Adiponectin receptor protein

Overview
NameAdiponectin receptor protein
Smed IDSMED30015405
Length (bp)418
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adiponectin receptor protein (SMED30015405) t-SNE clustered cells

Violin plots show distribution of expression levels for Adiponectin receptor protein (SMED30015405) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adiponectin receptor protein (SMED30015405) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adiponectin receptor protein (SMED30015405) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015405

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30015405h1SMcG0003674 dd_Smed_v4_19374_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015405h1SMcG0003674 dd_Smed_v4_19374_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: ADIPOR2 (adiponectin receptor 2 [Source:HGNC Symbol;Acc:HGNC:24041])

HSP 1 Score: 87.8113 bits (216), Expect = 7.514e-21
Identity = 41/88 (46.59%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +FL LGLSG +P LH++  E   K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  275 RGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVH 362          
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: ADIPOR2 (adiponectin receptor 2 [Source:HGNC Symbol;Acc:HGNC:24041])

HSP 1 Score: 87.8113 bits (216), Expect = 7.514e-21
Identity = 41/88 (46.59%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +FL LGLSG +P LH++  E   K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  275 RGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVH 362          
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: ADIPOR1 (adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGNC:24040])

HSP 1 Score: 87.8113 bits (216), Expect = 8.146e-21
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++T   +FL LGLSG +P +H    E   K     Q  W  LMA+ Y+ G   YA +IPE++FPGK +I FQSHQIFH+ V+  A  H
Sbjct:  264 RQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVH 351          
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: PAQR3 (progestin and adipoQ receptor family member 3 [Source:HGNC Symbol;Acc:HGNC:30130])

HSP 1 Score: 49.2914 bits (116), Expect = 3.111e-7
Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYS-WLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVIL 316
            +F ++   G +P LH +WL       I   ++  + +M +  LL    Y  K+PE+YFPG+ N L  SHQI+H+  ++
Sbjct:  206 IFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVV 283          
BLAST of Adiponectin receptor protein vs. Ensembl Human
Match: PAQR3 (progestin and adipoQ receptor family member 3 [Source:HGNC Symbol;Acc:HGNC:30130])

HSP 1 Score: 49.2914 bits (116), Expect = 3.111e-7
Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYS-WLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVIL 316
            +F ++   G +P LH +WL       I   ++  + +M +  LL    Y  K+PE+YFPG+ N L  SHQI+H+  ++
Sbjct:  206 IFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVV 283          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-2 (Progestin and AdipoQ Receptor family [Source:UniProtKB/TrEMBL;Acc:Q9N536])

HSP 1 Score: 78.9518 bits (193), Expect = 7.166e-18
Identity = 44/124 (35.48%), Postives = 69/124 (55.65%), Query Frame = 2
Query:    5 IPNHMINSEGLIF*MLNLW------IMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAI--FHTINTMSM 352
            I N MI   G+   +++LW        +    ++F+A+GLS  +P  H L ++ V     ++Q   + +M   Y+ G   YA ++PE+ FPGKC+I FQSHQ+FH  V+L A   +H I+ M M
Sbjct:  411 IYNGMIIILGIAAMVVSLWDKFAEPKFRPVRAAVFIAMGLSAVVPAFHLLVVDGVHYMVEESQVHLMIMMGAMYIGGATLYATRVPERCFPGKCDIWFQSHQLFHTFVVLAAFVHYHAISQMGM 534          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 78.1814 bits (191), Expect = 1.006e-17
Identity = 38/83 (45.78%), Postives = 55/83 (66.27%), Query Frame = 2
Query:   83 SMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++F+ +G SG +P +H++  + V      N + WL LMA  YLLG   YA + PE++FPGKC+I FQSHQ+FH CV++ A  H
Sbjct:  333 AVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVH 415          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 78.1814 bits (191), Expect = 1.006e-17
Identity = 38/83 (45.78%), Postives = 55/83 (66.27%), Query Frame = 2
Query:   83 SMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++F+ +G SG +P +H++  + V      N + WL LMA  YLLG   YA + PE++FPGKC+I FQSHQ+FH CV++ A  H
Sbjct:  333 AVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVH 415          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 78.1814 bits (191), Expect = 1.006e-17
Identity = 38/83 (45.78%), Postives = 55/83 (66.27%), Query Frame = 2
Query:   83 SMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++F+ +G SG +P +H++  + V      N + WL LMA  YLLG   YA + PE++FPGKC+I FQSHQ+FH CV++ A  H
Sbjct:  333 AVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVH 415          
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Match: paqr-1 (Progestin and adipoQ receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q94177])

HSP 1 Score: 76.6406 bits (187), Expect = 2.479e-17
Identity = 40/98 (40.82%), Postives = 58/98 (59.18%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFHTINTMSMVDA 361
            +    ++F+ +G SG +P +H++  + V      N + WL LMA  YLLG   YA + PE++FPGKC+I FQSHQ+FH CV++ A  H      M  A
Sbjct:  229 RPIRAAVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMAFLYLLGAGLYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFA 326          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0308848)

HSP 1 Score: 82.0333 bits (201), Expect = 6.747e-19
Identity = 41/115 (35.65%), Postives = 68/115 (59.13%), Query Frame = 2
Query:   32 GLIF*MLNLW------IMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAI--FHTINTMSM 352
            G++  +++LW       ++     +F++ GLSG +P +H+  +E    +  +    WL LM + Y+LG   YA ++PE++FPGK +I  QSHQIFH+ VI  A   +H I+ M+M
Sbjct:  313 GILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAM 427          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0084282)

HSP 1 Score: 82.0333 bits (201), Expect = 6.747e-19
Identity = 41/115 (35.65%), Postives = 68/115 (59.13%), Query Frame = 2
Query:   32 GLIF*MLNLW------IMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAI--FHTINTMSM 352
            G++  +++LW       ++     +F++ GLSG +P +H+  +E    +  +    WL LM + Y+LG   YA ++PE++FPGK +I  QSHQIFH+ VI  A   +H I+ M+M
Sbjct:  313 GILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAM 427          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0084283)

HSP 1 Score: 82.0333 bits (201), Expect = 6.747e-19
Identity = 41/115 (35.65%), Postives = 68/115 (59.13%), Query Frame = 2
Query:   32 GLIF*MLNLW------IMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAI--FHTINTMSM 352
            G++  +++LW       ++     +F++ GLSG +P +H+  +E    +  +    WL LM + Y+LG   YA ++PE++FPGK +I  QSHQIFH+ VI  A   +H I+ M+M
Sbjct:  313 GILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAM 427          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0334561)

HSP 1 Score: 82.0333 bits (201), Expect = 6.747e-19
Identity = 41/115 (35.65%), Postives = 68/115 (59.13%), Query Frame = 2
Query:   32 GLIF*MLNLW------IMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAI--FHTINTMSM 352
            G++  +++LW       ++     +F++ GLSG +P +H+  +E    +  +    WL LM + Y+LG   YA ++PE++FPGK +I  QSHQIFH+ VI  A   +H I+ M+M
Sbjct:  313 GILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAM 427          
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Match: AdipoR (gene:FBgn0038984 transcript:FBtr0084284)

HSP 1 Score: 79.337 bits (194), Expect = 4.080e-18
Identity = 41/115 (35.65%), Postives = 68/115 (59.13%), Query Frame = 2
Query:   32 GLIF*MLNLW------IMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAI--FHTINTMSM 352
            G++  +++LW       ++     +F++ GLSG +P +H+  +E    +  +    WL LM + Y+LG   YA ++PE++FPGK +I  QSHQIFH+ VI  A   +H I+ M+M
Sbjct:  231 GILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAM 345          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor1b (adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2896])

HSP 1 Score: 88.5817 bits (218), Expect = 1.803e-21
Identity = 40/88 (45.45%), Postives = 51/88 (57.95%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            + T   +FL LGLSG +P +H    E   K     Q  W  LM   Y+ G   YA +IPE+YFPG+C+I FQSHQIFH+ V+  A  H
Sbjct:  218 RSTRAGVFLGLGLSGLVPTMHFTIAEGFVKATTVGQMGWFYLMGAMYISGAALYAARIPERYFPGRCDIWFQSHQIFHVLVVGAAFVH 305          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor2 (adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-041210-60])

HSP 1 Score: 88.5817 bits (218), Expect = 2.055e-21
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P LH +  E   K     Q  WL LMA+ Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  248 RGVRAGVFVGLGLSGVVPTLHFMIAEGFLKATTMGQMGWLFLMAVLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVH 335          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor2 (adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-041210-60])

HSP 1 Score: 88.5817 bits (218), Expect = 2.055e-21
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P LH +  E   K     Q  WL LMA+ Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  248 RGVRAGVFVGLGLSGVVPTLHFMIAEGFLKATTMGQMGWLFLMAVLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVH 335          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 86.6557 bits (213), Expect = 1.175e-20
Identity = 39/88 (44.32%), Postives = 50/88 (56.82%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            + T   +F+ LGLSG +P +H    E   K     Q  W  LM   Y+ G   YA +IPE+YFPGKC+I F SHQIFH+ V+  A  H
Sbjct:  264 RPTRAGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERYFPGKCDIWFHSHQIFHVLVVAAAFIH 351          
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 86.6557 bits (213), Expect = 1.175e-20
Identity = 39/88 (44.32%), Postives = 50/88 (56.82%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            + T   +F+ LGLSG +P +H    E   K     Q  W  LM   Y+ G   YA +IPE+YFPGKC+I F SHQIFH+ V+  A  H
Sbjct:  264 RPTRAGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERYFPGKCDIWFHSHQIFHVLVVAAAFIH 351          
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Match: adipor1 (adiponectin receptor 1 [Source:NCBI gene;Acc:493308])

HSP 1 Score: 88.5817 bits (218), Expect = 3.905e-21
Identity = 41/88 (46.59%), Postives = 52/88 (59.09%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            + T   +FL LGLSG +P LH    E   K     Q  W  LMA+ Y+ G   YA +IPE++FPGK +I FQSHQIFH+ V+  A  H
Sbjct:  268 RPTRAGVFLGLGLSGIVPTLHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFIH 355          
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Match: atg4a (autophagy related 4A cysteine peptidase [Source:Xenbase;Acc:XB-GENE-922674])

HSP 1 Score: 46.9802 bits (110), Expect = 1.732e-6
Identity = 23/78 (29.49%), Postives = 43/78 (55.13%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYS-WLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVIL 316
            +F ++   G +P +H +WL       I  +++  + +M I   +    Y  K+PE+YFPG+ N L  SHQ++H+  ++
Sbjct:  206 IFCSVSGYGIIPTVHWIWLNGGVGTSIVQEFAPRVIVMYIIAAVAFLFYISKVPERYFPGQLNYLGSSHQLWHILAVV 283          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Adipor1 (adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:1919924])

HSP 1 Score: 87.8113 bits (216), Expect = 5.106e-21
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++T   +FL LGLSG +P +H    E   K     Q  W  LMA+ Y+ G   YA +IPE++FPGK +I FQSHQIFH+ V+  A  H
Sbjct:  264 RQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVH 351          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Adipor1 (adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:1919924])

HSP 1 Score: 87.8113 bits (216), Expect = 5.106e-21
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++T   +FL LGLSG +P +H    E   K     Q  W  LMA+ Y+ G   YA +IPE++FPGK +I FQSHQIFH+ V+  A  H
Sbjct:  264 RQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVH 351          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Adipor2 (adiponectin receptor 2 [Source:MGI Symbol;Acc:MGI:93830])

HSP 1 Score: 86.6557 bits (213), Expect = 1.427e-20
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P LH++  E   K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  275 RGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVH 362          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Adipor2 (adiponectin receptor 2 [Source:MGI Symbol;Acc:MGI:93830])

HSP 1 Score: 86.6557 bits (213), Expect = 1.427e-20
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P LH++  E   K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  275 RGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVH 362          
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Match: Paqr3 (progestin and adipoQ receptor family member III [Source:MGI Symbol;Acc:MGI:2679683])

HSP 1 Score: 51.2174 bits (121), Expect = 5.561e-8
Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYS-WLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVIL 316
            +F ++   G +P LH +WL       I   ++  + +M +  LL    Y  K+PE+YFPG+ N L  SHQI+H+  ++
Sbjct:  206 IFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRVIVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHVLAVV 283          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q91VH1|PAQR1_MOUSE (Adiponectin receptor protein 1 OS=Mus musculus OX=10090 GN=Adipor1 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.571e-20
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++T   +FL LGLSG +P +H    E   K     Q  W  LMA+ Y+ G   YA +IPE++FPGK +I FQSHQIFH+ V+  A  H
Sbjct:  264 RQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVH 351          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q86V24|PAQR2_HUMAN (Adiponectin receptor protein 2 OS=Homo sapiens OX=9606 GN=ADIPOR2 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.609e-20
Identity = 41/88 (46.59%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +FL LGLSG +P LH++  E   K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  275 RGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVH 362          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q96A54|PAQR1_HUMAN (Adiponectin receptor protein 1 OS=Homo sapiens OX=9606 GN=ADIPOR1 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.912e-20
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++T   +FL LGLSG +P +H    E   K     Q  W  LMA+ Y+ G   YA +IPE++FPGK +I FQSHQIFH+ V+  A  H
Sbjct:  264 RQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVH 351          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q8BQS5|PAQR2_MOUSE (Adiponectin receptor protein 2 OS=Mus musculus OX=10090 GN=Adipor2 PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 9.983e-20
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P LH++  E   K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  275 RGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVH 362          
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Match: sp|Q9VCY8|ADRL_DROME (Adiponectin receptor protein OS=Drosophila melanogaster OX=7227 GN=AdipoR PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 6.764e-18
Identity = 41/115 (35.65%), Postives = 68/115 (59.13%), Query Frame = 2
Query:   32 GLIF*MLNLW------IMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAI--FHTINTMSM 352
            G++  +++LW       ++     +F++ GLSG +P +H+  +E    +  +    WL LM + Y+LG   YA ++PE++FPGK +I  QSHQIFH+ VI  A   +H I+ M+M
Sbjct:  313 GILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYHGISEMAM 427          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: H2XV38 (Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 8.350e-23
Identity = 43/88 (48.86%), Postives = 58/88 (65.91%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F ALGLSG +P +H +  +   +     Q  WL LMA+ YL G F YAK+IPE+YFPGKC++ FQSHQIFH+ V+L A+ H
Sbjct:   50 RSVRAVLFAALGLSGIVPAVHTMVRQGFLRSVTVGQLGWLILMAVLYLTGAFLYAKRIPERYFPGKCDLWFQSHQIFHILVVLAAVVH 137          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A3P6TKQ3 (Uncharacterized protein OS=Litomosoides sigmodontis OX=42156 GN=NLS_LOCUS5350 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.320e-20
Identity = 43/91 (47.25%), Postives = 61/91 (67.03%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH--TINTMSM 352
            +FLA+G SG +P +H +  + V        + WL LMA  Y+LGT  YA + PE++FPGKC+ILFQSHQ+FH+CV++ A  H   I+ M+M
Sbjct:  363 VFLAMGCSGVVPTVHFMITDGVRTLFEDAAFHWLLLMAALYILGTLLYATRTPERFFPGKCDILFQSHQLFHICVVIAAFVHYYGISEMAM 453          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A1W2WLX3 (adiponectin receptor protein 1-like OS=Ciona intestinalis OX=7719 GN=LOC100175669 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.532e-20
Identity = 43/88 (48.86%), Postives = 58/88 (65.91%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F ALGLSG +P +H +  +   +     Q  WL LMA+ YL G F YAK+IPE+YFPGKC++ FQSHQIFH+ V+L A+ H
Sbjct:  283 RSVRAVLFAALGLSGIVPAVHTMVRQGFLRSVTVGQLGWLILMAVLYLTGAFLYAKRIPERYFPGKCDLWFQSHQIFHILVVLAAVVH 370          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A183E2W4 (Uncharacterized protein OS=Gongylonema pulchrum OX=637853 GN=GPUH_LOCUS15305 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.547e-20
Identity = 41/91 (45.05%), Postives = 64/91 (70.33%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH--TINTMSM 352
            +FL++G SG +P +H +  + V     +  + WL LMA+ Y++GT  YA ++PE++FPGKC+ILFQSHQ+FH+CV++ A  H   I+ M+M
Sbjct:  356 VFLSMGCSGVVPTVHFMITDGVRTLFEEAAFHWLLLMALLYIVGTLFYATRVPERFFPGKCDILFQSHQLFHICVVVAAFVHYYGISEMAM 446          
BLAST of Adiponectin receptor protein vs. TrEMBL
Match: A0A0R3RR78 (Uncharacterized protein OS=Elaeophora elaphi OX=1147741 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.739e-20
Identity = 43/91 (47.25%), Postives = 61/91 (67.03%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH--TINTMSM 352
            +FLA+G SG +P +H +  + V        + WL LMA  Y+LGT  YA + PE++FPGKC+ILFQSHQ+FH+CV++ A  H   I+ M+M
Sbjct:  363 VFLAMGCSGVVPTVHFMITDGVRTLFEDAAFHWLLLMAALYILGTLLYATRTPERFFPGKCDILFQSHQLFHICVVIAAFVHYCGISEMAM 453          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor1b (adiponectin receptor 1 [Source:NCBI gene;Acc:103027515])

HSP 1 Score: 88.5817 bits (218), Expect = 2.219e-21
Identity = 40/88 (45.45%), Postives = 51/88 (57.95%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            + T   +FL LGLSG +P +H    E   K     Q  W  LM   Y+ G   YA +IPE++FPGKC+I FQSHQIFH+ V+  A  H
Sbjct:  270 RPTRAGVFLGLGLSGVIPTMHFTIAEGFVKATTVGQMGWFILMGAMYITGAGLYAARIPERFFPGKCDIWFQSHQIFHVLVVAAAFIH 357          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:103034013])

HSP 1 Score: 88.5817 bits (218), Expect = 2.283e-21
Identity = 39/88 (44.32%), Postives = 55/88 (62.50%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P+LH +  E   +     Q  WL LMA+ Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  257 RGVRAGVFVGLGLSGVVPSLHFVITEGFLRATTMGQMGWLFLMAVLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVH 344          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 82.4185 bits (202), Expect = 3.177e-19
Identity = 38/85 (44.71%), Postives = 49/85 (57.65%), Query Frame = 2
Query:   77 NLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
             L +F+ LGLSG +P +H    E   K     Q  W  LM   Y+ G   YA +IPE++FPGKC+I F SHQIFH+ V+  A  H
Sbjct:  241 TLFLFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFIH 325          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 82.0333 bits (201), Expect = 4.208e-19
Identity = 37/82 (45.12%), Postives = 48/82 (58.54%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +F+ LGLSG +P +H    E   K     Q  W  LM   Y+ G   YA +IPE++FPGKC+I F SHQIFH+ V+  A  H
Sbjct:  235 VFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFIH 316          
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Match: adipor1a (adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-040718-169])

HSP 1 Score: 81.6481 bits (200), Expect = 6.794e-19
Identity = 37/83 (44.58%), Postives = 48/83 (57.83%), Query Frame = 2
Query:   83 SMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
             +F+ LGLSG +P +H    E   K     Q  W  LM   Y+ G   YA +IPE++FPGKC+I F SHQIFH+ V+  A  H
Sbjct:  238 GVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFIH 320          
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Match: adipor2 (adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-041210-60])

HSP 1 Score: 88.9669 bits (219), Expect = 2.293e-22
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +FL LGLSG +P +H +  E   K     Q  WL LMA+ Y+ G   YA +IPE++FPGKC+I F SHQIFH+ V+  A  H
Sbjct:  230 RAVRAGVFLGLGLSGIVPTIHFMIAEGFIKAATVGQIGWLFLMAVLYITGAALYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFVH 317          
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Match: adipor1b (adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2896])

HSP 1 Score: 83.1889 bits (204), Expect = 4.687e-20
Identity = 36/83 (43.37%), Postives = 52/83 (62.65%), Query Frame = 2
Query:   83 SMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            ++FL+LG SG +P +H + +E   +     Q  WL LM + Y +G   YA +IPE++FPG C+I F SHQIFH+ V+  A  H
Sbjct:  266 AVFLSLGFSGIVPTVHFMVVEGFMRATTAGQTGWLFLMGLLYSMGAALYAARIPERFFPGMCDIWFHSHQIFHVLVVAAACVH 348          
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Match: paqr3b (progestin and adipoQ receptor family member IIIb [Source:ZFIN;Acc:ZDB-GENE-050913-128])

HSP 1 Score: 44.2838 bits (103), Expect = 2.112e-6
Identity = 27/84 (32.14%), Postives = 40/84 (47.62%), Query Frame = 2
Query:   74 TNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFC---YAKKIPEKYFPGKCNILFQSHQIFHMCVIL 316
            T L +   + L G +P +H + L       I   +S    + I YLL       Y  K+PE+YFPG  N +  SHQ +H+ V+ 
Sbjct:  205 TRLVILSCVSLYGVIPTVHWIVLNGGPTTTIVQDFS--PRVMIMYLLAGVAFVFYVGKVPERYFPGHVNFVGSSHQCWHILVVF 286          
BLAST of Adiponectin receptor protein vs. Ensembl Yeast
Match: IZH2 (Plasma membrane receptor for plant antifungal osmotin; involved in zinc ion homeostasis, apoptosis; negatively regulates ZRT1 and other functionally divergent genes through CCCTC promoter motif (IzRE); modulates FET3 activity in iron-independent manner; affects gene expression by influencing balance of competition between Msn2p/Msn4p and Nrg1p/Nrg2p for binding to IzRE; transcription regulated by Zap1p, zinc, fatty acid levels; homolog of mammalian adiponectin receptor [Source:SGD;Acc:S000005362])

HSP 1 Score: 54.6842 bits (130), Expect = 2.958e-10
Identity = 27/82 (32.93%), Postives = 44/82 (53.66%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +F+  GLS  +P    L+    ++   + Q  W+ L  + Y++G   Y  + PEK  PGK +I   SHQ+FH  V++ A+ H
Sbjct:  215 LFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCH 296          
BLAST of Adiponectin receptor protein vs. Ensembl Yeast
Match: IZH1 (Membrane protein involved in zinc ion homeostasis; member of the four-protein IZH family; transcription is regulated directly by Zap1p, expression induced by zinc deficiency and fatty acids; deletion increases sensitivity to elevated zinc; IZH1 has a paralog, IZH4, that arose from the whole genome duplication [Source:SGD;Acc:S000002900])

HSP 1 Score: 48.1358 bits (113), Expect = 5.638e-8
Identity = 27/81 (33.33%), Postives = 42/81 (51.85%), Query Frame = 2
Query:   89 FLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            F+  G SG LP     +   +     + + S++   A+ Y+ G   Y  +IPE   PGK +    SHQIFH+ V+LG++ H
Sbjct:  219 FILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCH 299          
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Match: EDO36050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS3])

HSP 1 Score: 72.4034 bits (176), Expect = 3.682e-16
Identity = 37/100 (37.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query:   17 MINSEGLIF*MLNLWIMKKT------NLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIF 298
            +I S GL+  +++LW    T         +FL  G SG +P +H +    V     +    W+ LM + Y+LG   YA ++PE++FPG+ NI FQSHQIF
Sbjct:  175 VIVSMGLLSVLVSLWSKFNTPKYRCLRAGVFLTFGCSGVVPAIHFVAAHGVAIAHRQASVGWMALMGLLYILGAIAYASRMPERFFPGRFNIWFQSHQIF 274          
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Match: EDO36051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS3])

HSP 1 Score: 72.4034 bits (176), Expect = 3.682e-16
Identity = 37/100 (37.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query:   17 MINSEGLIF*MLNLWIMKKT------NLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIF 298
            +I S GL+  +++LW    T         +FL  G SG +P +H +    V     +    W+ LM + Y+LG   YA ++PE++FPG+ NI FQSHQIF
Sbjct:  175 VIVSMGLLSVLVSLWSKFNTPKYRCLRAGVFLTFGCSGVVPAIHFVAAHGVAIAHRQASVGWMALMGLLYILGAIAYASRMPERFFPGRFNIWFQSHQIF 274          
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Match: EDO36328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIY6])

HSP 1 Score: 45.4394 bits (106), Expect = 1.747e-6
Identity = 29/95 (30.53%), Postives = 52/95 (54.74%), Query Frame = 2
Query:   53 NLWIMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFC---YAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIF 328
            ++W  ++  L +F  L   G +P++H  +L     + +   +  +  + + Y+LG      YA K+PE+YFPGK N +  SHQ +H+ +IL A +
Sbjct:  196 SVWATRR--LLLFCCLVAYGVVPSVHWAYLSGGWDQPVVQIF--IPKVIVMYVLGVLALVFYALKVPERYFPGKMNFIGSSHQWWHV-LILAAFY 285          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 87.4261 bits (215), Expect = 4.390e-21
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P LH +  E + K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  226 RGVRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFLMATLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVH 313          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 87.4261 bits (215), Expect = 5.144e-21
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P LH +  E + K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  263 RGVRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFLMATLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVH 350          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: adipor2 (adiponectin receptor 2 [Source:NCBI gene;Acc:101161688])

HSP 1 Score: 87.4261 bits (215), Expect = 5.144e-21
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ LGLSG +P LH +  E + K     Q  WL LMA  Y+ G   YA +IPE++FPGKC+I F SHQ+FH+ V+ GA  H
Sbjct:  263 RGVRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQIGWLFLMATLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVH 350          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: adipor1a (adiponectin receptor 1 [Source:NCBI gene;Acc:101170340])

HSP 1 Score: 85.1149 bits (209), Expect = 3.432e-20
Identity = 38/88 (43.18%), Postives = 50/88 (56.82%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            + T   +F+ LGLSG +P +H    E   K     Q  W  LM   Y+ G   YA +IPE++FPGKC+I F SHQIFH+ V+  A  H
Sbjct:  260 RPTRAGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQMGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFVH 347          
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Match: PAQR3 (progestin and adipoQ receptor family member 3 [Source:NCBI gene;Acc:101166647])

HSP 1 Score: 48.1358 bits (113), Expect = 4.197e-7
Identity = 27/86 (31.40%), Postives = 44/86 (51.16%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGT---FCYAKKIPEKYFPGKCNILFQSHQIFHMCVIL 316
            K   +++F  +   G +P LH +WL      +I   +     + + YL+       Y  KIPE+YFPG+ N L  SHQ++H+ V+ 
Sbjct:  204 KVIRMTIFSCVAGIGVIPALHWVWLNGGLTSDIVQLF--FPRVIVMYLIAGSAFLFYITKIPERYFPGQVNYLGASHQLWHILVVF 287          
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Match: SMESG000005140.1 (SMESG000005140.1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.946e-18
Identity = 36/88 (40.91%), Postives = 56/88 (63.64%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFH 331
            +     +F+ALGL G +P LH++ +E       ++   WL LMA+ Y+ G   YA +IPE+  PG+ +I+FQSHQIFH+ V++ A+ H
Sbjct:  273 RPLRAGVFIALGLCGVVPCLHYIIVEGFWSAIHQSSVGWLSLMALLYITGAVIYAARIPERILPGRFDIIFQSHQIFHVFVVVAALVH 360          
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Match: SMESG000011535.1 (SMESG000011535.1)

HSP 1 Score: 67.781 bits (164), Expect = 4.948e-14
Identity = 33/70 (47.14%), Postives = 44/70 (62.86%), Query Frame = 2
Query:   86 MFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQI 295
            +F+ALGLSG +P  H++ LE            WL LMA  Y+ G   YA ++PE++FPGK +I FQSHQI
Sbjct:  285 VFVALGLSGVIPCAHYIILEGFYHAFCNASLGWLVLMAALYITGACIYALRVPERFFPGKFDIWFQSHQI 354          
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Match: SMESG000021251.1 (SMESG000021251.1)

HSP 1 Score: 48.1358 bits (113), Expect = 3.901e-7
Identity = 29/86 (33.72%), Postives = 51/86 (59.30%), Query Frame = 2
Query:   68 KKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLMAIAYLLGTFC---YAKKIPEKYFPGKCNILFQSHQIFHMCVIL 316
            K+T  S+FL L + G +P +H ++L    + EI + +  L  +   Y+LG      Y  KIPE+++PG+ + +  SHQI+H+ V++
Sbjct:  191 KRT--SIFLVLAIFGVVPTVHWIYLSNGFRSEIVSIF--LQRVIRLYVLGALSFIFYFCKIPERFWPGRFDFIGSSHQIWHVLVLI 272          
The following BLAST results are available for this feature:
BLAST of Adiponectin receptor protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADIPOR27.514e-2146.59adiponectin receptor 2 [Source:HGNC Symbol;Acc:HGN... [more]
ADIPOR27.514e-2146.59adiponectin receptor 2 [Source:HGNC Symbol;Acc:HGN... [more]
ADIPOR18.146e-2145.45adiponectin receptor 1 [Source:HGNC Symbol;Acc:HGN... [more]
PAQR33.111e-733.33progestin and adipoQ receptor family member 3 [Sou... [more]
PAQR33.111e-733.33progestin and adipoQ receptor family member 3 [Sou... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr-27.166e-1835.48Progestin and AdipoQ Receptor family [Source:UniP... [more]
paqr-11.006e-1745.78Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-11.006e-1745.78Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-11.006e-1745.78Progestin and adipoQ receptor-like protein 1 [Sou... [more]
paqr-12.479e-1740.82Progestin and adipoQ receptor-like protein 1 [Sou... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AdipoR6.747e-1935.65gene:FBgn0038984 transcript:FBtr0308848[more]
AdipoR6.747e-1935.65gene:FBgn0038984 transcript:FBtr0084282[more]
AdipoR6.747e-1935.65gene:FBgn0038984 transcript:FBtr0084283[more]
AdipoR6.747e-1935.65gene:FBgn0038984 transcript:FBtr0334561[more]
AdipoR4.080e-1835.65gene:FBgn0038984 transcript:FBtr0084284[more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adipor1b1.803e-2145.45adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor22.055e-2145.45adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adipor22.055e-2145.45adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adipor1a1.175e-2044.32adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor1a1.175e-2044.32adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
adipor13.905e-2146.59adiponectin receptor 1 [Source:NCBI gene;Acc:49330... [more]
atg4a1.732e-629.49autophagy related 4A cysteine peptidase [Source:Xe... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adipor15.106e-2145.45adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:... [more]
Adipor15.106e-2145.45adiponectin receptor 1 [Source:MGI Symbol;Acc:MGI:... [more]
Adipor21.427e-2045.45adiponectin receptor 2 [Source:MGI Symbol;Acc:MGI:... [more]
Adipor21.427e-2045.45adiponectin receptor 2 [Source:MGI Symbol;Acc:MGI:... [more]
Paqr35.561e-833.33progestin and adipoQ receptor family member III [S... [more]
back to top
BLAST of Adiponectin receptor protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91VH1|PAQR1_MOUSE3.571e-2045.45Adiponectin receptor protein 1 OS=Mus musculus OX=... [more]
sp|Q86V24|PAQR2_HUMAN3.609e-2046.59Adiponectin receptor protein 2 OS=Homo sapiens OX=... [more]
sp|Q96A54|PAQR1_HUMAN3.912e-2045.45Adiponectin receptor protein 1 OS=Homo sapiens OX=... [more]
sp|Q8BQS5|PAQR2_MOUSE9.983e-2045.45Adiponectin receptor protein 2 OS=Mus musculus OX=... [more]
sp|Q9VCY8|ADRL_DROME6.764e-1835.65Adiponectin receptor protein OS=Drosophila melanog... [more]
back to top
BLAST of Adiponectin receptor protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2XV388.350e-2348.86Uncharacterized protein OS=Ciona intestinalis OX=7... [more]
A0A3P6TKQ31.320e-2047.25Uncharacterized protein OS=Litomosoides sigmodonti... [more]
A0A1W2WLX31.532e-2048.86adiponectin receptor protein 1-like OS=Ciona intes... [more]
A0A183E2W41.547e-2045.05Uncharacterized protein OS=Gongylonema pulchrum OX... [more]
A0A0R3RR781.739e-2047.25Uncharacterized protein OS=Elaeophora elaphi OX=11... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adipor1b2.219e-2145.45adiponectin receptor 1 [Source:NCBI gene;Acc:10302... [more]
adipor22.283e-2144.32adiponectin receptor 2 [Source:NCBI gene;Acc:10303... [more]
adipor1a3.177e-1944.71adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor1a4.208e-1945.12adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
adipor1a6.794e-1944.58adiponectin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
adipor22.293e-2245.45adiponectin receptor 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adipor1b4.687e-2043.37adiponectin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
paqr3b2.112e-632.14progestin and adipoQ receptor family member IIIb [... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
IZH22.958e-1032.93Plasma membrane receptor for plant antifungal osmo... [more]
IZH15.638e-833.33Membrane protein involved in zinc ion homeostasis;... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO360503.682e-1637.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360513.682e-1637.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363281.747e-630.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adiponectin receptor protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adipor24.390e-2145.45adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
adipor25.144e-2145.45adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
adipor25.144e-2145.45adiponectin receptor 2 [Source:NCBI gene;Acc:10116... [more]
adipor1a3.432e-2043.18adiponectin receptor 1 [Source:NCBI gene;Acc:10117... [more]
PAQR34.197e-731.40progestin and adipoQ receptor family member 3 [Sou... [more]
back to top
BLAST of Adiponectin receptor protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000005140.12.946e-1840.91SMESG000005140.1[more]
SMESG000011535.14.948e-1447.14SMESG000011535.1[more]
SMESG000021251.13.901e-733.72SMESG000021251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015405 ID=SMED30015405|Name=Adiponectin receptor protein|organism=Schmidtea mediterranea sexual|type=transcript|length=418bp
TTTCATTCCAAATCATATGATTAATTCTGAAGGATTAATATTTTGAATGT
TAAATTTGTGGATAATGAAAAAAACTAATTTAAGTATGTTTTTAGCTCTT
GGATTAAGCGGATTTCTTCCCAATCTTCATCATTTGTGGCTTGAAAAGGT
GACTAAAGAAGAAATCAAAAATCAGTACTCGTGGTTAGGTTTAATGGCAA
TCGCATATTTGTTAGGGACTTTTTGTTATGCAAAAAAAATACCAGAAAAA
TATTTTCCTGGGAAATGCAATATTTTATTTCAGAGTCATCAGATATTTCA
TATGTGCGTCATTCTTGGTGCAATCTTTCATACAATTAATACGATGAGTA
TGGTTGATGCAAAATTGAAAGAATTATCAAAATAAATCTTCATTATATTA
ATTTAAATAGATCGGAAG
back to top

protein sequence of SMED30015405-orf-1

>SMED30015405-orf-1 ID=SMED30015405-orf-1|Name=SMED30015405-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MLNLWIMKKTNLSMFLALGLSGFLPNLHHLWLEKVTKEEIKNQYSWLGLM
AIAYLLGTFCYAKKIPEKYFPGKCNILFQSHQIFHMCVILGAIFHTINTM
SMVDAKLKELSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004254AdipoR/HlyIII-related
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
GO:0031226intrinsic component of plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0004872receptor activity
GO:0042802identical protein binding
GO:0046872metal ion binding
GO:0046982protein heterodimerization activity
GO:0055100adiponectin binding
GO:0097003adipokinetic hormone receptor activity
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:0007186G-protein coupled receptor signaling pathway
GO:0007507heart development
GO:0007565female pregnancy
GO:0007584response to nutrient
GO:0009755hormone-mediated signaling pathway
GO:0019395fatty acid oxidation
GO:0030308negative regulation of cell growth
GO:0033211adiponectin-activated signaling pathway
GO:0042304regulation of fatty acid biosynthetic process
GO:0042593glucose homeostasis
GO:0046326positive regulation of glucose import
GO:0061042vascular wound healing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004254AdipoR/Haemolysin-III-relatedPFAMPF03006HlyIIIcoord: 10..95
e-value: 4.6E-22
score: 78.8
IPR004254AdipoR/Haemolysin-III-relatedPANTHERPTHR20855ADIPOR/PROGESTIN RECEPTOR-RELATEDcoord: 12..106
NoneNo IPR availablePANTHERPTHR20855:SF52ADIPONECTIN RECEPTOR PROTEINcoord: 12..106
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 44..61