbjct:  129 VQNFGNEGLALLLNILRKLRFDCKCQHEIIRCLKAFMNNKYGLKSMLESEEGITLLVRAINPQKPSMMTDAVKLLSAISILEQPEGLHERVLEVITEEAEKQN-IERFQPLISGM----KNNSLPLRASCLTLINALI-------SRAEELD--FRIHIRSELLRLGLREPLKAVRTIENEELKVQLRVFDEQAEDDSEDLKVRLDDIPFFLLNVDFNYEVFEIVVNTVKDSKAESHFLSLMQHLLLVRNDYLARPHYYKLIDECVGQIVLQKKGADPDFKCRPLE-INVDHLIDNMVDKTKVETSEAKAADLMKKLEAELTERHELKAEM 444          
BLAST of Diaphanous, putative vs. Planmine SMEST
Match: SMESG000036976.1 (SMESG000036976.1)

HSP 1 Score: 1704.88 bits (4414), Expect = 0.000e+0
Identity = 875/878 (99.66%), Postives = 876/878 (99.77%), Query Frame = 3
Query:  396 KGINNESNNGLNKLVIVLSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIKDTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQPQTVNQTSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEPMLEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSRRDFDKNLIQVTPK 3029
            K  NNESNNGLNKLVIVLSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIKDTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQPQTVNQTSMPPPPAPPAPPPPLPINNALNAPPMPPPPPPGVPPPLKEPMLEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETI+STIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSRRDFDKNLIQVTPK
Sbjct:  121 KEFNNESNNGLNKLVIVLSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDAVYQLLNRTLCQTNCDSSLTSILKHLVIIKDTPIRYNLFRLINDVISELILHSDGMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKLFSLENKMGIKASEILQTQKQPQTVNQTSMPPPPAPPAPPPPLPINNALNAPPMPPPPPPGVPPPLKEPMLEPIFPFGMQIKSNLKPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETINSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSRRDFDKNLIQVTPK 998          

HSP 2 Score: 244.973 bits (624), Expect = 4.054e-67
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 1
Query:   37 MDKKKIFSLKSKENDKKFTEVSLLNTPVRDDMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKEL 405
            MDKKKIFSLKSKENDKKFTEVSLLNTPVRDDMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKE 
Sbjct:    1 MDKKKIFSLKSKENDKKFTEVSLLNTPVRDDMTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKEF 123          
BLAST of Diaphanous, putative vs. Planmine SMEST
Match: SMESG000057806.1 (SMESG000057806.1)

HSP 1 Score: 266.159 bits (679), Expect = 4.749e-74
Identity = 167/467 (35.76%), Postives = 269/467 (57.60%), Query Frame = 3
Query: 1611 KPKGLMKKANWNKVDIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQEDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSRRDFDKNL 3011
            +P+  MKKANWNK++ K+L  N VW  I +  + T+ +L EL   FST+      V  + +   +    PK      +LD K+ QN++IL GS ++  E++K+ ILE+D  +LTQ+ +E LLK+LP  EQ+ K++ + D Y++L E EQF   LS IK L  RL S LF++KF ++I+++K     A  AL+EI  S    KILE++L  GN+MN+ S++ Q++ F +NFL KL  TKD  N  +L+ F+   +            + SY+DKA +++ +  +ST+ E+K     +E +LK +K  ++ND +   M  F+  V EQ+ +       +  +F+ ++ Y +F+   Y +EE F+D+  FK  F +A+K  E     E R  KA+ ++ RRE EK  +     K T E+D  V+DNLL  L SG+   +   P++++ K  +    +NRSRSR +F++N+
Sbjct:  625 QPEQPMKKANWNKINEKILSENSVWLSIKEETIPTD-ILKELENNFSTKV----VVVKEKTVKTTVVKEPK------ILDGKTAQNISILLGSLRMEYEKLKQAILEIDTSILTQSMIEQLLKNLPETEQMQKIAELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFELNFLCKLSSTKDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFKGSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYFTFNSSTYKIEELFNDMAKFKTEFIEAHKFNEEKKLLEERALKAKLDKERREKEK--QMPVMSKTTSEEDSGVIDNLLAVLKSGDGALS---PKRRKPKSKDARRQLNRSRSRGEFNENM 1075          

HSP 2 Score: 224.172 bits (570), Expect = 7.737e-68
Identity = 124/329 (37.69%), Postives = 208/329 (63.22%), Query Frame = 3
Query:  396 KGINNESNNGLNKLVIVLSHYIDNAEISLHCLKCLRAFGNCGYGLLTLINNKEALLYVSLCLNAQYPNLMCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGL--DVGIHNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLNTYLDSLSNIDDENIK---QYILAFQTDTDDEDEYNNKIELEVLLQNRDA--VYQLLNRTLCQTNCDSSLTSILKHLVIIKDTPIRYNLFRLINDVISELILHSD-GMCLDPTLNQLDGYNLTDVFEKFNDPNYLQNTTELQEKYNKILEEKHETEVKL 1358
            K  +N++N+GLN L+ VLS   + A+ S+ CLKC RAF NCGYGLL L+ +  A L+++ CL  Q  +LM +A+E+LT+ TF+ ++S+ NVM+AL+  A++ N+  RF+P+I     +  + N   +L +  ++FINVI++P F + +  +  D YYR+HLR EFV+ GL    D L  + + N+K   + I  F ++ ++EDE  N+    ++    DA  +++++NR++  T C+ +  SIL +L+II++ PIR +LFR I++++ E+IL  D G C DPTL + D  NL    +KF D ++++   EL+ + +    +K E ++KL
Sbjct:  128 KEFDNKTNDGLNLLLAVLSTLTETADSSIVCLKCFRAFANCGYGLLKLMASDNAYLFIARCLRPQNIHLMYVAVEILTILTFFDYKSYQNVMDALFRAAKLNNYENRFVPLIESAKKNAQMENENESLSLATIRFINVIISPPFLNPNDSAQFDEYYRLHLRREFVNNGLMQVFDEL--LCNPNLKLTHEQINQFLSEYENEDEEVNEKSETIIRAFGDASDIFRIINRSVSNTKCEVNFRSILANLLIIREDPIRDDLFRFIDEIVQEIILQDDSGFCPDPTLKKFDKINL----KKFYDGSHVE---ELKRELDSERLKKDELKIKL 447          

HSP 3 Score: 54.299 bits (129), Expect = 7.737e-68
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  130 MTESEFEEVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPSNYINTLVDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKEL 405
            ++E+E  + F K +D+MNI +DKR  +  ++ E K  +L    +S     + Y+  L  I+  + +  KI   LD +R+ LNS+P+S +KE 
Sbjct:   39 LSENEINDKFEKLLDDMNIPIDKRSVIREKTQEQKLVMLKSCITSQIKPVTYYVELLKQIISEKLSESKICENLDQIRICLNSNPVSWIKEF 130          
BLAST of Diaphanous, putative vs. Planmine SMEST
Match: SMESG000054598.1 (SMESG000054598.1)

HSP 1 Score: 110.923 bits (276), Expect = 2.237e-24
Identity = 117/509 (22.99%), Postives = 231/509 (45.38%), Query Frame = 3
Query: 1638 NWNKVDIKLLDRNC-----VWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLNSYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLTQTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARLNSFLFKMKFS-ERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFLVMQEFLVNVNEQLTLISEMNKI---LQSSFREMAKYLSFDIQKYPMEEFFHDIKIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHT--------------RQCKATQEDDKKV---------LDNLLVTLNSGNAFGN------------RKDPRKKRLKKTENIVVIN-----RSRSRR-DFDKNLI 3014
            ++ ++++ L+   C     +W ++N + ++T++++ +L  +F+++               +     K VK   VLDSK+ QN  I   S  +  EEI   I +++  ++T   +  L+  +P   QL KL   +D  E+L   EQF   L  + +   R N    ++  S + + +++ ++     +  ++  S     +LE+++     MN   K    V   ++ L K +DTKDN N G L+EF+V Q+R+  P  +   ++   LD A+++S+++I+S + +   +       LK  +   +N +   +  E  V V     L+S ++ +   L S ++E+ +Y       Y  E+ F D+K+FK+ F+ + K I       + RQK  E   +++ME   +                      +  +KK+         ++N ++ ++SG  F +            R++ +K R++   NI  IN      SRSR+ DF + +I
Sbjct:  661 SFKRINVTLIPETCLNEKSIWLQLNKTTLSTDKIVGKLFARFASKK--------------AAEFKTKFVKPLIVLDSKNAQNFEIFLRSVNMKNEEIINAIRKMNFKVITLDMINKLVAYMPDISQLVKLEPFKDKIEDLRLCEQFIVHLMEVDNYKIRFNGIHLQILVSNDCLKEVENSLDLLYSSFEKLLSSDKLKSVLEMVVFITQSMNPEKK---IVGITLDSLAKFVDTKDNCN-GNLLEFLVEQLRDLVPESLKVWDDLDSLDSASRISSDSINSVVNQFSTV-------LKSLQCDIENIDSINLRSEISVTVELAKNLLSHISFLQNELDSKYQEVCEYFGISKSNYCFEKLFSDLKLFKNQFKNSEKII-------YERQKLNEIH-KQKMESINKMQMQQFQQSDQLAIILSSLDGEKSSEKKLKSIFKQSAFIENAIIGISSGKIFCDEDSVLNWNVQYHRRENQKNRVRNARNIRRINFNNLTPSRSRKIDFTQTMI 1136          
BLAST of Diaphanous, putative vs. Planmine SMEST
Match: SMESG000040024.1 (SMESG000040024.1)

HSP 1 Score: 73.559 bits (179), Expect = 7.185e-13
Identity = 79/306 (25.82%), Postives = 140/306 (45.75%), Query Frame = 3
Query: 2040 LNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSD----NDNYFLVMQEFLVNVNEQLTL-ISEMNKILQSSFREMAKYLSFDIQKYPMEE-FFHDIKIFKDNFQKANKEIE----------IAIQNEHRRQKAREEQLRREMEKTER----HTRQCKATQEDDKKVLDNLLVTLN 2897
            L + ++   TL  ++ L  +L   ++   F E    +   +   T+A   +R S    +ILE+IL  GN MN SS+      F +  L  L DTK      TLM+F V+ V +K+  L +F++E  ++++A+K+  E I+          TD+   +   KQ  D    N N    +++F  + NE LT  +S+     + +F + A++   + Q  P  + FF     F +NF+K+ +++           I    E  + K ++++L  E  K  R     TRQ  A       ++D++L  L+
Sbjct:  692 LTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMN-SSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAIT----------TDVASLVGGMKQVRDEMNCNTNQPPRLKKFFED-NENLTADLSKSAANAKETFLQAAEWFG-ERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKKLALEARKKNRRMNNRTRQINA-----DGIMDDILAGLD 979          
BLAST of Diaphanous, putative vs. Planmine SMEST
Match: SMESG000040024.1 (SMESG000040024.1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.806e-12
Identity = 65/241 (26.97%), Postives = 116/241 (48.13%), Query Frame = 3
Query: 2040 LNEAEQFGCTLSTIKHLHARLNSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFMNASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINFTNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSD----NDNYFLVMQEFLVNVNEQLTL-ISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDI-KIFKDNFQKANKEI 2744
            L + ++   TL  ++ L  +L   ++   F E    +   +   T+A   +R S    +ILE+IL  GN MN SS+      F +  L  L DTK      TLM+F V+ V +K+  L +F++E  ++++A+K+  E I+          TD+   +   KQ  D    N N    +++F  + NE LT  +S+     + +F + A++   + Q  P  + F  I   F +NF+K+ +++
Sbjct:  692 LTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMN-SSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAIT----------TDVASLVGGMKQVRDEMNCNTNQPPRLKKFFED-NENLTADLSKSAANAKETFLQAAEWFG-ERQNNPTPDVFFGIFHRFTENFKKSLEDV 919          
The following BLAST results are available for this feature:
BLAST of Diaphanous, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIAPH11.322e-8536.89diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
DIAPH11.514e-8536.91diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
DIAPH11.566e-8536.91diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
DIAPH19.357e-8536.70diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
DIAPH14.533e-8436.70diaphanous related formin 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyk-17.257e-5030.21CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q... [more]
cyk-17.462e-5030.21CYtoKinesis defect [Source:UniProtKB/TrEMBL;Acc:Q... [more]
daam-14.634e-3024.24DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-14.634e-3024.24DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-17.872e-3024.28DAAM (Disheveled-Associated Activator of Morphogen... [more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dia1.859e-7834.92gene:FBgn0011202 transcript:FBtr0081410[more]
dia1.859e-7834.92gene:FBgn0011202 transcript:FBtr0335145[more]
dia1.859e-7834.92gene:FBgn0011202 transcript:FBtr0081411[more]
dia1.956e-7834.92gene:FBgn0011202 transcript:FBtr0305961[more]
DAAM3.623e-3426.48gene:FBgn0025641 transcript:FBtr0342731[more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diaph31.279e-8134.06diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-G... [more]
diaph31.233e-7734.84diaphanous-related formin 3 [Source:ZFIN;Acc:ZDB-G... [more]
diaph22.591e-7533.04diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-G... [more]
diaph21.004e-6335.38diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-G... [more]
CABZ01057928.19.803e-5937.98protein diaphanous homolog 1-like [Source:NCBI gen... [more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIAPH29.921e-8135.41diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
DIAPH11.218e-8035.70diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
DIAPH21.424e-8034.99diaphanous related formin 2 [Source:NCBI gene;Acc:... [more]
DIAPH11.851e-6632.76diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
atrn2.326e-6632.64attractin [Source:Xenbase;Acc:XB-GENE-953934][more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Diaph19.395e-8636.91diaphanous related formin 1 [Source:MGI Symbol;Acc... [more]
Diaph11.957e-8536.91diaphanous related formin 1 [Source:MGI Symbol;Acc... [more]
Diaph12.026e-8536.91diaphanous related formin 1 [Source:MGI Symbol;Acc... [more]
Diaph11.217e-8436.70diaphanous related formin 1 [Source:MGI Symbol;Acc... [more]
Diaph12.032e-8436.70diaphanous related formin 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Diaphanous, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60610|DIAP1_HUMAN7.522e-8536.91Protein diaphanous homolog 1 OS=Homo sapiens OX=96... [more]
sp|O08808|DIAP1_MOUSE1.369e-8436.91Protein diaphanous homolog 1 OS=Mus musculus OX=10... [more]
sp|F1M775|DIAP1_RAT1.627e-8236.48Protein diaphanous homolog 1 OS=Rattus norvegicus ... [more]
sp|O70566|DIAP2_MOUSE3.018e-8135.68Protein diaphanous homolog 2 OS=Mus musculus OX=10... [more]
sp|O60879|DIAP2_HUMAN8.649e-8035.05Protein diaphanous homolog 2 OS=Homo sapiens OX=96... [more]
back to top
BLAST of Diaphanous, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YK299.349e-14433.74Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A410SF408.017e-12432.42Diaphonous OS=Bradybaena similaris OX=145626 GN=di... [more]
A0A3Q0CRV14.173e-11231.41LOW QUALITY PROTEIN: protein diaphanous homolog 3 ... [more]
A0A402FED28.306e-10829.87Uncharacterized protein OS=Paroedura picta OX=1436... [more]
A0A5N3X0W12.065e-10731.65Uncharacterized protein (Fragment) OS=Muntiacus re... [more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diaph25.271e-7331.26diaphanous-related formin 2 [Source:ZFIN;Acc:ZDB-G... [more]
ENSAMXT00000048841.16.349e-6333.85pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
daam1b5.117e-4129.76disheveled-associated activator of morphogenesis 1... [more]
daam21.677e-3926.43dishevelled associated activator of morphogenesis ... [more]
daam1b2.746e-3929.82disheveled-associated activator of morphogenesis 1... [more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000125.12.857e-7933.33pep scaffold:Pmarinus_7.0:GL476709:11284:97599:-1 ... [more]
ENSPMAT00000001778.11.762e-5439.21pep scaffold:Pmarinus_7.0:GL479130:173791:184898:-... [more]
daam1a1.810e-3126.13dishevelled associated activator of morphogenesis ... [more]
ENSPMAT00000010867.11.888e-2829.15pep scaffold:Pmarinus_7.0:GL477036:280430:297830:1... [more]
ENSPMAT00000010834.16.624e-2726.60pep scaffold:Pmarinus_7.0:GL476428:81056:119857:-1... [more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BNI12.678e-922.99Formin; polarisome component; nucleates the format... [more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353351.166e-8037.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328683.156e-3927.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482589.769e-2426.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273872.656e-2234.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367093.572e-1923.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Diaphanous, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diaph32.129e-10029.25diaphanous related formin 3 [Source:NCBI gene;Acc:... [more]
diaph32.129e-10029.25diaphanous related formin 3 [Source:NCBI gene;Acc:... [more]
diaph32.499e-10029.25diaphanous related formin 3 [Source:NCBI gene;Acc:... [more]
DIAPH19.039e-8035.63diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
DIAPH14.049e-7936.07diaphanous related formin 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Diaphanous, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036976.14.054e-6799.66SMESG000036976.1[more]
SMESG000057806.14.749e-7435.76SMESG000057806.1[more]
SMESG000054598.12.237e-2422.99SMESG000054598.1[more]
SMESG000040024.17.185e-1325.82SMESG000040024.1[more]
SMESG000040024.14.806e-1226.97SMESG000040024.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015407 ID=SMED30015407|Name=Diaphanous, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=3096bp
GATAATATGAAAAACGTTTTTGAATTTTTCAAATCTATGGATAAAAAGAA
AATTTTTTCTTTAAAAAGTAAAGAAAACGATAAAAAGTTTACAGAAGTTA
GTTTGTTAAATACTCCTGTCCGTGATGATATGACGGAAAGTGAATTTGAA
GAGGTATTTGCAAAGTTTATGGATGAAATGAATATTGGCTTGGATAAAAG
AGGGCCTTTGCTTACTCGGAGCATTGAGGATAAAAGGAAATTATTGAGTC
AAATTCATTCATCATCTGAAACCAGTCCATCGAACTATATAAATACTTTA
GTTGACATCGTCGAACGTCAATGGGCTATAGAGAAAATAATTGTCAAACT
TGATTCACTGAGAGTTTATTTAAATAGTTCTCCATTATCGCGAGTAAAGG
AATTAATAACGAATCAAATAATGGTCTTAATAAATTGGTAATTGTTCTAA
GTCATTACATTGATAATGCTGAAATTTCTCTTCATTGCTTGAAATGCTTA
AGAGCATTCGGTAATTGTGGATATGGGTTATTGACCCTCATCAATAATAA
AGAAGCTCTTTTATATGTATCATTATGTCTCAATGCTCAATATCCAAACT
TAATGTGCTTAGCAATAGAATTATTGACGCTATTTACCTTTTACAGTTTT
GAAAGTCATGCCAATGTTATGGAAGCCTTGTATCTCGGTGCTCAAATGCA
AAATCACATACAGCGTTTCATTCCTATTATAAATGGTCTCGATGTCGGGA
TTCACAATAGACAAAGCAATCTTCTTATTCCATGTCTTCAGTTCATAAAT
GTCATCGTCAATCCGAATTTCAACGACACCAGCACTTGTTCAAATTTGGA
TTTATACTACCGCATGCATTTACGAATCGAATTCGTTAGCTGTGGACTAA
ATACTTATCTCGATTCTCTATCAAATATCGACGATGAAAATATCAAACAA
TATATTCTTGCCTTTCAAACTGATACCGACGATGAAGATGAATACAATAA
TAAAATCGAACTCGAAGTTCTTTTACAAAACAGGGACGCCGTTTATCAAT
TATTGAATCGAACTCTTTGTCAAACAAATTGCGACAGTTCTTTGACGTCG
ATTCTCAAACATCTGGTAATTATAAAAGACACTCCAATTCGTTACAATTT
GTTTCGTTTGATCAACGATGTCATTTCAGAATTGATTCTCCACAGTGACG
GAATGTGCTTGGATCCGACGTTGAATCAACTCGATGGATACAATTTAACT
GATGTATTTGAAAAGTTCAACGATCCCAATTATTTGCAGAATACGACGGA
GCTCCAGGAGAAATATAATAAAATCCTGGAAGAAAAGCACGAAACCGAAG
TTAAATTGTTTTCATTGGAAAATAAAATGGGAATTAAAGCCTCCGAAATC
CTACAAACGCAAAAACAACCACAAACCGTCAATCAAACATCAATGCCTCC
TCCGCCTGCCCCACCAGCGCCTCCTCCTCCGTTGCCGATAAATAATGCAT
TAAACGCTCCTCCAATGCCACCACCGCCACCTCCCGGTGTTCCTCCTCCT
TTAAAAGAGCCAATGTTGGAACCGATATTTCCATTTGGAATGCAAATCAA
ATCCAACCTCAAACCGAAAGGTCTAATGAAAAAAGCCAATTGGAACAAAG
TCGACATCAAACTGCTGGATAGGAATTGCGTTTGGAAGAAAATCAATGAC
AGCGAAATGAATACCAATGAAATGCTGATGGAACTGAACGAGAAATTCAG
CACGAGAGCTTTCAGACCGAAAGACGTGTCCGATGACAATTCATCTCTCA
ATTCCTATTCAACACTCCCGAAAAAAGTGAAAGAGTTCAAAGTGCTCGAT
TCGAAATCCGGTCAAAATCTGGCGATTCTATCAGGTTCCTTTAAAGTGCC
AGCTGAAGAAATCAAAAGACGGATTCTTGAGCTTGACGAAGGCCTGCTCA
CCCAAACCAATGTAGAAAACCTATTGAAAAGCCTCCCGCCCCAGGAACAG
CTGGCAAAACTGTCTCGCATGCAAGACGATTACGAGAATCTCAACGAGGC
TGAACAATTCGGCTGCACTTTGTCGACAATAAAACATTTGCACGCTCGTC
TCAACAGTTTTCTCTTTAAAATGAAATTCAGTGAGCGGATTTCCGATATC
AAACCGGCAATCGTTTGCGCTACCCAGGCGTTGAATGAAATCCGACACAG
CAGCAATTTCATTAAAATCCTCGAATTGATATTGATTTGTGGGAATTTCA
TGAATGCCTCTTCCAAGCACAATCAAACTGTTGCTTTTCATATCAATTTT
CTCGGGAAATTAATCGATACCAAAGACAACCAAAACGAGGGAACGTTGAT
GGAATTTATCGTCAATCAAGTCCGCAACAAATATCCGTACTTGATCAATT
TCACAAACGAATTCTCTTATTTGGATAAGGCGGCAAAAGTTTCCAATGAA
ACTATCAGTTCGACGATTGTAGAAATGAAGAAAATGAAAACGGATTTAGA
ACGGGAACTGAAGGACTACAAGCAGCAATCAGACAATGATAACTATTTCC
TGGTGATGCAAGAGTTCCTGGTCAATGTCAATGAGCAATTGACATTGATT
TCAGAAATGAACAAAATCCTCCAATCATCATTCAGAGAAATGGCCAAATA
TCTCTCGTTTGATATTCAGAAATATCCGATGGAGGAATTTTTTCATGACA
TCAAAATTTTCAAAGACAACTTTCAGAAAGCGAATAAAGAAATTGAAATT
GCTATTCAAAACGAACATCGGCGCCAGAAAGCCCGAGAGGAACAACTGCG
ACGGGAAATGGAGAAAACCGAACGGCACACCCGTCAGTGTAAAGCTACTC
AGGAAGATGATAAAAAGGTTTTGGATAATTTACTCGTAACGCTTAATAGC
GGCAATGCATTTGGGAATCGCAAGGATCCTCGTAAAAAACGTTTGAAGAA
AACGGAAAATATTGTAGTCATTAATCGGTCTAGGTCGAGAAGGGATTTCG
ATAAAAACCTGATTCAAGTTACTCCGAAGTGATAGATTTTTTTTTATTTC
AGACTCAGATTATTCCTGTATATTAAAATATATTTTTATATTATTT
back to top

protein sequence of SMED30015407-orf-1

>SMED30015407-orf-1 ID=SMED30015407-orf-1|Name=SMED30015407-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=810bp
MCLAIELLTLFTFYSFESHANVMEALYLGAQMQNHIQRFIPIINGLDVGI
HNRQSNLLIPCLQFINVIVNPNFNDTSTCSNLDLYYRMHLRIEFVSCGLN
TYLDSLSNIDDENIKQYILAFQTDTDDEDEYNNKIELEVLLQNRDAVYQL
LNRTLCQTNCDSSLTSILKHLVIIKDTPIRYNLFRLINDVISELILHSDG
MCLDPTLNQLDGYNLTDVFEKFNDPNYLQNTTELQEKYNKILEEKHETEV
KLFSLENKMGIKASEILQTQKQPQTVNQTSMPPPPAPPAPPPPLPINNAL
NAPPMPPPPPPGVPPPLKEPMLEPIFPFGMQIKSNLKPKGLMKKANWNKV
DIKLLDRNCVWKKINDSEMNTNEMLMELNEKFSTRAFRPKDVSDDNSSLN
SYSTLPKKVKEFKVLDSKSGQNLAILSGSFKVPAEEIKRRILELDEGLLT
QTNVENLLKSLPPQEQLAKLSRMQDDYENLNEAEQFGCTLSTIKHLHARL
NSFLFKMKFSERISDIKPAIVCATQALNEIRHSSNFIKILELILICGNFM
NASSKHNQTVAFHINFLGKLIDTKDNQNEGTLMEFIVNQVRNKYPYLINF
TNEFSYLDKAAKVSNETISSTIVEMKKMKTDLERELKDYKQQSDNDNYFL
VMQEFLVNVNEQLTLISEMNKILQSSFREMAKYLSFDIQKYPMEEFFHDI
KIFKDNFQKANKEIEIAIQNEHRRQKAREEQLRREMEKTERHTRQCKATQ
EDDKKVLDNLLVTLNSGNAFGNRKDPRKKRLKKTENIVVINRSRSRRDFD
KNLIQVTPK*
back to top

protein sequence of SMED30015407-orf-2

>SMED30015407-orf-2 ID=SMED30015407-orf-2|Name=SMED30015407-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
DNMKNVFEFFKSMDKKKIFSLKSKENDKKFTEVSLLNTPVRDDMTESEFE
EVFAKFMDEMNIGLDKRGPLLTRSIEDKRKLLSQIHSSSETSPSNYINTL
VDIVERQWAIEKIIVKLDSLRVYLNSSPLSRVKELITNQIMVLINW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000208testis
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR010472FH3_dom
IPR015425FH2_Formin
IPR010473GTPase-bd
IPR014768GBD/FH3_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0017048Rho GTPase binding
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0016043cellular component organization
GO:0030036actin cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010473Formin, GTPase-binding domainPFAMPF06371Drf_GBDcoord: 44..137
e-value: 2.2E-9
score: 37.2
NoneNo IPR availableGENE3DG3DSA:1.10.20.40coord: 37..88
e-value: 5.0E-6
score: 27.9
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 50..146