TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30015406
Length (bp)1830
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30015406) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30015406) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015406

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30015406h1SMcG0020183 tr5_1521mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
anterior primary gut branchSMED30015406h1SMcG0020183 tr5_1521mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
posterior primary gut branchSMED30015406h1SMcG0020183 tr5_1521mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
Smed sexual biotypeSMED30015406h1SMcG0020183 Contig35190newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015406h1SMcG0020183 Contig35190uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30015406h1SMcG0020183 dd_Smed_v4_2172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015406h1SMcG0020183 dd_Smed_v4_2172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 67.0106 bits (162), Expect = 1.650e-11
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query:  912 LNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSE---LAGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            L  E  F+    WKI +  ++       +   +   +FY+  +GYKL L LY NG        L +F+ +++G+YD  L WPF+  VT  +L+ N+ ++   +   ++ + S +R  SE    +G  +FF  SK+ +   + +KD+ +F+K
Sbjct:  137 LMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 287          

HSP 2 Score: 58.151 bits (139), Expect = 1.594e-8
Identity = 37/89 (41.57%), Postives = 54/89 (60.67%), Query Frame = 3
Query:  492 DG-FIWKIDNVS-----SFLNKTVAELTSNSFYTDGQYGYKIRLKL----DNSFGKIRIKL--EILKGVFDSLLPWPFNNEIEVSLLSQ 722
            DG F+WKI NV+     S   +TV+ L S +FYT  +YGYK+ L+L    D +  +  + L   I++G +D+LLPWPF N++   LL Q
Sbjct:  144 DGTFLWKITNVTRRCHESACGRTVS-LFSPAFYT-AKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ 230          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 66.6254 bits (161), Expect = 5.075e-11
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query:  912 LNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSE---LAGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            L  E  F+    WKI +  ++       +   +   +FY+  +GYKL L LY NG        L +F+ +++G+YD  L WPF+  VT  +L+ N+ ++   +   ++ + S +R  SE    +G  +FF  SK+ +   + +KD+ +F+K
Sbjct:  259 LMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 409          

HSP 2 Score: 58.5362 bits (140), Expect = 2.165e-8
Identity = 37/89 (41.57%), Postives = 54/89 (60.67%), Query Frame = 3
Query:  492 DG-FIWKIDNVS-----SFLNKTVAELTSNSFYTDGQYGYKIRLKL----DNSFGKIRIKL--EILKGVFDSLLPWPFNNEIEVSLLSQ 722
            DG F+WKI NV+     S   +TV+ L S +FYT  +YGYK+ L+L    D +  +  + L   I++G +D+LLPWPF N++   LL Q
Sbjct:  266 DGTFLWKITNVTRRCHESACGRTVS-LFSPAFYT-AKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ 352          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 66.6254 bits (161), Expect = 5.075e-11
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query:  912 LNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSE---LAGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            L  E  F+    WKI +  ++       +   +   +FY+  +GYKL L LY NG        L +F+ +++G+YD  L WPF+  VT  +L+ N+ ++   +   ++ + S +R  SE    +G  +FF  SK+ +   + +KD+ +F+K
Sbjct:  259 LMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 409          

HSP 2 Score: 58.5362 bits (140), Expect = 2.165e-8
Identity = 37/89 (41.57%), Postives = 54/89 (60.67%), Query Frame = 3
Query:  492 DG-FIWKIDNVS-----SFLNKTVAELTSNSFYTDGQYGYKIRLKL----DNSFGKIRIKL--EILKGVFDSLLPWPFNNEIEVSLLSQ 722
            DG F+WKI NV+     S   +TV+ L S +FYT  +YGYK+ L+L    D +  +  + L   I++G +D+LLPWPF N++   LL Q
Sbjct:  266 DGTFLWKITNVTRRCHESACGRTVS-LFSPAFYT-AKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ 352          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 63.1586 bits (152), Expect = 7.804e-10
Identity = 43/146 (29.45%), Postives = 76/146 (52.05%), Query Frame = 3
Query:  927 VFNRKIKWKIKDF-IQKTKLKDSK---ILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL---AGFI-FFNKSKINNSYPSVIKDNQIFIK 1325
             +N K+ WK+ D+ ++K +  D     I   SFY+   GY+L    Y NG        L ++  V++G++D  L WPF+  VT+ +L+ +  KN+  +   +  + S KR + E+   +G   F   S + N+  + IKD+ +F+K
Sbjct:  401 CYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLK 546          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 63.1586 bits (152), Expect = 7.804e-10
Identity = 43/146 (29.45%), Postives = 76/146 (52.05%), Query Frame = 3
Query:  927 VFNRKIKWKIKDF-IQKTKLKDSK---ILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL---AGFI-FFNKSKINNSYPSVIKDNQIFIK 1325
             +N K+ WK+ D+ ++K +  D     I   SFY+   GY+L    Y NG        L ++  V++G++D  L WPF+  VT+ +L+ +  KN+  +   +  + S KR + E+   +G   F   S + N+  + IKD+ +F+K
Sbjct:  401 CYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLK 546          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 51.6026 bits (122), Expect = 1.366e-6
Identity = 28/91 (30.77%), Postives = 47/91 (51.65%), Query Frame = 3
Query:  924 KVFNRKIKWKIKDFIQKTKLK----DSKILEHSFYSGDFGYKLQLV--LYPNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGN 1178
            ++F  ++ WKI    Q+T       D+ I    F S  FGYK+     L+ +G S    + +++ +LKG++D  L WPF   + I +L+ N
Sbjct:  259 EMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQN 349          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 50.8322 bits (120), Expect = 1.754e-6
Identity = 25/72 (34.72%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  966 IQKTKLKDSK-ILEHSFYSGDFGYKLQLVLYP--NGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            ++ TK K  + I    FYS  +GYK+  V  P  +G++      +F+ ++KG++DD L WPF+ +VT  +L+
Sbjct:  172 VKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILS 243          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 57.7658 bits (138), Expect = 1.750e-8
Identity = 39/144 (27.08%), Postives = 73/144 (50.69%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLKDS-KILEHSFYSGDFGYKLQLVLY--PNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVL-------NGNSTKNMCPSEIRNKSSKRSNS--ELA-GFIFFNKSKINNSYPSVIKDNQIFIKFK 1331
            WKI D+   + + + KD  +++   FY+  +GYKLQ  ++   NG  ++  + ++++VL G+YD  L WPF +++T  +         G   ++  P        + SN   +L  GF  F   ++ +S P  IK + +F++ K
Sbjct:  326 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP-FIKGDTVFLRVK 468          

HSP 2 Score: 51.2174 bits (121), Expect = 2.361e-6
Identity = 37/132 (28.03%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  363 LQSSFEKTSLSNTNKVVF--RRFGSLIQNMQSNTEIDDVFYVSPSDGFIWKIDNVSSFLNKTVA----ELTSNSFYTDGQYGYKIRLKL---DNSFGK---IRIKLEILKGVFDSLLPWPFNNEIEVSLLSQ 722
            L++  E  + ++ + +V    R G  IQ ++S      + Y   +   +WKI + S+ + +       EL S  FYT  QYGYK++  +    N  G+   + + +++L G +D+LL WPF++ I  +L  Q
Sbjct:  280 LEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVSKLSINY---TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTS-QYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQ 407          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 56.9954 bits (136), Expect = 3.023e-8
Identity = 39/144 (27.08%), Postives = 73/144 (50.69%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLKDS-KILEHSFYSGDFGYKLQLVLY--PNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVL-------NGNSTKNMCPSEIRNKSSKRSNS--ELA-GFIFFNKSKINNSYPSVIKDNQIFIKFK 1331
            WKI D+   + + + KD  +++   FY+  +GYKLQ  ++   NG  ++  + ++++VL G+YD  L WPF +++T  +         G   ++  P        + SN   +L  GF  F   ++ +S P  IK + +F++ K
Sbjct:  335 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP-FIKGDTVFLRVK 477          

HSP 2 Score: 50.447 bits (119), Expect = 3.785e-6
Identity = 38/132 (28.79%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  363 LQSSFEKTSLSNTNKVVF--RRFGSLIQNMQSNTEIDDVFYVSPSDGFIWKIDNVSSFL----NKTVAELTSNSFYTDGQYGYKIRLKL---DNSFGK---IRIKLEILKGVFDSLLPWPFNNEIEVSLLSQ 722
            L++  E  + ++ + +V    R G  IQ ++S      + Y   +   +WKI + S+ +     K   EL S  FYT  QYGYK++  +    N  G+   + + +++L G +D+LL WPF++ I  +L  Q
Sbjct:  289 LEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVSKLSINY---TGTLLWKITDWSAKMAEARGKDGLELVSPPFYTS-QYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQ 416          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 66.6254 bits (161), Expect = 1.011e-11
Identity = 39/148 (26.35%), Postives = 77/148 (52.03%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKLKDSKILEHSFYSGDFGYKLQLVLY--PNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS----EIRNKSSKRSNSE---LAGFI-FFNKSKINNSYPSV-IKDNQIFIKFKTKS 1340
            ++ K+ WK++D+  + K   + +    FY+   GYKL +  Y   +G      + +++ +++GD+D FL WPF+ N+T+ +L+ + T+N        ++ + S  R  S+     GF  F +   + N   +V ++D  +FIK K  +
Sbjct:  109 YDGKLIWKVRDYWHR-KESGAALSSSPFYTSRSGYKLSVRAYLGGDGSGRGSHMSLYITIMRGDFDSFLPWPFRQNITLTLLDQSGTRNHMSHTFIPDVNSDSFHRPTSDANVATGFTRFISHCDLENPRNAVFVRDETLFIKVKVDT 255          

HSP 2 Score: 59.3066 bits (142), Expect = 2.990e-9
Identity = 47/175 (26.86%), Postives = 86/175 (49.14%), Query Frame = 3
Query:  288 QLTKLQDDINDLEEEISKCKTMISRLQSSFEKTSLSNTNKVVFRRFGSLIQNMQSNTEIDDVFYVSPSDG-FIWKIDNVSSFLNKTVAELTSNSFYTDGQYGYKIRLKL---DNSFGK---IRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEYPYNHYTET--------SFYEP 767
            +L +LQ  ++ L ++++  +++   L  + E+T   +T     R     ++ +Q N +       S  DG  IWK+ +      ++ A L+S+ FYT  + GYK+ ++     +  G+   + + + I++G FDS LPWPF   I ++LL Q    NH + T        SF+ P
Sbjct:   48 ELPRLQASLDSLRQQVAVTESLREHL-GALEQTCERHT-----RLLDIHVEQLQCNEQRLRQLESSSYDGKLIWKVRDYW-HRKESGAALSSSPFYT-SRSGYKLSVRAYLGGDGSGRGSHMSLYITIMRGDFDSFLPWPFRQNITLTLLDQSGTRNHMSHTFIPDVNSDSFHRP 214          

HSP 3 Score: 52.373 bits (124), Expect = 5.804e-7
Identity = 40/134 (29.85%), Postives = 66/134 (49.25%), Query Frame = 3
Query: 1437 SPIPISSEVFQTDNFGYDIQMLVYPAGDRSVLGKYAXXXXXXXXXXFDHILPWPFQKRLTLSIVDGQNRTVDENIQVFQNKEFVADL------KPSFNQGVLIGYSRFMRLID---EWLSKYVIDNCLRIKLKI 1811
            S   +SS  F T   GY + +  Y  GD S  G + S+YI I+   FD  LPWPF++ +TL+++D          +   +  F+ D+      +P+ +  V  G++RF+   D      + +V D  L IK+K+
Sbjct:  126 SGAALSSSPFYTSRSGYKLSVRAYLGGDGSGRGSHMSLYITIMRGDFDSFLPWPFRQNITLTLLD------QSGTRNHMSHTFIPDVNSDSFHRPTSDANVATGFTRFISHCDLENPRNAVFVRDETLFIKVKV 253          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4b (tnf receptor-associated factor 4b [Source:ZFIN;Acc:ZDB-GENE-040305-2])

HSP 1 Score: 67.781 bits (164), Expect = 1.661e-11
Identity = 50/157 (31.85%), Postives = 76/157 (48.41%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLKDSKILE---HSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIRN--------KSSKRSNSELAGFI---FFNKSKINNSYP-----------SVIKDNQIFIK 1325
            WK+ DF   +Q+ K + S  LE    +FYS ++GY+LQ+  + NG + SGE   + ++LRVL G+YD  L WPF Y V+  +L+        P  I          K+ +R      G I     ++S +   YP           + I+DN +FIK
Sbjct:  312 WKLTDFSQRLQEAKTRTSGCLELFSPAFYSHNYGYRLQVSAFLNG-NGSGEDTHMSVYLRVLPGEYDGLLEWPFPYRVSFSLLDQCDPALTKPQHITETFSPDPTWKNFQRPRPGALGSIRGGCLDESMLGFGYPKFISHEEMKKRNYIRDNAVFIK 467          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 66.6254 bits (161), Expect = 4.126e-11
Identity = 47/147 (31.97%), Postives = 77/147 (52.38%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTK----LKDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLN-GNSTKNMCPSEIRNKSS---KRSNSEL---AGFIFFNKSKI--NNSYPSVIKDNQIFIK 1325
            FN  + WKI+D+ ++ +     K   +    FY+G FGYK+   +Y NG  +     L +F  V++G+YD  L WPFK  VT+ +++ G + K++  +   + SS   +R   E+   +G   F    +  N +Y   IKD+ IFIK
Sbjct:  419 FNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMNIASGCPLFVAQTVLENGTY---IKDDTIFIK 562          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 65.4698 bits (158), Expect = 9.727e-11
Identity = 34/82 (41.46%), Postives = 53/82 (64.63%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLKDS-KILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            WK+ D+   +Q+ KL+++ +     FY+  +GYKLQ+  + NG + SGE   L I++RVL G+YD+ L WPF Y VT  +L+
Sbjct:  312 WKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNG-NGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILD 392          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 65.4698 bits (158), Expect = 9.727e-11
Identity = 34/82 (41.46%), Postives = 53/82 (64.63%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLKDS-KILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            WK+ D+   +Q+ KL+++ +     FY+  +GYKLQ+  + NG + SGE   L I++RVL G+YD+ L WPF Y VT  +L+
Sbjct:  312 WKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNG-NGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILD 392          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 63.1586 bits (152), Expect = 7.316e-10
Identity = 33/82 (40.24%), Postives = 52/82 (63.41%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLKDS-KILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            WKI D+   +Q+ K++ + +     FY+  +GYKLQ+  + NG + SGE   L +++RVL G+YD+ L WPF Y VT  +L+
Sbjct:  312 WKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNG-NGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLD 392          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 61.2326 bits (147), Expect = 3.230e-9
Identity = 50/148 (33.78%), Postives = 77/148 (52.03%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIR---NKSS-KRSNSEL---AGF-IFFNKSKINNSYPSV-IKDNQIFIK 1325
            +N K+ WKI D+ +K +     +   I    FY+   GY+L    Y NG   SG+   L ++  V+KG++D  L WPFK  VT+ +L+ +  KN      R   N SS KR +SE+   +G   F + +++ N      IKD+ +FIK
Sbjct:  381 YNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNG-DGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIK 527          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 60.8474 bits (146), Expect = 3.693e-9
Identity = 50/149 (33.56%), Postives = 77/149 (51.68%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIR---NKSS-KRSNSEL---AGF-IFFNKSKINNSYPSV-IKDNQIFIKF 1328
            +N K+ WKI D+ +K +     +   I    FY+   GY+L    Y NG   SG+   L ++  V+KG++D  L WPFK  VT+ +L+ +  KN      R   N SS KR +SE+   +G   F + +++ N      IKD+ +FIK 
Sbjct:  331 YNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNG-DGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKI 478          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 60.8474 bits (146), Expect = 4.346e-9
Identity = 50/149 (33.56%), Postives = 77/149 (51.68%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIR---NKSS-KRSNSEL---AGF-IFFNKSKINNSYPSV-IKDNQIFIKF 1328
            +N K+ WKI D+ +K +     +   I    FY+   GY+L    Y NG   SG+   L ++  V+KG++D  L WPFK  VT+ +L+ +  KN      R   N SS KR +SE+   +G   F + +++ N      IKD+ +FIK 
Sbjct:  382 YNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNG-DGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKI 529          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 58.9214 bits (141), Expect = 1.288e-8
Identity = 37/139 (26.62%), Postives = 71/139 (51.08%), Query Frame = 3
Query:  948 WKIKDFIQKTK----LKDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRS----NSELAGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            WKI D   K+      +   +   +FY+  +GYK+ L +Y NG        + +F  V+KG+YD  L WPFK+ VT  +++ N+  ++  +   ++ + S +R     N      +F   +K+N+   + I++N ++I+
Sbjct:  234 WKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRDSVFDAFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIR 372          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 66.6254 bits (161), Expect = 3.299e-11
Identity = 45/152 (29.61%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  912 LNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSE---LAGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            L  E  F+    WKI +  ++       +   +   +FY+  +GYKL L LY NG   SG+   L +F+ +++G+YD  L WPF+  VT  +L+ N+ ++   +   ++ + S +R  SE    +G  +FF  SK+ +   + +KD+ +F+K
Sbjct:  252 LMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNG-DGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 402          

HSP 2 Score: 61.2326 bits (147), Expect = 1.627e-9
Identity = 37/88 (42.05%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  492 DG-FIWKIDNVSSFLNKTVA----ELTSNSFYTDGQYGYKIRLKL----DNSFGKIRIKL--EILKGVFDSLLPWPFNNEIEVSLLSQ 722
            DG F+WKI NV+   +++V      L S +FYT  +YGYK+ L+L    D S  K  + L   I++G +D+LLPWPF N++   LL Q
Sbjct:  259 DGTFLWKITNVTKRCHESVCGRTVSLFSPAFYT-AKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ 345          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 66.6254 bits (161), Expect = 3.299e-11
Identity = 45/152 (29.61%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  912 LNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSE---LAGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            L  E  F+    WKI +  ++       +   +   +FY+  +GYKL L LY NG   SG+   L +F+ +++G+YD  L WPF+  VT  +L+ N+ ++   +   ++ + S +R  SE    +G  +FF  SK+ +   + +KD+ +F+K
Sbjct:  252 LMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNG-DGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 402          

HSP 2 Score: 61.2326 bits (147), Expect = 1.627e-9
Identity = 37/88 (42.05%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  492 DG-FIWKIDNVSSFLNKTVA----ELTSNSFYTDGQYGYKIRLKL----DNSFGKIRIKL--EILKGVFDSLLPWPFNNEIEVSLLSQ 722
            DG F+WKI NV+   +++V      L S +FYT  +YGYK+ L+L    D S  K  + L   I++G +D+LLPWPF N++   LL Q
Sbjct:  259 DGTFLWKITNVTKRCHESVCGRTVSLFSPAFYT-AKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ 345          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 66.6254 bits (161), Expect = 3.299e-11
Identity = 45/152 (29.61%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  912 LNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSE---LAGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            L  E  F+    WKI +  ++       +   +   +FY+  +GYKL L LY NG   SG+   L +F+ +++G+YD  L WPF+  VT  +L+ N+ ++   +   ++ + S +R  SE    +G  +FF  SK+ +   + +KD+ +F+K
Sbjct:  252 LMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNG-DGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 402          

HSP 2 Score: 61.2326 bits (147), Expect = 1.627e-9
Identity = 37/88 (42.05%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  492 DG-FIWKIDNVSSFLNKTVA----ELTSNSFYTDGQYGYKIRLKL----DNSFGKIRIKL--EILKGVFDSLLPWPFNNEIEVSLLSQ 722
            DG F+WKI NV+   +++V      L S +FYT  +YGYK+ L+L    D S  K  + L   I++G +D+LLPWPF N++   LL Q
Sbjct:  259 DGTFLWKITNVTKRCHESVCGRTVSLFSPAFYT-AKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ 345          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 63.5438 bits (153), Expect = 4.475e-10
Identity = 44/141 (31.21%), Postives = 74/141 (52.48%), Query Frame = 3
Query:  948 WKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL---AGFIFF---NKSKINNSYPSVIKDNQIFIK 1325
            WKI DF +K +     +   I   +FY+  +GYK+ L +Y NG        L +F  V+KG  D  L WPF   VT+ +L+ N+ +++  +   ++ + S +R  S++   +G   F   +K +  NSY   ++D+ IFIK
Sbjct:  356 WKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSY---VRDDAIFIK 493          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 63.5438 bits (153), Expect = 4.695e-10
Identity = 44/141 (31.21%), Postives = 74/141 (52.48%), Query Frame = 3
Query:  948 WKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL---AGFIFF---NKSKINNSYPSVIKDNQIFIK 1325
            WKI DF +K +     +   I   +FY+  +GYK+ L +Y NG        L +F  V+KG  D  L WPF   VT+ +L+ N+ +++  +   ++ + S +R  S++   +G   F   +K +  NSY   ++D+ IFIK
Sbjct:  363 WKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSY---VRDDAIFIK 500          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39428|TRAF1_MOUSE (TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 2.307e-10
Identity = 45/152 (29.61%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  912 LNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSE---LAGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            L  E  F+    WKI +  ++       +   +   +FY+  +GYKL L LY NG   SG+   L +F+ +++G+YD  L WPF+  VT  +L+ N+ ++   +   ++ + S +R  SE    +G  +FF  SK+ +   + +KD+ +F+K
Sbjct:  252 LMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNG-DGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 402          

HSP 2 Score: 61.2326 bits (147), Expect = 1.138e-8
Identity = 37/88 (42.05%), Postives = 53/88 (60.23%), Query Frame = 3
Query:  492 DG-FIWKIDNVSSFLNKTVA----ELTSNSFYTDGQYGYKIRLKL----DNSFGKIRIKL--EILKGVFDSLLPWPFNNEIEVSLLSQ 722
            DG F+WKI NV+   +++V      L S +FYT  +YGYK+ L+L    D S  K  + L   I++G +D+LLPWPF N++   LL Q
Sbjct:  259 DGTFLWKITNVTKRCHESVCGRTVSLFSPAFYT-AKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ 345          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13077|TRAF1_HUMAN (TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.437e-10
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query:  912 LNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSE---LAGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            L  E  F+    WKI +  ++       +   +   +FY+  +GYKL L LY NG        L +F+ +++G+YD  L WPF+  VT  +L+ N+ ++   +   ++ + S +R  SE    +G  +FF  SK+ +   + +KD+ +F+K
Sbjct:  259 LMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 409          

HSP 2 Score: 58.5362 bits (140), Expect = 1.040e-7
Identity = 37/89 (41.57%), Postives = 54/89 (60.67%), Query Frame = 3
Query:  492 DG-FIWKIDNVS-----SFLNKTVAELTSNSFYTDGQYGYKIRLKL----DNSFGKIRIKL--EILKGVFDSLLPWPFNNEIEVSLLSQ 722
            DG F+WKI NV+     S   +TV+ L S +FYT  +YGYK+ L+L    D +  +  + L   I++G +D+LLPWPF N++   LL Q
Sbjct:  266 DGTFLWKITNVTRRCHESACGRTVS-LFSPAFYT-AKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQ 352          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.130e-9
Identity = 44/141 (31.21%), Postives = 74/141 (52.48%), Query Frame = 3
Query:  948 WKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL---AGFIFF---NKSKINNSYPSVIKDNQIFIK 1325
            WKI DF +K +     +   I   +FY+  +GYK+ L +Y NG        L +F  V+KG  D  L WPF   VT+ +L+ N+ +++  +   ++ + S +R  S++   +G   F   +K +  NSY   ++D+ IFIK
Sbjct:  356 WKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSY---VRDDAIFIK 493          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 3.748e-9
Identity = 43/146 (29.45%), Postives = 76/146 (52.05%), Query Frame = 3
Query:  927 VFNRKIKWKIKDF-IQKTKLKDSK---ILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL---AGFI-FFNKSKINNSYPSVIKDNQIFIK 1325
             +N K+ WK+ D+ ++K +  D     I   SFY+   GY+L    Y NG        L ++  V++G++D  L WPF+  VT+ +L+ +  KN+  +   +  + S KR + E+   +G   F   S + N+  + IKD+ +F+K
Sbjct:  401 CYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLK 546          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 9.301e-9
Identity = 44/146 (30.14%), Postives = 77/146 (52.74%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIR---NKSS-KRSNSEL---AGF-IFFNKSKINNSYPSVIKDNQIFIK 1325
            +N  + WKI+D+ ++ +     K   +    FY+G FGYK+   +Y NG  +     L +F  +++G+YD  L WPFK  VT+ +++  S++       +   N SS K+   E+   +G  +F  ++ + N   + IKD+ IFIK
Sbjct:  414 YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENG--TYIKDDTIFIK 557          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: B7PYP8 (Tnf receptor associated factor, putative OS=Ixodes scapularis OX=6945 GN=8033322 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.057e-11
Identity = 76/331 (22.96%), Postives = 143/331 (43.20%), Query Frame = 3
Query:  420 RFGSLIQN----MQSNTEIDDVFYVSPSDGFIWKIDNVSSFLNKTVAELTSNS---------FYTDGQYGYKIRLKLDNSFGKIRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEYPYNHYTETSFYE---PDTCLHRAVKSFKQYSHIYSVQIKKILYQGFKFEREPLV---VECFLN------GGKDLNNEKVFNRKIKWKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNGVS----------DSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLN-GNSTKNM----------CPSEIRNKSSKRSNSELAGFIFF 1262
            R+GSL+      M+     +    V   D  + + D + S + + VA+  S S         + T+G Y   +RL  + + G I + +   +G +DS+L WPF  + E+ L+ Q+      T T+F     PD  L + ++ F ++S   S  +   +  G ++  +  +      FL           L N  + +  + W++KD + K  L      SK+    FY+G+ GY +++ +  N V+          D   L I+  + KG +D  L WPF + +++ +++  NS +++          CP E  ++     N +  G+  F
Sbjct:  507 RYGSLLVKVVVYMEEIEPPNQAKLVFRDDSVVAEYDWLVSDIKEKVAQARSGSLQFVDSEKFYLTNGGYRVMLRLYPEKTRGFIGLYVVFTRGAYDSVLDWPFTQKYELVLVDQKDATADITHTTFAASGCPDIALQKPMQEFAEWSCGESQMVSHDVLDGDEYVLKGAIRVRFRVFLKEYASHVASIALRNNALVSEYL-WELKDVLAKVNLLMNGGFSKVESPLFYTGNQGYAMRISVVLNRVTTPLQTLASNDDQSVLGIYFTLWKGKHDSVLAWPFPHAISLALVDPSNSGRDLAKTVDPTNARCPPEAFHRPKGTRNEQACGYSAF 836          

HSP 2 Score: 73.1738 bits (178), Expect = 1.184e-9
Identity = 112/495 (22.63%), Postives = 198/495 (40.00%), Query Frame = 3
Query:  369 SSFEKTSLSNTNKVVFRRFGSLIQNMQ--SNTEIDDVFYVSPSDGFIWKIDNVSSFL----NKTVAELTSNSFYTDGQYGYKIRLKL---DNSFGKIRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEY---------------PY--NHYTETSFYEP----DTCLHRAVKSF-----KQYSHIYSVQIKKILYQGFKFEREPLVVECFLNGGKDLNNEKVFNRKIKWKIKDFIQKTKLKDSKILE----HSFYSGDFGYKLQLVLYPNGVSDSGELDIFLRVLKGDYDDFLWWPF--KY--------NVTIKVLNGNSTKNMCPSEIRNKSSKRSNSELAGFIFFNKSKINNSYPSVIKDNQIFIKFKT--KSPLSYI--ITTQKNRTTVEX--XXXXXXXXXXXXXXGSPIPISSEVFQTDNFGYDIQMLVY------------PAGDRSVLGKYAXXXXXXXXXXFDHILPWPFQKRLTLSIVDGQNRTVD 1652
            S+ E+ +     K++ R F +++  M   ++  + D   V+    + WK+ N+   +    +   + L S  FYT  Q GY ++++L   +++ G I + L +L+G +DSL  WPF    ++ ++ Q++               PY  N     SF+ P    D C   +  S+     ++Y    S+ +K ++Y     E EP       N  K +  +     +  W + D  +K     S  L+      FY  + GY++ L LYP      G + +++   +G YD  L WPF  KY        + T  + +     + CP     K  +       G        + +    V+K   I ++F+   K   S++  I  + N    E   +      K    + G    + S +F T N GY +++ V                D+SVLG Y      +     D +L WPF   ++L++VD  N   D
Sbjct:  329 SALERNNFKKDGKILLR-FTAILDQMPNFASVSVKDRHLVAE---YTWKVPNIERKIALASSGRASNLLSERFYTRHQ-GYLMQMQLKFQNHTNGSIGVFLTLLEGGYDSLARWPFVKRFDLIIIDQQHGKTGNDVVVAVDPNNPYIRNEACVGSFWRPFGRNDACGSSSTISYEEVYNRKYIRYGSLLVKVVVYME---EIEP------PNQAKLVFRDDSVVAEYDWLVSDIKEKVAQARSGSLQFVDSEKFYLTNGGYRVMLRLYPE--KTRGFIGLYVVFTRGAYDSVLDWPFTQKYELVLVDQKDATADITHTTFAASGCPDIALQKPMQEFAEWSCGESQMVSHDVLDGDEYVLK-GAIRVRFRVFLKEYASHVASIALRNNALVSEYLWELKDVLAKVNLLMNGGFSKVESPLFYTGNQGYAMRISVVLNRVTTPLQTLASNDDQSVLGIY----FTLWKGKHDSVLAWPFPHAISLALVDPSNSGRD 802          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 7.127e-10
Identity = 39/92 (42.39%), Postives = 54/92 (58.70%), Query Frame = 3
Query:  918 NEKVF-NRKIKWKIKDFIQ----KTKLKDSKILEHSFYSGDFGYKLQLVLYP--NGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            N+ +F N K  WKIK F +      + K+  IL  +FY+ DFGYK+ + +YP  +GV     L IF  ++KGDYDD L WPFK  V I + +
Sbjct:  297 NKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFD 388          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2D0RTQ7 (TNF receptor-associated factor OS=Ictalurus punctatus OX=7998 GN=LOC108271110 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.156e-10
Identity = 45/148 (30.41%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKLKDSKILEHSFYSGDFGYKLQLVLYPNGVSDS--GELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEI---RNKSSKR-----SNSELAGFIFFNKSKINNSYPSV-IKDNQIFIKFKTKS 1340
            ++ K+ WK+ D+ Q+ K   + +    FY+G  GYKL   +YP+G   +    L +++ V++GD+D  L WPF+  VT+ VL+ + ++N          NK S R     SN+ L    F + + +     +V I+D+ +FIK K  +
Sbjct:  398 YDGKLIWKVHDY-QRRKDAGAPLTSPPFYTGRSGYKLSARVYPDGEGSARGTHLSLYVMVMRGDFDSLLPWPFRQGVTLTVLDQSGSRNHISCSFTPDTNKESFRRPTADSNAALGFSRFISHTDLEGPRNAVYIRDDTLFIKVKVDT 544          

HSP 2 Score: 60.4622 bits (145), Expect = 8.912e-6
Identity = 40/127 (31.50%), Postives = 69/127 (54.33%), Query Frame = 3
Query: 1446 PISSEVFQTDNFGYDIQMLVYPAGDRSVLGKYAXXXXXXXXXXFDHILPWPFQKRLTLSIVD--GQNRTVDENIQVFQNKEFVADLKPSFNQGVLIGYSRFMRLIDEWLSK---YVIDNCLRIKLKI 1811
            P++S  F T   GY +   VYP G+ S  G + S+Y+ ++   FD +LPWPF++ +TL+++D  G    +  +     NKE     +P+ +    +G+SRF+   D    +   Y+ D+ L IK+K+
Sbjct:  418 PLTSPPFYTGRSGYKLSARVYPDGEGSARGTHLSLYVMVMRGDFDSLLPWPFRQGVTLTVLDQSGSRNHISCSFTPDTNKESFR--RPTADSNAALGFSRFISHTDLEGPRNAVYIRDDTLFIKVKV 542          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: K1R9U7 (TNF receptor-associated factor 3 OS=Crassostrea gigas OX=29159 GN=CGI_10023156 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.115e-9
Identity = 45/145 (31.03%), Postives = 78/145 (53.79%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKLKDS----KILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLN-GNSTKNMCPS---EIRNKSSKRSNSEL---AGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            +N  + WKI+D+ ++ +   S     +    FY+G FGYK+   +Y NG  V     L +F  V +G+YD  L WPFK  V++ +L+  N T+++  S   +I + S KR  SE+   +G   F    +  + P+ ++++ I+IK
Sbjct:    6 YNGVLMWKIRDYSRRKQDAKSGRTISLYSQPFYTGRFGYKMCARVYLNGDGVGKGTHLSLFFVVQRGEYDALLPWPFKQKVSLMLLDQDNGTRHLVDSFRPDITSSSFKRPTSEMNVASGCPLFVSHSVLET-PTFLQEDTIYIK 149          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A401Q9D5 (MATH domain-containing protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0021488 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.264e-9
Identity = 44/146 (30.14%), Postives = 76/146 (52.05%), Query Frame = 3
Query:  930 FNRKIKWKIKDFI-QKTKLKDSKILE---HSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTK----NMCPSEIRNKSSKRSNSEL----AGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            +N ++ WKI+D+  QK +    KIL      FY+  FGYK+   +Y NG  +     L +F  V++G+YD  L WPF+  VT+ +L+   +K    +M   +  + S ++ ++++       +F  +  + N     IKD+ IFIK
Sbjct:   24 YNGQLVWKIRDYTRQKQEAVSGKILSLYSQPFYTSPFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDPLLPWPFRQKVTLALLDQGPSKKHMTDMFKPDPDSTSFRKPHTDMNIASGCPLFVPQPVLENETHHYIKDDTIFIK 169          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 69.707 bits (169), Expect = 3.847e-12
Identity = 43/139 (30.94%), Postives = 76/139 (54.68%), Query Frame = 3
Query:  948 WKIKDFIQKTKL----KDSKILEHSFYSGDFGYK--LQLVLYPNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL----AGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            W+I D  QK K     + S     +FY+  +G+K  ++L +Y +GV     + +F  ++KGDYD  L WPFK  VT  +++ N  +++  +   ++R+ S +R  SE+       +FF  SK+ +   + +KD+ +FIK
Sbjct:  373 WRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIK 511          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 69.3218 bits (168), Expect = 5.422e-12
Identity = 43/139 (30.94%), Postives = 76/139 (54.68%), Query Frame = 3
Query:  948 WKIKDFIQKTKL----KDSKILEHSFYSGDFGYK--LQLVLYPNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL----AGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            W+I D  QK K     + S     +FY+  +G+K  ++L +Y +GV     + +F  ++KGDYD  L WPFK  VT  +++ N  +++  +   ++R+ S +R  SE+       +FF  SK+ +   + +KD+ +FIK
Sbjct:  396 WRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIK 534          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.510e-11
Identity = 49/148 (33.11%), Postives = 79/148 (53.38%), Query Frame = 3
Query:  927 VFNRKIKWKIKDFIQ-KTKLKDSKILE---HSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLN-GNSTKNMCPS---EIRNKSSKRSNSEL---AGFIFFNKSKI--NNSYPSVIKDNQIFIK 1325
            +FN  + WKI+D+ + K +   SK L      FY+G FGYK+   +Y NG  +     L +F  V++G+YD  L WPFK  VT+ +++ G + K++  +   +  + S +R   E+   +G   F    +  N +Y   IKD+ IFIK
Sbjct:    1 IFNGTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPTGEMNIASGCPLFVAQTVLENGTY---IKDDTIFIK 145          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 63.929 bits (154), Expect = 2.666e-10
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLKDS-KILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            WK+ D+   +Q+ KL ++ +     FY+  +GYKLQ+  + NG + SGE   L I++RVL G+YD+ L WPF Y VT  +L+
Sbjct:  312 WKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNG-NGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILD 392          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 63.5438 bits (153), Expect = 3.197e-10
Identity = 43/138 (31.16%), Postives = 70/138 (50.72%), Query Frame = 3
Query:  948 WKIKDFIQKTK----LKDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL---AGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            WKI DF ++ +     +   +   +FYS  +GYK+ L LY NG        L +F  V++G YD  L WPF   VT+ +L+ N+ +++  +   +I + S +R  SE+   +G   F          S ++D+ IFIK
Sbjct:  386 WKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 523          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 3.140e-11
Identity = 41/145 (28.28%), Postives = 72/145 (49.66%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKLKDS----KILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIR----NKSSKRSNSEL---AGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            +N K+ WKI+D+ ++ +   S     +    FY+  FGY++    Y NG  V     L +F  V++G+YD  L WPF+  VT+ +L+  + +       +    + S +R  S++   +G   F  S +     S ++D+ IFIK
Sbjct:  323 YNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLF-VSHVALESASYLQDDTIFIK 466          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.153e-10
Identity = 29/92 (31.52%), Postives = 50/92 (54.35%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTKLKDS----KILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTK 1187
            ++ K+ WKI+D+ ++ +   S     +    FY+  FGYK+    Y NG  V     L +F  V++G+YD  L WPF+  VT+ +L+  + +
Sbjct:  266 YSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAAR 357          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 63.1586 bits (152), Expect = 1.390e-10
Identity = 40/119 (33.61%), Postives = 66/119 (55.46%), Query Frame = 3
Query:  876 LVVECFLNGGKDLNNEKVFNRKIK--------WKIKDFIQ---KTKLKDSKILEHS--FYSGDFGYKLQLVLYP--NGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTK 1187
            LV E  +   K++N+ K   R  K        W+I DF +   + K K    L HS  FY+ ++GYK ++VL+P  NG  +   L +++R+L G+YD  L WPF+  +T+ +L+ ++ K
Sbjct:  285 LVSELAIQQQKEINSLKEIVRHCKPYHDSKLLWRIDDFWEAFDEGKRKPGTEL-HSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQSTDK 402          

HSP 2 Score: 51.9878 bits (123), Expect = 4.785e-7
Identity = 39/128 (30.47%), Postives = 71/128 (55.47%), Query Frame = 3
Query: 1449 ISSEVFQTDNFGYDIQMLVYPAGDRSVLGKYAXXXXXXXXXXFDHILPWPFQKRLTLSIVDGQNRTVDENIQVFQNKEFVAD------LKPSFNQGVL-IGYSRFMRLIDEWLSKYVIDNCLRIKLKI 1811
            + S VF T N+GY  +++++P G+ S  G + S+YI ++   +D +LPWPF+ ++TL+++D   ++ D+  +   ++ F  D       +PS N   L  GY +F+         YV D+ L +K+ I
Sbjct:  337 LHSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLD---QSTDKRAKRHISQSFSPDPNWKSFQRPSKNSTSLGFGYPQFVSHRGLESIGYVRDDVLFLKVTI 461          

HSP 3 Score: 50.447 bits (119), Expect = 1.442e-6
Identity = 31/85 (36.47%), Postives = 46/85 (54.12%), Query Frame = 3
Query:  498 FIWKIDNVSSFLN----KTVAELTSNSFYTDGQYGYKIRLKL---DNSFGK---IRIKLEILKGVFDSLLPWPFNNEIEVSLLSQ 722
             +W+ID+     +    K   EL S  FYT   YGYK ++ L    N  G+   + + + +L G +DSLLPWPF  +I ++LL Q
Sbjct:  315 LLWRIDDFWEAFDEGKRKPGTELHSPVFYTSN-YGYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQ 398          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 59.6918 bits (143), Expect = 2.035e-9
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 3
Query:  948 WKIKDFIQKTKLKDS----KILEHSFYSGDFGYKLQLVLYPNGVSDSGE--LDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNM 1193
            WKI  F ++     S     I    FY+  FGYKL   L+PNG   + +  L IF+ +++G+YD  L WPF+  +TI +++ ++  N+
Sbjct:  384 WKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNI 471          

HSP 2 Score: 55.0694 bits (131), Expect = 5.650e-8
Identity = 37/127 (29.13%), Postives = 64/127 (50.39%), Query Frame = 3
Query: 1434 GSPIPISSEVFQTDNFGYDIQMLVYPAGDRSVLGKYAXXXXXXXXXXFDHILPWPFQKRLTLSIVDGQN-RTVDENIQVFQNKEFVADLKPSFNQGVLIGYSRFMRLIDEWLSKYVIDNCLRIKLKI 1811
            G+   I S  F T  FGY +   ++P GD S    Y S++I ++   +D ILPWPFQ+ +T++++D  N   + E      +   ++  +P+ N  V  G  RF          Y+ +NC+ +K+ +
Sbjct:  399 GNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNISETFD--PDPCSISFQRPTRNINVASGCPRFCSQTVLRTRGYMNENCVFVKVVV 523          

HSP 3 Score: 53.9138 bits (128), Expect = 1.416e-7
Identity = 36/106 (33.96%), Postives = 58/106 (54.72%), Query Frame = 3
Query:  492 DG-FIWKIDNVSSFLNKT----VAELTSNSFYTDGQYGYKIRLKL-DNSFGKIR-----IKLEILKGVFDSLLPWPFNNEIEVSLLSQEYPYNHYTETSFYEPDTC 776
            DG F+WKID  +    +        + S+ FYT  ++GYK+  +L  N  G  R     I + +++G +DS+LPWPF   I ++L+ Q+   N  +ET  ++PD C
Sbjct:  379 DGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTH-RFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMN-ISET--FDPDPC 480          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 59.3066 bits (142), Expect = 2.810e-9
Identity = 39/138 (28.26%), Postives = 67/138 (48.55%), Query Frame = 3
Query:  948 WKIKDFIQK----TKLKDSKILEHSFYSGDFGYKLQLVLYPN--GVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKR--SNSELAGFIFFNKSKINNSYPSVIKDNQIFIKF 1328
            WKI ++ ++       K   I    FY G +GYK    +YPN  G+     L +F  +++G++D  L WPF+  VT K+L+ +   ++  +   +  + S KR  SN  +A       S  N    + ++D+ +FIK 
Sbjct:  382 WKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYVRDDTMFIKI 519          

HSP 2 Score: 49.2914 bits (116), Expect = 3.694e-6
Identity = 31/89 (34.83%), Postives = 48/89 (53.93%), Query Frame = 3
Query:  492 DG-FIWKIDNVSSFLNKTVAELT----SNSFYTDGQYGYKIRLKL---DNSFGK---IRIKLEILKGVFDSLLPWPFNNEIEVSLLSQE 725
            DG +IWKID  +    + V+  T    S  FY  G+YGYK   ++    +  GK   + +   +++G FD+LLPWPF  ++   LL Q+
Sbjct:  377 DGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYV-GRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQD 464          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 58.9214 bits (141), Expect = 3.177e-9
Identity = 23/56 (41.07%), Postives = 37/56 (66.07%), Query Frame = 3
Query: 1011 FYSGDFGYKLQLVLYPNGVSDS--GELDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            FY+  +GYK++L  YPNG  D     L + +R++KG+YD  L WPF+  +T+ ++N
Sbjct:  368 FYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLIN 423          

HSP 2 Score: 50.8322 bits (120), Expect = 1.223e-6
Identity = 34/121 (28.10%), Postives = 64/121 (52.89%), Query Frame = 3
Query: 1464 FQTDNFGYDIQMLVYPAGDRSVLGKYAXXXXXXXXXXFDHILPWPFQKRLTLSIVDGQNRTVDENIQVFQNKEFVADLKPSF-----NQGVLIGYSRFMRLIDEWLSKYVIDNCLRIKLKI 1811
            F T  +GY +++  YP G     G + S+ I I+   +D IL WPF++++TLS+++   +   E ++++ + +   D K  F     N+ V  GYS F+  ++     Y+ D+ + I+  I
Sbjct:  368 FYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWRSETVEIYPD-DATPDKKHKFERPIENENVGCGYSCFISHMELNSGDYIKDDVIFIEAVI 487          

HSP 3 Score: 49.2914 bits (116), Expect = 3.908e-6
Identity = 38/124 (30.65%), Postives = 58/124 (46.77%), Query Frame = 3
Query:  489 SDG-FIWKIDNVSSFLNKTVAELTSNS-----------------------FYTDGQYGYKIRLKL-DNSFG-----KIRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEYPYNHYTETSFYEPD 770
            +DG F+W+I N      K VA  T+                         FYT  +YGYK+RLK   N +G      + + + I+KG +D++L WPF  +I +SL++Q   +   +ET    PD
Sbjct:  318 TDGTFVWRICNYKDKYKKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYT-SRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWR--SETVEIYPD 438          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO40665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K0])

HSP 1 Score: 56.9954 bits (136), Expect = 1.194e-8
Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 3
Query:  933 NRKIKWKIKDFIQ-----KTKLKDSKILEHSFYSGDFGYKLQLVLYPNGVSDS--GELDIFLRVLKGDYDDFLWWPFKYNV 1154
            N K  WKI ++ Q      TK +  K+    FY+G +GYKL+   + NG+       L +++ ++KGDYD  L WPF+  V
Sbjct:  228 NGKFLWKISNYTQLFQQSATKKEKEKLCSPPFYTGQYGYKLRAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRV 308          

HSP 2 Score: 56.6102 bits (135), Expect = 1.528e-8
Identity = 31/87 (35.63%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  498 FIWKIDNVSSFLNKTVAE-----LTSNSFYTDGQYGYKIRLK-LDNSFGK-----IRIKLEILKGVFDSLLPWPFNNEIEVSLLSQE 725
            F+WKI N +    ++  +     L S  FYT GQYGYK+R +   N  G+     + + + I+KG +DS+LPWPF   ++  L+ Q+
Sbjct:  231 FLWKISNYTQLFQQSATKKEKEKLCSPPFYT-GQYGYKLRAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRVDFILIDQD 316          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 64.6994 bits (156), Expect = 1.226e-10
Identity = 46/145 (31.72%), Postives = 77/145 (53.10%), Query Frame = 3
Query:  930 FNRKIKWKIKDFIQKTK----LKDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLN-GNSTKNMCPSEIRNKSS---KRSNSEL---AGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            +N  + WKI+D+ ++ +     K   +    FY+G FGYK+   +Y NG  +     L +F  V++G+YD  L WPFK  VT+ +++ G S K++  +   + SS   +R  +E+   +G   F    +  S  + IKD+ IFIK
Sbjct:  296 YNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVSQSVLESG-TYIKDDTIFIK 439          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 64.3142 bits (155), Expect = 1.725e-10
Identity = 33/82 (40.24%), Postives = 52/82 (63.41%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLK-DSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            WK+ D+   +Q+ KL+ + +     FY+  +GYKLQ+  + NG + SGE   L +++RVL G+YD+ L WPF Y VT  +L+
Sbjct:  305 WKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNG-NGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILD 385          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 64.3142 bits (155), Expect = 1.780e-10
Identity = 33/82 (40.24%), Postives = 52/82 (63.41%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLK-DSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            WK+ D+   +Q+ KL+ + +     FY+  +GYKLQ+  + NG + SGE   L +++RVL G+YD+ L WPF Y VT  +L+
Sbjct:  312 WKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNG-NGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILD 392          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 64.3142 bits (155), Expect = 1.866e-10
Identity = 33/82 (40.24%), Postives = 52/82 (63.41%), Query Frame = 3
Query:  948 WKIKDF---IQKTKLK-DSKILEHSFYSGDFGYKLQLVLYPNGVSDSGE---LDIFLRVLKGDYDDFLWWPFKYNVTIKVLN 1172
            WK+ D+   +Q+ KL+ + +     FY+  +GYKLQ+  + NG + SGE   L +++RVL G+YD+ L WPF Y VT  +L+
Sbjct:  312 WKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNG-NGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILD 392          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 61.2326 bits (147), Expect = 1.910e-9
Identity = 42/139 (30.22%), Postives = 70/139 (50.36%), Query Frame = 3
Query:  948 WKIKDFIQKTKL----KDSKILEHSFYSGDFGYKLQLVLYPNG--VSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPS---EIRNKSSKRSNSEL----AGFIFFNKSKINNSYPSVIKDNQIFIK 1325
            WKI DF  + +     +   +   +FYS  +GYK+ L LY NG        L +F  V++  YD  L WPF   VT+ +L+ N+ +++  +   +I + S +R  SE+       +F   +K+    P  ++D+ IFIK
Sbjct:  371 WKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSP-YLRDDTIFIK 508          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000035446.1 (SMESG000035446.1)

HSP 1 Score: 1070.07 bits (2766), Expect = 0.000e+0
Identity = 556/562 (98.93%), Postives = 558/562 (99.29%), Query Frame = 3
Query:  132 MIFRVSFLFVLASVIKREGIGLFGFQLNLRDQVTKNTQNIIKLDQAQYKFINQLTKLQDDINDLEEEISKCKTMISRLQSSFEKTSLSNTNKVVFRRFGSLIQNMQSNTEIDDVFYVSPSDGFIWKIDNVSSFLNKTVAELTSNSFYTDGQYGYKIRLKLDNSFGKIRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEYPYNHYTETSFYEPDTCLHRAVKSFKQYSHIYSVQIKKILYQGFKFEREPLVVECFLNGGKDLNNEKVFNRKIKWKIKDFIQKTKLKDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIRNKSSKRSNSELAGFIFFNKSKINNSYPSVIKDNQIFIKFKTKSPLSYIITTQKNRTTVEXXXXXXXXXXXXXXXGSPIPISSEVFQTDNFGYDIQMLVYPAGDRSVLGKYAXXXXXXXXXXFDHILPWPFQKRLTLSIVDGQNRTVDENIQVFQNKEFVADLKPSFNQGVLIGYSRFMRLIDEWLSKYVIDNCLRIKLKIHN 1817
            MIFRVSFLFVLASVIKREGIGLFGFQLNLRDQVTKNTQNIIKLDQAQYKFINQLTKLQDDINDLEEEISKCKTMISRLQSSFEKTSLSNTNKVVFRRFGSLIQNMQSNTEIDDVFYVSPSDGFIWKIDNVSSFLNKTVAELTSNSFYTDGQYGYKIRLKLDNSFGKIRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEYPYNHYTETS YEPDTCLHRAVKSFKQYSHIYSVQIKKILYQGFKFEREPLVVECFLNGGKDLNNEKVFNRKIKWKIKDFIQKTKLKDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIRNKSSKR NSELAGFIFFNKSKINNSYPSVIKDNQ+FIKFKTKSPLSYIITTQ+NRTTVENKEIIWNIKNFNKIKGSPIPISSEVFQT NFGYDIQMLVYPAGDRSVLGKYASVYIYIVYS FDHILPWPFQKRLTLSIVDGQNRTVDENIQVFQNKEFVADLKPSFNQGVLIGYSRFMRLIDEWLSKYVIDNCLRIKLKIHN
Sbjct:    1 MIFRVSFLFVLASVIKREGIGLFGFQLNLRDQVTKNTQNIIKLDQAQYKFINQLTKLQDDINDLEEEISKCKTMISRLQSSFEKTSLSNTNKVVFRRFGSLIQNMQSNTEIDDVFYVSPSDGFIWKIDNVSSFLNKTVAELTSNSFYTDGQYGYKIRLKLDNSFGKIRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEYPYNHYTETSLYEPDTCLHRAVKSFKQYSHIYSVQIKKILYQGFKFEREPLVVECFLNGGKDLNNEKVFNRKIKWKIKDFIQKTKLKDSKILEHSFYSGDFGYKLQLVLYPNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNSTKNMCPSEIRNKSSKRFNSELAGFIFFNKSKINNSYPSVIKDNQMFIKFKTKSPLSYIITTQENRTTVENKEIIWNIKNFNKIKGSPIPISSEVFQTANFGYDIQMLVYPAGDRSVLGKYASVYIYIVYSLFDHILPWPFQKRLTLSIVDGQNRTVDENIQVFQNKEFVADLKPSFNQGVLIGYSRFMRLIDEWLSKYVIDNCLRIKLKIHN 562          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000039062.1 (SMESG000039062.1)

HSP 1 Score: 77.411 bits (189), Expect = 1.096e-14
Identity = 83/313 (26.52%), Postives = 145/313 (46.33%), Query Frame = 3
Query:  498 FIWKIDNVSSFLNKT----VAELTSNSFYTDGQYGYKIRLKLD-NSFGK-----IRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEYPYNHYTETSFYE--PDTCLHRAVKSFKQYSHIYS--VQIKKILYQGFKFEREPLVVECFLN-GGKDLNNEKVFNRKIKWKIKDFIQKTKLKDS----KILEHSFYSGDFGYKLQLVLYPNGVSD--SGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNS---------TKNMCPSEI-RNK--SSKRSNSELAGFIFFNKSKINNSYPSVIKDNQIFIKFKTK 1337
            F W I N S+         V E+ S+ F +  + GY++  + D N  G      + I + I+KG  D+ LPWPF   +  S+++Q+    H      Y+  P++        F+     +   + +K++  Q        ++++C ++  GK  N       KI W +K+F Q  K   S    +I    FYS   GYK+ L LYPNG++   +  + I+ +++KG +DD L WP+K NV  ++++ ++         T ++ P    RN+  + K        FI F K  +N   P +I D++I  +  T+
Sbjct:  288 FTWTIHNFSNKRENAKSGKVYEIFSDPFLSH-ENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLPWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISLKELETQTGLIVDNKIILKCKVHLDGKLANTLHENGNKIIWTVKNFTQLRKDAQSGKAVQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMN---PGLIVDDKIAFRVTTE 596          

HSP 2 Score: 65.4698 bits (158), Expect = 7.948e-11
Identity = 70/278 (25.18%), Postives = 119/278 (42.81%), Query Frame = 3
Query:  846 YQGFKFEREPLVVECFLNGGKDLNNEKVFNRKIKWKIKDFIQKTKLKDS----KILEHSFYSGDFGYKLQLVLYPNGVSDSGEL--DIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNS---------TKNMCP-SEIRNKSSKRSNSELAGFIFFNKSKINNSYPSVIKDNQIFIKFKTKSPLSYIITTQKNRTTVEXXXXXXXXXXXXXXXGSPIPISSEVFQTDNFGYDIQMLVYPAGDRSVLGKYAXXXXXXXXXXFDHILPWPFQKRLTLSIVD 1631
            Y+G++ E+E    E            ++   +  W I +F  K +   S    +I    F S + GY+L     PNG  +   L   I++ ++KG  D+ L WPFK NVT  ++N  S         T +M P S+  N+ ++  N  + GF  F   K   +   +I DN+I +K K         T  +N   +      +     +   G  + I SE F +   GY + + +YP G  + + +  S+Y  I+    D  L WP++  +   ++D
Sbjct:  264 YEGYQLEQEIHTSE--------KTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLPWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGV-GFPSFISLKELETQTGLIVDNKIILKCKVHLDGKLANTLHENGNKIIWTVKNFTQLRKDAQSGKAVQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMD 532          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 71.633 bits (174), Expect = 8.186e-13
Identity = 50/158 (31.65%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  921 EKVFNRKIKWKIKDF--IQKTKLKDSK--ILEHSFYSGDFGYKLQLVLYPNGV--SDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNS---------TKNMCPSEIR-NKSSKRSNSELAGFIFFNKSKINNSYPSVIKDNQIFIKFKTKSPL 1346
            EK+ + +  W IK+F  + +  +  S   I   SFYS   GY+L + + PNG+  + +  L I+LR+LKG +D+ L WPFKYNVT+ + N ++         T    P+ +   K ++  N+ +  +       + N  P +++ N+IFIK K   PL
Sbjct:  384 EKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSP-LLRGNEIFIKCKVHIPL 540          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 71.633 bits (174), Expect = 8.535e-13
Identity = 50/158 (31.65%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  921 EKVFNRKIKWKIKDF--IQKTKLKDSK--ILEHSFYSGDFGYKLQLVLYPNGV--SDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNS---------TKNMCPSEIR-NKSSKRSNSELAGFIFFNKSKINNSYPSVIKDNQIFIKFKTKSPL 1346
            EK+ + +  W IK+F  + +  +  S   I   SFYS   GY+L + + PNG+  + +  L I+LR+LKG +D+ L WPFKYNVT+ + N ++         T    P+ +   K ++  N+ +  +       + N  P +++ N+IFIK K   PL
Sbjct:  406 EKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSP-LLRGNEIFIKCKVHIPL 562          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 71.2478 bits (173), Expect = 9.182e-13
Identity = 50/158 (31.65%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  921 EKVFNRKIKWKIKDF--IQKTKLKDSK--ILEHSFYSGDFGYKLQLVLYPNGV--SDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNS---------TKNMCPSEIR-NKSSKRSNSELAGFIFFNKSKINNSYPSVIKDNQIFIKFKTKSPL 1346
            EK+ + +  W IK+F  + +  +  S   I   SFYS   GY+L + + PNG+  + +  L I+LR+LKG +D+ L WPFKYNVT+ + N ++         T    P+ +   K ++  N+ +  +       + N  P +++ N+IFIK K   PL
Sbjct:  403 EKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSP-LLRGNEIFIKCKVHIPL 559          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF11.650e-1128.48TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF15.075e-1128.48TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF15.075e-1128.48TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF57.804e-1029.45TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF57.804e-1029.45TNF receptor associated factor 5 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.366e-630.77TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-21.754e-634.72TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf41.750e-827.08gene:FBgn0026319 transcript:FBtr0334401[more]
Traf43.023e-827.08gene:FBgn0026319 transcript:FBtr0077429[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf51.011e-1126.35Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
traf4b1.661e-1131.85tnf receptor-associated factor 4b [Source:ZFIN;Acc... [more]
traf34.126e-1131.97TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf4a9.727e-1141.46tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a9.727e-1141.46tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl27.316e-1040.24synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
slc12a13.230e-933.78solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a13.693e-933.56solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a14.346e-933.56solute carrier family 12 member 1 [Source:Xenbase;... [more]
hspb61.288e-826.62heat shock protein family B (small) member 6 [Sour... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf13.299e-1129.61TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf13.299e-1129.61TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf13.299e-1129.61TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
Traf24.475e-1031.21TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf24.695e-1031.21TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39428|TRAF1_MOUSE2.307e-1029.61TNF receptor-associated factor 1 OS=Mus musculus O... [more]
sp|Q13077|TRAF1_HUMAN2.437e-1028.48TNF receptor-associated factor 1 OS=Homo sapiens O... [more]
sp|P39429|TRAF2_MOUSE3.130e-931.21TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|O00463|TRAF5_HUMAN3.748e-929.45TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|Q13114|TRAF3_HUMAN9.301e-930.14TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B7PYP81.057e-1122.96Tnf receptor associated factor, putative OS=Ixodes... [more]
T1DBK67.127e-1042.39TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A2D0RTQ79.156e-1030.41TNF receptor-associated factor OS=Ictalurus puncta... [more]
K1R9U71.115e-931.03TNF receptor-associated factor 3 OS=Crassostrea gi... [more]
A0A401Q9D51.264e-930.14MATH domain-containing protein OS=Scyliorhinus tor... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf13.847e-1230.94TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf15.422e-1230.94TNF receptor-associated factor 1-like [Source:NCBI... [more]
ENSAMXT00000035169.11.510e-1133.11pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf4a2.666e-1041.46TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2b3.197e-1031.16TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000074.13.140e-1128.28pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.11.153e-1031.52pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO377501.390e-1033.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352372.035e-934.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494642.810e-928.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483943.177e-941.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406651.194e-835.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf31.226e-1031.72TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a1.725e-1040.24TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.780e-1040.24TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.866e-1040.24TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2b1.910e-930.22TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035446.10.000e+098.93SMESG000035446.1[more]
SMESG000039062.11.096e-1426.52SMESG000039062.1[more]
SMESG000001662.18.186e-1331.65SMESG000001662.1[more]
SMESG000001662.18.535e-1331.65SMESG000001662.1[more]
SMESG000001662.19.182e-1331.65SMESG000001662.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015406 ID=SMED30015406|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1830bp
CTCTACTTTATCATTTATTGTCTAATGACGTCGCCGCATAAATTTGTCGG
TTGGATTGTTTATTGGAAAAGAACGGTTTAGAGCGTGACCGTCATTTTCC
ACTTATTATCAGTTAACAATTGTCAGACTTTATGATTTTTCGAGTAAGCT
TTCTATTTGTGTTAGCCTCGGTGATAAAAAGAGAAGGAATCGGACTATTT
GGATTTCAGTTAAATTTGAGAGACCAAGTGACAAAGAATACTCAGAACAT
CATTAAATTAGATCAAGCTCAATACAAATTCATCAACCAGCTGACGAAGT
TACAAGACGATATCAATGATTTGGAGGAAGAAATTAGCAAATGCAAAACA
ATGATAAGCCGTCTTCAAAGCTCTTTTGAAAAGACATCACTTTCGAATAC
TAATAAGGTTGTCTTCAGAAGATTCGGAAGCTTAATCCAGAATATGCAAA
GCAATACTGAAATTGATGATGTTTTCTATGTGTCACCCTCAGATGGGTTC
ATTTGGAAGATTGATAATGTTTCTAGTTTCTTAAACAAGACCGTCGCGGA
ATTGACAAGCAACAGCTTTTATACCGATGGCCAATATGGTTATAAGATTC
GACTGAAACTAGACAATTCGTTCGGTAAAATCAGAATCAAGTTAGAGATT
TTGAAAGGGGTTTTTGACAGTTTACTTCCATGGCCTTTTAATAATGAGAT
TGAAGTTTCTCTATTGAGCCAGGAATATCCCTATAACCATTACACTGAGA
CTAGTTTTTATGAGCCGGATACTTGCCTTCATCGCGCAGTTAAATCTTTC
AAACAATACAGTCACATTTATTCTGTGCAAATAAAAAAGATTTTATATCA
AGGCTTCAAATTTGAAAGAGAACCATTAGTTGTTGAGTGTTTCCTTAATG
GTGGAAAAGATCTAAATAATGAAAAAGTCTTTAACAGAAAGATCAAATGG
AAAATCAAAGATTTCATTCAGAAAACTAAATTAAAAGATTCAAAAATTTT
AGAGCATTCTTTTTATTCCGGAGATTTTGGATATAAACTACAGCTCGTTC
TTTATCCCAATGGAGTGTCGGATAGCGGAGAATTGGATATATTTCTGAGA
GTTCTCAAAGGGGATTACGATGACTTTCTTTGGTGGCCTTTCAAATACAA
TGTCACGATAAAGGTTCTGAATGGAAACAGCACGAAGAACATGTGTCCAT
CGGAGATTAGGAATAAAAGCTCCAAGCGCTCTAATTCCGAATTGGCGGGA
TTTATATTCTTTAACAAATCTAAAATCAACAATTCCTATCCTTCGGTGAT
TAAGGATAATCAAATTTTTATCAAATTCAAAACGAAATCTCCACTGTCTT
ACATTATAACGACTCAAAAAAATAGGACGACTGTCGAAAACAAAGAAATC
ATTTGGAACATTAAAAACTTTAATAAAATTAAAGGAAGTCCTATCCCAAT
CTCAAGTGAAGTCTTTCAAACCGATAATTTTGGATATGATATTCAAATGC
TCGTTTATCCTGCCGGTGATCGCTCGGTCCTCGGTAAATACGCATCGGTT
TATATCTACATTGTCTACAGTTCATTTGATCACATTCTGCCTTGGCCATT
CCAGAAACGTTTGACATTGTCCATTGTTGATGGACAAAATCGAACAGTAG
ATGAAAATATTCAAGTTTTTCAAAATAAAGAATTCGTGGCCGATTTAAAA
CCATCTTTCAATCAAGGGGTTTTGATAGGATATTCAAGATTTATGAGACT
GATAGATGAATGGTTGTCAAAATATGTCATTGACAATTGCTTGAGGATTA
AATTGAAAATACATAATTAAAAGAATATAA
back to top

protein sequence of SMED30015406-orf-1

>SMED30015406-orf-1 ID=SMED30015406-orf-1|Name=SMED30015406-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MIFRVSFLFVLASVIKREGIGLFGFQLNLRDQVTKNTQNIIKLDQAQYKF
INQLTKLQDDINDLEEEISKCKTMISRLQSSFEKTSLSNTNKVVFRRFGS
LIQNMQSNTEIDDVFYVSPSDGFIWKIDNVSSFLNKTVAELTSNSFYTDG
QYGYKIRLKLDNSFGKIRIKLEILKGVFDSLLPWPFNNEIEVSLLSQEYP
YNHYTETSFYEPDTCLHRAVKSFKQYSHIYSVQIKKILYQGFKFEREPLV
VECFLNGGKDLNNEKVFNRKIKWKIKDFIQKTKLKDSKILEHSFYSGDFG
YKLQLVLYPNGVSDSGELDIFLRVLKGDYDDFLWWPFKYNVTIKVLNGNS
TKNMCPSEIRNKSSKRSNSELAGFIFFNKSKINNSYPSVIKDNQIFIKFK
TKSPLSYIITTQKNRTTVENKEIIWNIKNFNKIKGSPIPISSEVFQTDNF
GYDIQMLVYPAGDRSVLGKYASVYIYIVYSSFDHILPWPFQKRLTLSIVD
GQNRTVDENIQVFQNKEFVADLKPSFNQGVLIGYSRFMRLIDEWLSKYVI
DNCLRIKLKIHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0005515protein binding
GO:0016740transferase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0046330positive regulation of JNK cascade
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000042anterior primary gut branch
PLANA:0000084posterior primary gut branch
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 47..81
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 265..399
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 95..217
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 412..558
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.476
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 405..562
e-value: 3.0E-26
score: 94.1
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 103..236
e-value: 7.5E-17
score: 63.3
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 251..402
e-value: 2.5E-22
score: 81.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 122..211
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 421..560
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 268..397
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 412..558
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 265..399
coord: 95..217
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 268..401
score: 14.075
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 420..560
score: 14.97
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 120..255
score: 8.424