Sushi/SCR/CCP domain-containing protein

Overview
NameSushi/SCR/CCP domain-containing protein
Smed IDSMED30015403
Length (bp)2037
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sushi/SCR/CCP domain-containing protein (SMED30015403) t-SNE clustered cells

Violin plots show distribution of expression levels for Sushi/SCR/CCP domain-containing protein (SMED30015403) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sushi/SCR/CCP domain-containing protein (SMED30015403) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sushi/SCR/CCP domain-containing protein (SMED30015403) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015403

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015403h1SMcG0014682 SmedASXL_016197SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30015403h1SMcG0014682 dd_Smed_v4_16592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015403h1SMcG0014682 dd_Smed_v4_16592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015403h1SMcG0014682 dd_Smed_v4_16592_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015403h1SMcG0014682 dd_Smed_v6_16592_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015403h1SMcG0014682 OX_Smed_1.0.20340ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sushi/SCR/CCP domain-containing protein vs. TrEMBL
Match: A0A4E0RGX6 (Sushi/SCR/CCP domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_002908 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.770e-78
Identity = 175/583 (30.02%), Postives = 281/583 (48.20%), Query Frame = 1
Query:  220 DNPCYDG-WGYSNINGKCYSNSFNVS--NQLTAAAICKSSLVSIDGRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNPSSQ-WLWSDGS------LVNINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQIQYNILGDKCDNLNTFICEHDSIPCDLMLLQMQPDTMQLIPNSIFISSYPYVSCKPGYYRPSEIPAAKVIQAG---PVPNNYAYCTGTRDVTKNPALYNAKWNVSQ--IDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNXXXXXXXIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLFNSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQK 1923
            D PC+D  W YS+++GKCY      +      A+A C  SL       TQ V RL++ S+ ++  A+   M  +GN   +W+DA  + S + + W +G+       ++ +  +G    L L+     +    +  S   ++   +    C+    F+CEHD   C          +M L P          V CK G Y        + + A     +  N  YC G RD + +P LY AK+  S   +  C  + C  +  +L NV++        +Q  F+FG T+ ++C  G+V+  N++S    + C Q      +GVW P NY  C +++CD+  L SM+P NA + S RN  T + Y    Q +    + N++ ++C +G+ YPDR+  K +IC L  NS TS  + GY GT LPL  SC+  TC  E  +I P  ++ P + I N  G ++N ++  G P+  QA++ F C  GF T   +    + C   G WSP L  CI     +   N   +  +  EA SAK+I  + + ++ IF  LI++LD++T+ RD+K + +N+   +  I R R K
Sbjct:   34 DVPCFDETWQYSDVSGKCYKFVGKSAPLKWAEASAACSQSLS------TQSV-RLIQFSSEDELRALIEIMLRLGNMDSIWLDAHRDSSGKDFRWQNGTEPLQFPFLDWSEGRGNGQCLELS-----YLTSALPTSSNWKMDVTLQETDCEERKPFVCEHDVQLCQNPPGGFDNTSMVLTPPKAAPRKLVTVVCKEGSYMTPGPTTERSVDADVNDTLGANQYYCDGKRDPSGDPQLYVAKFKYSGYLVSKCARLQCPLYPQLLKNVENAPELPPGTTQLIFNFGETIDLNCTGGYVSLQNATSTVGRMECSQVDRLAAEGVWIPENYQVCVAVRCDLDELKSMVPKNAFLSSARNYQTDRLY-AQHQVNEFSYYGNVITIRCNNGFLYPDRTTEKLVICKLAENSKTSGVYGGYGGTSLPLPGSCEATTCMYENAVIKPEHHMNPYFLIQNGTGDWMNVSKHEGIPYALQAKIRFFCKEGFETVNQNEDFNITCSDTGLWSPQLIGCIAKTAEIPSTNTGRFYTEPEEAKSAKEISSIMLILIFIFLGLIILLDLTTIGRDMKQLWSNLKLQQKRISRGRSK 603          
BLAST of Sushi/SCR/CCP domain-containing protein vs. TrEMBL
Match: A0A504Z6P6 (Sushi/SCR/CCP domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_07331 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 6.737e-76
Identity = 171/584 (29.28%), Postives = 285/584 (48.80%), Query Frame = 1
Query:  220 DNPCYDG-WGYSNINGKCYSNSFNVSNQLTAAAICKSSLVSIDGRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNPSSQ-WLWSDGS------LVNINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQIQYNILGDKCDNLNTFICEHDSIPCDLMLLQMQPDTMQLIPNSIFISSYPYVSCKPGYYRPSEIPAAKVIQAG---PVPNNYAYCTGTRDVTKNPALY--NAKWNVSQIDACQSVSCAPFSGVLNNVQS--QIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNXXXXXXXIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLFNSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQKL 1926
            D PC D  W YS+++GKCY      S  L  A    + L S+  +  Q V RL++ S+ ++  A+   M  +GN   +W+DA  + S + + W +G+       ++ +  +G    L L+     +    +  S   ++   +    C+    F+CEHD   C          +M L P          V CK G Y      +++ + A     +  N  YC G RD + +P LY  N K++   +  C  + C  +  +L NV++  ++PQ    +Q  F+FG T+ ++C  G+V+  N++S    + C Q      +GVW P NY  C +++CD+  L SM+P NA + S RN  T + Y    Q +    + N++ ++C +G+ YPDR+  K +IC L  NS T+  + GY GT LPL  SC+  TC  E  +I    +++P + I N  G ++N ++  G P+  QA++ F C  GF T   +    + C   G WSP L  CI     +   N   +  +  EA SAK I  + + ++ IF   +++LD++T+ RD+K + +N+   +  I R R K+
Sbjct:   17 DVPCLDETWQYSDVSGKCY-RFVGKSAPLKWAEASAACLQSLSTQSNQSV-RLIQFSSEDELRALIEIMLRLGNMDSIWLDAHRDSSGKDFRWQNGTEPLQFPFLDWSEGRGNGQCLELS-----YLTSALPTSSNWKMDVTLQETDCEERKPFLCEHDVQLCQNPPGGFDNSSMVLTPPKAAPRKVFTVVCKEGSYMTPGSTSSRSVDADVNDTLGANQYYCDGKRDPSGDPQLYVANFKYSGYLVSKCARLQCPLYPQLLKNVENAPELPQG--TTQLIFNFGETIDLNCTGGYVSLHNATSTVGRMECSQVDRFAAEGVWIPENYQVCVAVRCDLDELKSMVPKNAFLSSARNYQTDRLY-AQHQVNEFSYYGNVITIRCNNGFLYPDRTTEKLVICKLAENSKTNGVYGGYGGTSLPLPGSCEATTCMYENAVIKHEHHMKPYFLIQNGTGDWMNVSKHEGIPYALQAKIRFFCEEGFETVNQNEDFNITCSDTGLWSPQLIGCIAKTAEIPSTNTGRFYTEPEEAKSAKAISSIMLILIFIFLGFVILLDLTTIGRDMKQLWSNLKLQQKRISRGRFKM 590          
BLAST of Sushi/SCR/CCP domain-containing protein vs. TrEMBL
Match: A0A1S8X800 (Lectin C-type domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01278 PE=4 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.554e-70
Identity = 173/589 (29.37%), Postives = 277/589 (47.03%), Query Frame = 1
Query:  220 DNPCYD-GWGYSNINGKCYSNSFNVSNQLTAAAICKSSLVSIDGRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNP-SSQWLWSDGS----LVNINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQ--IQYNILGDKCDNLNTFICEHDSIPCDLMLLQMQPDTMQLIPNSIFISSYPYVSCKPGYY--RPSEIPAAKVIQAGP-----VPNNYAYCTGTR--DVTKNPALYNAKWNVSQ--IDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNXXXXXXXIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLFNSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQKLQ 1929
            D PCYD  W YS+  GKCY    + S +LT     +     ++G  T  V RLL++ +  ++  ++  M   G    VW+ A+    ++++ W D S    L   +   G  P       C+ F Y       T +  +Q NI    C     + CEH+ + C          TM+  P++    +     CKPG +  + ++ PA     +GP     +     YC GTR      +P  +  ++  S   +  C +V C  F   L +V+++       S     FG  + +DC+ G+V+  N +S  +++ C+Q+      GVW P NY  C +++C  + L +M P NAL+ S RN  T + Y    Q +    F N++ V+C+ GY +PDR   K++ C L   S T   + GY GT+LPL + C+  TC  E  I+ P  N++  +   N+ G++ N T+  G P+   A+L F C SG+ T   +S   + C   G W+P L  CI I   L   +   +     EA SAKQ+  +   +++IF   IVILD++T+ RD K + TN+   K  I+   Q+ Q
Sbjct:    2 DVPCYDDSWTYSSFTGKCYKEMMD-SKKLTWDKAKEQCSKFLEGVSTAKV-RLLQVRSKEESMTVARIMQQAGFMEAVWIGARRGAGTAEFKWDDESETADLSFFDWSGGAGP-----GDCIEFSYETDTNQDTSKWGLQLNIQNVDCSFERAYYCEHEVLRCQNPPGGFDEQTMRFEPSTTVPRALVTAVCKPGKFMVKKNKPPAI----SGPDVNTTLKEGQYYCDGTRIGSGAADPMKFQTQFKYSGYPVTECDTVICLLFPDGLEHVKNRPTSDPGESYLKKRFGDVIELDCSHGYVSQANRNSTKATMSCEQADVSSANGVWKPENYQACVAVRCSETELQNMKPKNALLASARNYGTDKAYGPQ-QVNEFNYFGNVITVRCMPGYLFPDRVVEKEVFCGLKKGSETEGQYFGYSGTVLPLPDECEVTTCMFENAILKPEHNMESEFMANNATGVWKNLTKHEGKPYALNAELRFFCQSGYETVNQNSDLNITCSNSGIWTPQLIGCIEITEKLPASSDGRFHGTKEEAKSAKQVSSIMFILIIIFLGFIVILDLTTVGRDTKTLVTNMKLQKKRIQLQSQRRQ 578          
BLAST of Sushi/SCR/CCP domain-containing protein vs. TrEMBL
Match: G7YMZ6 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_102296 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 3.011e-70
Identity = 170/589 (28.86%), Postives = 277/589 (47.03%), Query Frame = 1
Query:  220 DNPCYDG-WGYSNINGKCYSNSFNVSNQLTAAAICKSSLVSIDGRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNP-SSQWLWSDGSLVN----INALKGVAPTLNLTNPCVLFQYYYIYVSGTPQ--IQYNILGDKCDNLNTFICEHDSIPCDLMLLQMQPDTMQLIPNSIFISSYPYVSCKPGYY--RPSEIPAAKVIQAGP-----VPNNYAYCTGTR--DVTKNPALYNAKWNVSQ--IDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNXXXXXXXIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLFNSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQKLQ 1929
            D PCYD  W YS+++GKCY    +   Q    A  + S   +DG  T  V RLL++ +  ++  ++  M   G     W+ A+    S+++ W D S        +   G  P       C+ F Y       T +  +Q NI    C     + CEH+   C+        +TM+  P+     +     CKPG +  +    PA     +GP     +  +  YC GTR      +P  +  K+  S   +  C +V+C  F   L +V+++       S     FG  + +DC+ G+V+  N +S  +++ C+Q      +GVW P NY  C +++C+   L +M P NA++ S RN  T + Y    Q +    + N++ ++C+ GY +PDR   K++ C L   S T   + GY GT+LPL   C+  TC  E +I+ P  N++P +   N+ G++ N T+  G P+   A+L F C +G+ T   +S   + C   G W+P L  CI I   L   +   +     EA SAKQ+  +   +++IF   IVILD++T+ RD K +  N+   K  I+  +Q+ Q
Sbjct:   23 DVPCYDDTWTYSSLSGKCYKKMADSKKQTWDKAKEQCSKF-LDGVSTAKV-RLLQVRSKEESVTVARIMQQAGFMEAAWLGARRRGGSAEFKWDDESEAADFSFFDWSGGAGP-----GDCIEFSYETDPNQDTSKWGLQLNIQNVDCSFERAYYCEHEVPRCENPPGGFNQETMRFEPSVAVPRALLRAVCKPGKFMVKKDRPPA----NSGPDVNTTLKEDQYYCDGTRINSGAADPMKFQTKFQYSGYPVTKCDTVTCLLFPDGLEHVKNKPTPDPGESYLEKRFGDVIELDCSYGYVSQANRNSTKATMSCEQGDVSSAKGVWNPENYQTCVAVRCNEKELQTMKPENAVLASARNYETDKAYGPQ-QVNEFNHYGNVITIRCLPGYLFPDRFVEKEVFCGLKKGSETEGEYFGYSGTVLPLPAKCEVTTCMFENVILKPEHNMKPQFMANNATGVWKNLTKHEGKPYALNAELRFFCQAGYETVNQNSDLNITCSNSGTWTPQLIGCIEITEKLPASSDGRFQGTKEEAKSAKQVSSIMFILIIIFLGFIVILDLTTVGRDTKTLVNNMKLQKKRIQATKQQSQ 599          
BLAST of Sushi/SCR/CCP domain-containing protein vs. TrEMBL
Match: A0A4S2L3F2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010513 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.098e-67
Identity = 168/583 (28.82%), Postives = 271/583 (46.48%), Query Frame = 1
Query:  220 DNPCYDG-WGYSNINGKCYSNSFNVSNQLTAAAICKSSLVSIDGRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNP-SSQWLWSDGSLVNINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQ--IQYNILGDKCDNLNTFICEHDSIPCDLMLLQMQPDTMQLIPNSIFISSYPYVSCKPGYY-----RPSEIPAAKVIQAGPVPNNYAYCTGTR--DVTKNPALYNAKWNVSQ--IDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNXXXXXXXIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLFNSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQKLQ 1929
            D PCYD  W YS++ GKCY    +   Q    A  + S   +DG     V RLL++ +  ++  ++  M   G   +VW+ A+    S+++ W D S     +    +      + C+ F Y       T +  +Q NI    C     + CEH+   C         +TM+  P++ F  +     CKPG +     RP +     V     +  ++ YC GTR      +P  +  ++  S   +  C +V C  F   L +V+++             FG  + +DC+ G+V+  N +S  +++ C+Q      +GVW P NY  C +++C  + L +M P NAL+ S RN  T + Y    Q +    + N++  +C+ GY +PDR   K++ C L   S T   + GY GT+LPL   C+  TC  E  I+ P  N++  +   N+ G++ N T+  G P+   AQL F C SG+ T   +S   + C   G W+P L  CI I   L   +   +     EA SAKQ+  +   +++IF   IVILD++T+ RD K +  N+   K  I+  +Q  Q
Sbjct:   23 DVPCYDDTWTYSSLTGKCYKKMMDSKKQTWDKAKEQCSKF-LDGVSIAKV-RLLQVRSKEESVTVARMMQQAGFMEVVWIGARRRGGSAEFKWDDESEAADFSFFDWSGGAGQGD-CIEFSYETDTNQDTSKWGLQLNIENVDCSVGRAYYCEHEVPRCQNPPGGFNENTMRFEPSTTFPRALVRAVCKPGKFMVKKARPPDNSGPDVNMT--LKEDHYYCDGTRINSGAADPMKFRTQFKYSGYPVTECDTVICLLFPDGLEHVENRPKPDPGEPYLKKRFGDLIDLDCSYGYVSQANRNSTKATMSCEQGDVSSAKGVWNPENYQTCVAVRCSEAELQTMKPENALLASARNYETDKAYGPQ-QVNEFNHYGNVITFRCMPGYLFPDRVIEKEVFCGLKKGSQTEGQYFGYSGTVLPLPAKCEVTTCMFENAILRPEHNMESQFMANNATGVWKNLTKHEGKPYALNAQLRFFCQSGYETVNQNSDLNITCSNSGIWTPQLIGCIEITEKLPASSDGRFQGTKEEAKSAKQVSSIMFILIIIFLGFIVILDLTTVGRDTKTLVNNMKLQKKRIQATKQHSQ 599          
BLAST of Sushi/SCR/CCP domain-containing protein vs. Planmine SMEST
Match: SMESG000009423.1 (SMESG000009423.1)

HSP 1 Score: 1165.6 bits (3014), Expect = 0.000e+0
Identity = 582/590 (98.64%), Postives = 586/590 (99.32%), Query Frame = 1
Query:  163 MTNLLVSFVILFLNGYYCQDNPCYDGWGYSNINGKCYSNSFNVSNQLTAAAICKSSLVSIDGRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNPSSQWLWSDGSLVNINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQIQYNILGDKCDNLNTFICEHDSIPCDLMLLQMQPDTMQLIPNSIFISSYPYVSCKPGYYRPSEIPAAKVIQAGPVPNNYAYCTGTRDVTKNPALYNAKWNVSQIDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNXXXXXXXIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLFNSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQKLQD 1932
            MTNLLVSFVILFLNGYYCQDNPCYDGWGYSNINGKCYSNSFN SNQLTAAAICKSSLVSID RFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNPSSQW WSDGSLV+INALKGVAPTLNLTNPCVLFQYYYIYVSGTPQIQYNILGDKCDNLNTFICEHDSI CDLMLLQMQPDTMQLIPNSIFISSYPYVSCKPGYYRPSE+PAAKVIQAGPVPNNYAYCTGTRDVTKNPALYNAKWNVSQIDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNSSSASSSIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLF+SCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNW+PNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQKLQD
Sbjct:    1 MTNLLVSFVILFLNGYYCQDNPCYDGWGYSNINGKCYSNSFNFSNQLTAAAICKSSLVSIDRRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDAQLNPSSQWQWSDGSLVDINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQIQYNILGDKCDNLNTFICEHDSISCDLMLLQMQPDTMQLIPNSIFISSYPYVSCKPGYYRPSELPAAKVIQAGPVPNNYAYCTGTRDVTKNPALYNAKWNVSQIDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNSSSASSSIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTILPLFSSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWNPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQKLQD 590          
BLAST of Sushi/SCR/CCP domain-containing protein vs. Planmine SMEST
Match: SMESG000010733.1 (SMESG000010733.1)

HSP 1 Score: 254.603 bits (649), Expect = 2.221e-76
Identity = 162/514 (31.52%), Postives = 258/514 (50.19%), Query Frame = 1
Query:  373 LLRISNINDATAISNQMTLIGNNALVWMDAQLNPS-SQWLWSDGSL-VNINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQIQYNILGDKCDNLNTFICEHDSIPCDLMLLQ-MQPDTMQLIPNSIFISSYPYVSCKPGYYRPSEIPAAKVIQAGPVPNNYAYCTGTR-DVTKNPALYNAKWNVSQIDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNXXXXXXXIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTIL--PLFNSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLK 1896
            L  I + ND   +   +  IGN+  +W++A  N    +W WS     VN    + V   LN  N C + ++ YIYV G   +   I  + C N ++ +CE  +  C    ++      M+L P+  +I +   V CK G+Y  S+               +  CT T       P +        +I  C+ V C       +N      ++ V+ Q  +++G  +   C RGFV+Y   +   + + C+QS T+K +G+W P ++ PC +I+C+M  L  + P NA+    RN++TQ+ ++  FQ +  P FNNIV +QC    F+ DR  +K  +CD+ N S    SW GY GT +  PL   C+ VTC  E +      N++ ++++  S    +N T      + +   L F C +GF T    + Q++ CGP GNW P L+ CI     ++ GN + Y+P    A+ A+++G + I IMVIFFS+IVILD+ST+ RDIK++R NI  L+
Sbjct:   20 LTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDV--NLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEY------------WVTCTQTEVKQAWKPKM------SQRIIQCKMVGCNKPEEQFSNANKD--KNHVDKQI-YNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPL--KCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAIVIIIMVIFFSIIVILDLSTITRDIKILRKNIRFLR 508          
BLAST of Sushi/SCR/CCP domain-containing protein vs. Planmine SMEST
Match: SMESG000010733.1 (SMESG000010733.1)

HSP 1 Score: 254.218 bits (648), Expect = 2.830e-76
Identity = 162/514 (31.52%), Postives = 258/514 (50.19%), Query Frame = 1
Query:  373 LLRISNINDATAISNQMTLIGNNALVWMDAQLNPS-SQWLWSDGSL-VNINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQIQYNILGDKCDNLNTFICEHDSIPCDLMLLQ-MQPDTMQLIPNSIFISSYPYVSCKPGYYRPSEIPAAKVIQAGPVPNNYAYCTGTR-DVTKNPALYNAKWNVSQIDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGFVNYMNXXXXXXXIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIPNNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVKQLICDLNNNSLTSASWQGYMGTIL--PLFNSCQNVTCKNEAIIITPTMNIQPIYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCGPQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVIFFSLIVILDMSTLARDIKVMRTNIIRLK 1896
            L  I + ND   +   +  IGN+  +W++A  N    +W WS     VN    + V   LN  N C + ++ YIYV G   +   I  + C N ++ +CE  +  C    ++      M+L P+  +I +   V CK G+Y  S+               +  CT T       P +        +I  C+ V C       +N      ++ V+ Q  +++G  +   C RGFV+Y   +   + + C+QS T+K +G+W P ++ PC +I+C+M  L  + P NA+    RN++TQ+ ++  FQ +  P FNNIV +QC    F+ DR  +K  +CD+ N S    SW GY GT +  PL   C+ VTC  E +      N++ ++++  S    +N T      + +   L F C +GF T    + Q++ CGP GNW P L+ CI     ++ GN + Y+P    A+ A+++G + I IMVIFFS+IVILD+ST+ RDIK++R NI  L+
Sbjct:   18 LTVIRDTNDLMILHRMLIEIGNSEALWLNAYFNEKDKEWKWSTSEQSVNKTIFQDV--NLNQINSCAILKFNYIYVDGPFTLSSTIQNENCSNPHSVVCEIQTESCTTDTIRGFDNSIMELNPDISYIENTVQVQCKDGFYSESDYEY------------WVTCTQTEVKQAWKPKM------SQRIIQCKMVGCNKPEEQFSNANKD--KNHVDKQI-YNYGDEILFRCIRGFVDYKYRNQTIAKLKCKQSKTNKREGLWEPQSFAPCVAIECNMGELQILKPTNAIFSGARNRITQEEFNPEFQMNQFPYFNNIVDIQCNSDLFFSDRKMIKNFLCDIKNLSEIKGSWIGYAGTEVNNPL--KCEAVTCMYEDVRTQKFQNLEELFEMKISGNQMINITNHEWMSYNYTNTLRFFCKNGFLTGNQETFQLVKCGPDGNWIPRLSDCIKKTEQVDSGNKKFYIPPPQNANGAREVGAIVIIIMVIFFSIIVILDLSTITRDIKILRKNIRFLR 506          
The following BLAST results are available for this feature:
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RGX61.770e-7830.02Sushi/SCR/CCP domain-containing protein OS=Fasciol... [more]
A0A504Z6P66.737e-7629.28Sushi/SCR/CCP domain-containing protein OS=Fasciol... [more]
A0A1S8X8001.554e-7029.37Lectin C-type domain protein (Fragment) OS=Opistho... [more]
G7YMZ63.011e-7028.86Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A4S2L3F21.098e-6728.82Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sushi/SCR/CCP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000009423.10.000e+098.64SMESG000009423.1[more]
SMESG000010733.12.221e-7631.52SMESG000010733.1[more]
SMESG000010733.12.830e-7631.52SMESG000010733.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015403 ID=SMED30015403|Name=Sushi/SCR/CCP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2037bp
ATTGCAATAGAAAATAACAATGGCATGTCAAAGAGACTTGTTGCTGTTCG
ACACTGACCTACCCAGCCATGCATTATATTTCCGCATTAAAAAAGACCAC
TTTTTTCTTCATTCGATTTCAAAATTGCAAATTAATTCTACAAAATATTT
CCAGTCTATATTATGACGAATTTGTTGGTTTCTTTTGTAATTTTGTTTTT
AAATGGATATTACTGTCAAGATAACCCATGTTATGACGGATGGGGGTATT
CCAATATTAATGGAAAATGCTATTCGAATAGTTTTAATGTTTCAAATCAA
TTAACAGCAGCAGCTATATGTAAAAGTTCTTTGGTTTCTATTGATGGACG
TTTCACTCAATTTGTTCCAAGATTACTTAGAATTTCAAATATTAACGATG
CCACTGCCATCTCAAACCAAATGACTTTAATAGGAAATAATGCCCTGGTT
TGGATGGATGCTCAACTTAATCCTTCAAGTCAGTGGCTATGGAGTGACGG
ATCTCTCGTCAATATAAATGCATTGAAGGGAGTTGCTCCAACACTTAACT
TAACAAACCCATGTGTCCTATTTCAATATTATTATATTTATGTTAGCGGA
ACACCTCAAATACAATACAATATATTAGGGGATAAGTGTGACAATCTCAA
TACATTTATATGCGAACATGATTCTATACCTTGTGATTTGATGTTGCTTC
AAATGCAACCAGACACAATGCAACTAATTCCCAATTCTATTTTCATCAGT
AGTTATCCGTATGTATCATGTAAACCTGGATACTATAGGCCTTCCGAAAT
TCCCGCAGCAAAGGTTATTCAAGCGGGACCCGTGCCTAATAATTATGCCT
ACTGTACCGGAACTAGAGATGTCACTAAGAATCCAGCTTTATACAATGCT
AAGTGGAATGTTTCACAAATCGATGCTTGTCAAAGTGTTTCTTGTGCTCC
ATTTTCTGGAGTTTTGAATAACGTGCAAAGTCAGATTCCCCAGTCTATGG
TTAACTCACAGACAAGTTTCAGTTTTGGATTCACTTTGTACGTAGATTGC
GCTCGAGGATTTGTGAACTATATGAACAGCAGTTCCGCATCATCTTCTAT
TGTCTGTCAACAGTCCATAACCGATAAGACACAAGGAGTTTGGACCCCAA
TTAATTACACTCCATGTAACTCAATTAAATGTGACATGTCAATTTTGACC
TCAATGATTCCAAACAATGCTTTGATCCAATCTGTAAGAAACAAAGTTAC
GCAACAACCTTATGACGTAACTTTCCAAACAAGCTTCATCCCATTGTTTA
ACAATATTGTTGGAGTACAATGTATTGACGGATACTTTTACCCTGACCGA
TCATGGGTCAAACAATTGATATGCGACTTGAATAATAACTCTCTCACTTC
TGCAAGTTGGCAGGGATATATGGGAACCATTTTACCACTTTTTAATTCGT
GTCAAAATGTAACCTGCAAGAATGAGGCTATTATTATTACTCCAACCATG
AATATCCAACCAATTTATCAAATCCTAAATAGCATTGGGATTTTTGTCAA
CCAAACTCAATCAAATGGCAATCCTTTCCCATTCCAAGCGCAATTGCTAT
TTACATGCCTGAGTGGATTCACAACTGCTATTGGATCTAGCACCCAGGTA
TTAGTTTGTGGACCACAAGGAAACTGGAGTCCTAATCTTACTCCTTGCAT
CACAATTATCCCAGCTTTAAACGTGGGCAATGCTCAACATTATGTTCCAG
ACGCTGTCGAGGCGTCATCCGCTAAACAAATCGGAATTGTCGCTATCGGG
ATTATGGTCATTTTCTTCTCATTAATTGTCATTTTAGACATGTCAACGTT
GGCTCGCGACATAAAGGTAATGCGGACGAACATTATTCGCCTCAAAGCGT
CAATAAAACGAAACAGGCAAAAACTACAAGATTAATGTTTACTAAAAAGC
AAATACAAAACATCAACAACATCAAAATCATGACTTAATAATTGTTTAAT
CGCTATAATATTAATAATCATAATAATAAATAGATCG
back to top

protein sequence of SMED30015403-orf-1

>SMED30015403-orf-1 ID=SMED30015403-orf-1|Name=SMED30015403-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=591bp
MTNLLVSFVILFLNGYYCQDNPCYDGWGYSNINGKCYSNSFNVSNQLTAA
AICKSSLVSIDGRFTQFVPRLLRISNINDATAISNQMTLIGNNALVWMDA
QLNPSSQWLWSDGSLVNINALKGVAPTLNLTNPCVLFQYYYIYVSGTPQI
QYNILGDKCDNLNTFICEHDSIPCDLMLLQMQPDTMQLIPNSIFISSYPY
VSCKPGYYRPSEIPAAKVIQAGPVPNNYAYCTGTRDVTKNPALYNAKWNV
SQIDACQSVSCAPFSGVLNNVQSQIPQSMVNSQTSFSFGFTLYVDCARGF
VNYMNSSSASSSIVCQQSITDKTQGVWTPINYTPCNSIKCDMSILTSMIP
NNALIQSVRNKVTQQPYDVTFQTSFIPLFNNIVGVQCIDGYFYPDRSWVK
QLICDLNNNSLTSASWQGYMGTILPLFNSCQNVTCKNEAIIITPTMNIQP
IYQILNSIGIFVNQTQSNGNPFPFQAQLLFTCLSGFTTAIGSSTQVLVCG
PQGNWSPNLTPCITIIPALNVGNAQHYVPDAVEASSAKQIGIVAIGIMVI
FFSLIVILDMSTLARDIKVMRTNIIRLKASIKRNRQKLQD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR035976Sushi/SCR/CCP_sf
IPR001304C-type_lectin-like
IPR000436Sushi_SCR_CCP_dom
IPR016186C-type_lectin-like/link_sf
IPR016187CTDL_fold
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 574..590
NoneNo IPR availableGENE3DG3DSA:2.10.70.10coord: 457..515
e-value: 8.4E-6
score: 28.1
NoneNo IPR availableCDDcd00037CLECTcoord: 35..169
e-value: 5.87994E-5
score: 40.681
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.705
NoneNo IPR availableTMHMMTMhelixcoord: 542..564
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 23..168
e-value: 6.3E-7
score: 39.0
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 17..171
e-value: 1.8E-8
score: 36.5
IPR000436Sushi/SCR/CCP domainPFAMPF00084Sushicoord: 465..508
e-value: 1.6E-5
score: 25.4
IPR000436Sushi/SCR/CCP domainCDDcd00033CCPcoord: 470..513
e-value: 0.00191015
score: 34.746
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 460..514
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 13..172