ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30015384
Length (bp)1448
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30015384) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30015384) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30015384) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30015384) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015384

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015384h1SMcG0004977 SmedASXL_015395SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015384h1SMcG0004977 dd_Smed_v4_8330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015384h1SMcG0004977 dd_Smed_v4_8330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015384h1SMcG0004977 dd_Smed_v4_8330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015384h1SMcG0004977 dd_Smed_v4_8330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015384h1SMcG0004977 dd_Smed_v6_8330_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015384h1SMcG0004977 dd_Smed_v4_8330_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD60 (ankyrin repeat domain 60 [Source:HGNC Symbol;Acc:HGNC:16217])

HSP 1 Score: 148.673 bits (374), Expect = 5.371e-40
Identity = 75/206 (36.41%), Postives = 123/206 (59.71%), Query Frame = 3
Query:  111 TNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWH--VWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMF 722
            T E F++        +R+L+ E ++  GIP N+Q L YLD+  L+DD T++  D+V    +++ +WH   W EL+   V+ D +K+  +G+T+DS + T +SE    ++ + W  +RA +AL +ASHRGH +    L++ GA     + LGRT LH+AAA  +S+ I LLL  GA+I  +D  G TP+++A++  H   ER + + 
Sbjct:  103 TGEMFRVANCRGDMTVRELKEELDLMVGIPFNLQRLQYLDEGVLMDDTTLKFHDVVPGGIISLCIWHHDGWTELVLAAVEGDPSKLSCLGLTEDSFYRTANSEHFEGEKWKHWTSQRAFVALYVASHRGHFDAVQYLLEHGASCLSRSPLGRTPLHVAAAMGRSDCIILLLQHGASIHDRDAKGETPISIAHRLNHTLSERQMVLL 308          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 68.9366 bits (167), Expect = 1.346e-11
Identity = 30/76 (39.47%), Postives = 52/76 (68.42%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+E+ S+L++  A V+ +TK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENH 152          

HSP 2 Score: 60.4622 bits (145), Expect = 5.979e-9
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 3
Query:  453 RANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETK 758
            R  IA + +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L+ +GA++D +   G TP+ +   YG+      +  F  Q  AK N +TK
Sbjct:  662 RQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIK----IVNFLLQHSAKVNAKTK 761          

HSP 3 Score: 58.5362 bits (140), Expect = 2.349e-8
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE+L  +       ++ N AL IAS  G  E+   L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  L   +G TP+ +A + GH
Sbjct:   91 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGH 185          

HSP 4 Score: 56.6102 bits (135), Expect = 1.030e-7
Identity = 26/76 (34.21%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+   A V+++ +   T LH+A+ +  + ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  239 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHE 314          

HSP 5 Score: 55.0694 bits (131), Expect = 3.146e-7
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  GAK++  T+ G T LH  A     +++++LL + A I  K  NGL+P+ +A +  H +C + L 
Sbjct:  272 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLL 354          

HSP 6 Score: 54.6842 bits (130), Expect = 3.610e-7
Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA+ +    +G TP+ L+ + GH+     L 
Sbjct:  465 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLL 552          

HSP 7 Score: 54.6842 bits (130), Expect = 3.641e-7
Identity = 25/70 (35.71%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  T+ G  ++HLAA +   +++ LLL + AN++L + +GLTP+ LA
Sbjct:  635 LHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLA 704          

HSP 8 Score: 54.299 bits (129), Expect = 5.132e-7
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +++  GH ++ + L+  GA ++ +TK G T LH+AA   K E+ +LLL K A+ D    +GLTP+ +A  Y
Sbjct:  536 LHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHY 608          

HSP 9 Score: 53.9138 bits (128), Expect = 6.812e-7
Identity = 25/84 (29.76%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GH+ + S+L+  GA  N +   G TALH+AA   ++E++  L+  GA ++ K  +  TP+ ++ + G
Sbjct:  427 QAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLG 510          

HSP 10 Score: 52.7582 bits (125), Expect = 1.780e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +A+H GH ++   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   GH
Sbjct:  370 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGH 445          

HSP 11 Score: 51.9878 bits (123), Expect = 2.952e-6
Identity = 25/74 (33.78%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            L I++  G  ++  +L++ GA  N +T  G T LHL+A +   ++   LL  GA++ +    G TP+ +A KYG
Sbjct:  503 LHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYG 576          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 65.4698 bits (158), Expect = 3.466e-11
Identity = 31/84 (36.90%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ S+L++  A V+ +TK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H    + L 
Sbjct:   51 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLL 134          

HSP 2 Score: 54.6842 bits (130), Expect = 1.279e-7
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE+L  +       ++ N AL IAS  G  E+   L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  L   +G TP+ +A + GH
Sbjct:   65 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGH 159          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 67.3958 bits (163), Expect = 4.979e-11
Identity = 30/84 (35.71%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +A+  GH+ L  +L+  G+ V+ +TK G TALH+A+   ++E++ +L+ +GANI+ +  NG TP+ +A +  H    ++L 
Sbjct:   67 ALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLL 150          

HSP 2 Score: 62.3882 bits (150), Expect = 1.433e-9
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            L +AS  GH ++ + L+  GA ++ STK G T+LHLAA +DK  + D+L   GA+ D     G TP+ +A  YG+
Sbjct:  633 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGN 707          

HSP 3 Score: 62.3882 bits (150), Expect = 1.673e-9
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            E     L IA+H G++ + + L+  GA V+++ + G T LH+A+ +  + ++ LLL +G  ID K  +GLTP+  A + GH
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGH 311          

HSP 4 Score: 60.8474 bits (146), Expect = 5.591e-9
Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            L +AS RG+  +   L+  G +++  T+ G T LH AA     ++++LLL +GA +  +  NGL+P+ +A +  H  C +HL   +
Sbjct:  270 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK 355          

HSP 5 Score: 58.151 bits (139), Expect = 3.236e-8
Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L+K GA +N  ++ G T L++AA ++  +++  LL  GAN      +G TP+ +A + GH
Sbjct:   96 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGH 175          

HSP 6 Score: 56.9954 bits (136), Expect = 6.778e-8
Identity = 29/70 (41.43%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ S L+  GA+ N  TK G T LHLA+ +  ++++ LLL KGANI +   +GLT + LA
Sbjct:  600 LHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLA 669          

HSP 7 Score: 52.373 bits (124), Expect = 2.309e-6
Identity = 27/80 (33.75%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R   AL +A+  G +E+   L++ GA V+   +  +T LH+A+   K+EI+ LLL   A+ D    NG TP+ ++ + G 
Sbjct:  463 RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 542          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 67.3958 bits (163), Expect = 5.022e-11
Identity = 30/84 (35.71%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +A+  GH+ L  +L+  G+ V+ +TK G TALH+A+   ++E++ +L+ +GANI+ +  NG TP+ +A +  H    ++L 
Sbjct:   46 ALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLL 129          

HSP 2 Score: 62.7734 bits (151), Expect = 1.384e-9
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            L +AS  GH ++ + L+  GA ++ STK G T+LHLAA +DK  + D+L   GA+ D     G TP+ +A  YG+
Sbjct:  612 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGN 686          

HSP 3 Score: 62.3882 bits (150), Expect = 1.616e-9
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            E     L IA+H G++ + + L+  GA V+++ + G T LH+A+ +  + ++ LLL +G  ID K  +GLTP+  A + GH
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGH 290          

HSP 4 Score: 60.8474 bits (146), Expect = 5.401e-9
Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            L +AS RG+  +   L+  G +++  T+ G T LH AA     ++++LLL +GA +  +  NGL+P+ +A +  H  C +HL   +
Sbjct:  249 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK 334          

HSP 5 Score: 58.151 bits (139), Expect = 3.153e-8
Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L+K GA +N  ++ G T L++AA ++  +++  LL  GAN      +G TP+ +A + GH
Sbjct:   75 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGH 154          

HSP 6 Score: 57.3806 bits (137), Expect = 6.661e-8
Identity = 29/70 (41.43%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ S L+  GA+ N  TK G T LHLA+ +  ++++ LLL KGANI +   +GLT + LA
Sbjct:  579 LHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLA 648          

HSP 7 Score: 52.373 bits (124), Expect = 2.212e-6
Identity = 27/80 (33.75%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R   AL +A+  G +E+   L++ GA V+   +  +T LH+A+   K+EI+ LLL   A+ D    NG TP+ ++ + G 
Sbjct:  442 RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 521          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 67.3958 bits (163), Expect = 1.488e-11
Identity = 31/84 (36.90%), Postives = 55/84 (65.48%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            +L +AS  GH E+  +LIK  A+V+ +T+ G TALH+A+   +S I+ +L+  GAN++++  NG TP+ +A +  H+   ++L 
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          

HSP 2 Score: 57.7658 bits (138), Expect = 1.642e-8
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMA 782
             ++L +K      Q R NI+ L +A+  G   + + L+  GA ++  TK   T LH AA     +++DLL+++GA I  K  NGL P+ +A +  H    R L   R      ++   YL P  +A
Sbjct:  243 GQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVA 366          

HSP 3 Score: 56.6102 bits (135), Expect = 4.091e-8
Identity = 35/99 (35.35%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  408 SEILFDKEKRQW----LQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE++ +  KRQ        + N AL IAS  G   + + L++ GA VN  +  G T L++AA ++  E++  LL  GAN  L   +G TP+ +A + GH
Sbjct:   79 SEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGH 177          

HSP 4 Score: 50.8322 bits (120), Expect = 1.975e-6
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IAS  G+ ++   L++AGA  N +T+   + LH+AA + + E+  +LL   A+  L    G TP+ LA+KYG+    R L 
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 5 Score: 49.2914 bits (116), Expect = 6.348e-6
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IA+ +  +E+ S L++  A  N  ++ G T LHL+A +   EI  LL+  G+++  K  NGLT M L  +  H    + L+
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILY 709          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 67.3958 bits (163), Expect = 1.488e-11
Identity = 31/84 (36.90%), Postives = 55/84 (65.48%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            +L +AS  GH E+  +LIK  A+V+ +T+ G TALH+A+   +S I+ +L+  GAN++++  NG TP+ +A +  H+   ++L 
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          

HSP 2 Score: 57.7658 bits (138), Expect = 1.642e-8
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMA 782
             ++L +K      Q R NI+ L +A+  G   + + L+  GA ++  TK   T LH AA     +++DLL+++GA I  K  NGL P+ +A +  H    R L   R      ++   YL P  +A
Sbjct:  243 GQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVA 366          

HSP 3 Score: 56.6102 bits (135), Expect = 4.091e-8
Identity = 35/99 (35.35%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  408 SEILFDKEKRQW----LQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE++ +  KRQ        + N AL IAS  G   + + L++ GA VN  +  G T L++AA ++  E++  LL  GAN  L   +G TP+ +A + GH
Sbjct:   79 SEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGH 177          

HSP 4 Score: 50.8322 bits (120), Expect = 1.975e-6
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IAS  G+ ++   L++AGA  N +T+   + LH+AA + + E+  +LL   A+  L    G TP+ LA+KYG+    R L 
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 5 Score: 49.2914 bits (116), Expect = 6.348e-6
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IA+ +  +E+ S L++  A  N  ++ G T LHL+A +   EI  LL+  G+++  K  NGLT M L  +  H    + L+
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILY 709          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 67.3958 bits (163), Expect = 1.547e-11
Identity = 31/84 (36.90%), Postives = 55/84 (65.48%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            +L +AS  GH E+  +LIK  A+V+ +T+ G TALH+A+   +S I+ +L+  GAN++++  NG TP+ +A +  H+   ++L 
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          

HSP 2 Score: 57.7658 bits (138), Expect = 1.567e-8
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMA 782
             ++L +K      Q R NI+ L +A+  G   + + L+  GA ++  TK   T LH AA     +++DLL+++GA I  K  NGL P+ +A +  H    R L   R      ++   YL P  +A
Sbjct:  243 GQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVA 366          

HSP 3 Score: 56.225 bits (134), Expect = 4.292e-8
Identity = 35/99 (35.35%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  408 SEILFDKEKRQW----LQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE++ +  KRQ        + N AL IAS  G   + + L++ GA VN  +  G T L++AA ++  E++  LL  GAN  L   +G TP+ +A + GH
Sbjct:   79 SEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGH 177          

HSP 4 Score: 51.2174 bits (121), Expect = 1.903e-6
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IAS  G+ ++   L++AGA  N +T+   + LH+AA + + E+  +LL   A+  L    G TP+ LA+KYG+    R L 
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 5 Score: 49.2914 bits (116), Expect = 6.606e-6
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IA+ +  +E+ S L++  A  N  ++ G T LHL+A +   EI  LL+  G+++  K  NGLT M L  +  H    + L+
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILY 709          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 67.3958 bits (163), Expect = 1.547e-11
Identity = 31/84 (36.90%), Postives = 55/84 (65.48%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            +L +AS  GH E+  +LIK  A+V+ +T+ G TALH+A+   +S I+ +L+  GAN++++  NG TP+ +A +  H+   ++L 
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          

HSP 2 Score: 57.7658 bits (138), Expect = 1.567e-8
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMA 782
             ++L +K      Q R NI+ L +A+  G   + + L+  GA ++  TK   T LH AA     +++DLL+++GA I  K  NGL P+ +A +  H    R L   R      ++   YL P  +A
Sbjct:  243 GQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVA 366          

HSP 3 Score: 56.225 bits (134), Expect = 4.292e-8
Identity = 35/99 (35.35%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  408 SEILFDKEKRQW----LQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE++ +  KRQ        + N AL IAS  G   + + L++ GA VN  +  G T L++AA ++  E++  LL  GAN  L   +G TP+ +A + GH
Sbjct:   79 SEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGH 177          

HSP 4 Score: 51.2174 bits (121), Expect = 1.903e-6
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IAS  G+ ++   L++AGA  N +T+   + LH+AA + + E+  +LL   A+  L    G TP+ LA+KYG+    R L 
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 5 Score: 49.2914 bits (116), Expect = 6.606e-6
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IA+ +  +E+ S L++  A  N  ++ G T LHL+A +   EI  LL+  G+++  K  NGLT M L  +  H    + L+
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILY 709          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 67.3958 bits (163), Expect = 1.564e-11
Identity = 31/84 (36.90%), Postives = 55/84 (65.48%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            +L +AS  GH E+  +LIK  A+V+ +T+ G TALH+A+   +S I+ +L+  GAN++++  NG TP+ +A +  H+   ++L 
Sbjct:   69 SLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL 152          

HSP 2 Score: 57.7658 bits (138), Expect = 1.597e-8
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMA 782
             ++L +K      Q R NI+ L +A+  G   + + L+  GA ++  TK   T LH AA     +++DLL+++GA I  K  NGL P+ +A +  H    R L   R      ++   YL P  +A
Sbjct:  243 GQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVA 366          

HSP 3 Score: 56.225 bits (134), Expect = 4.263e-8
Identity = 35/99 (35.35%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  408 SEILFDKEKRQW----LQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE++ +  KRQ        + N AL IAS  G   + + L++ GA VN  +  G T L++AA ++  E++  LL  GAN  L   +G TP+ +A + GH
Sbjct:   79 SEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGH 177          

HSP 4 Score: 50.8322 bits (120), Expect = 2.006e-6
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IAS  G+ ++   L++AGA  N +T+   + LH+AA + + E+  +LL   A+  L    G TP+ LA+KYG+    R L 
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 5 Score: 49.2914 bits (116), Expect = 6.448e-6
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L IA+ +  +E+ S L++  A  N  ++ G T LHL+A +   EI  LL+  G+++  K  NGLT M L  +  H    + L+
Sbjct:  627 LHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILY 709          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303125)

HSP 1 Score: 69.3218 bits (168), Expect = 5.654e-12
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+ + S+L++ GA V+ +TK G TALH+A+   + E++ LLL   A+++++  NG TP+ +A +  H +  R L 
Sbjct:   47 ALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLL 130          

HSP 2 Score: 68.5514 bits (166), Expect = 8.945e-12
Identity = 37/95 (38.95%), Postives = 56/95 (58.95%), Query Frame = 3
Query:  414 ILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            +L D +    +  ++    L IASH G+  + + LI+ GA VNYS K   + LH+AA   K+ ++ LLL KG NI+ K  +GLTP+  A + GH+
Sbjct:  190 LLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHE 284          

HSP 3 Score: 61.6178 bits (148), Expect = 1.300e-9
Identity = 30/85 (35.29%), Postives = 47/85 (55.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFM 719
             L ++S  GH E+ + LI+  A VN+  K G T +HL A +D   + ++L   GANID+    G TP+ +A+ +G  +  R L  
Sbjct:  637 PLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQ 721          

HSP 4 Score: 60.4622 bits (145), Expect = 3.379e-9
Identity = 30/76 (39.47%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
             L IAS  G++++   L++ GA+V+ +TK   TALH+AA + + E+  +L+  GA +D     G TP+ L  KYGH
Sbjct:  472 PLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 5 Score: 58.151 bits (139), Expect = 1.495e-8
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L++  A VN  ++ G T L++AA ++   ++ LLL  GAN  L   +G TP+ +A + GH
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGH 155          

HSP 6 Score: 56.9954 bits (136), Expect = 4.014e-8
Identity = 29/79 (36.71%), Postives = 44/79 (55.70%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
             L +ASH G   +   L++ GA V+ +T +G T LH  A +    I++LLL   AN + +  NG TP+ +A K G+ S 
Sbjct:  703 PLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV 781          

HSP 7 Score: 56.6102 bits (135), Expect = 5.329e-8
Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            AL IA+  G  E+ + LI+ GA ++ +TK G T LHL A     ++  LLL K A++D +  NG+TP+ +A  Y ++
Sbjct:  505 ALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQ 581          

HSP 8 Score: 56.6102 bits (135), Expect = 5.757e-8
Identity = 31/92 (33.70%), Postives = 48/92 (52.17%), Query Frame = 3
Query:  453 RANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            + NI+ L +A+  G   + S L++ G  +   T+ G T LH AA     +++D+LL +GA I  K  NGL P+ +A +  H    R L   R
Sbjct:  236 KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHR 327          

HSP 9 Score: 51.9878 bits (123), Expect = 1.458e-6
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            AL +A+H GH+ +   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   G
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303123)

HSP 1 Score: 68.9366 bits (167), Expect = 6.266e-12
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+ + S+L++ GA V+ +TK G TALH+A+   + E++ LLL   A+++++  NG TP+ +A +  H +  R L 
Sbjct:   47 ALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLL 130          

HSP 2 Score: 68.5514 bits (166), Expect = 1.072e-11
Identity = 35/76 (46.05%), Postives = 49/76 (64.47%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IASH G+  + + LI+ GA VNYS K   + LH+AA   K+ ++ LLL KG NI+ K  +GLTP+  A + GH+
Sbjct:  209 LHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHE 284          

HSP 3 Score: 61.2326 bits (147), Expect = 1.661e-9
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L ++S  GH E+ + LI+  A VN+  K G T +HL A +D   + ++L   GANID+    G TP+ +A+ +G  +  R L 
Sbjct:  638 LHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 720          

HSP 4 Score: 60.077 bits (144), Expect = 3.668e-9
Identity = 30/75 (40.00%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            L IAS  G++++   L++ GA+V+ +TK   TALH+AA + + E+  +L+  GA +D     G TP+ L  KYGH
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 5 Score: 57.7658 bits (138), Expect = 1.947e-8
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L++  A VN  ++ G T L++AA ++   ++ LLL  GAN  L   +G TP+ +A + GH
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGH 155          

HSP 6 Score: 57.7658 bits (138), Expect = 2.158e-8
Identity = 29/78 (37.18%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +ASH G   +   L++ GA V+ +T +G T LH  A +    I++LLL   AN + +  NG TP+ +A K G+ S 
Sbjct:  704 LHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV 781          

HSP 7 Score: 56.225 bits (134), Expect = 6.318e-8
Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            AL IA+  G  E+ + LI+ GA ++ +TK G T LHL A     ++  LLL K A++D +  NG+TP+ +A  Y ++
Sbjct:  505 ALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQ 581          

HSP 8 Score: 55.0694 bits (131), Expect = 1.369e-7
Identity = 31/90 (34.44%), Postives = 47/90 (52.22%), Query Frame = 3
Query:  459 NIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            NI+ L +A+  G   + S L++ G  +   T+ G T LH AA     +++D+LL +GA I  K  NGL P+ +A +  H    R L   R
Sbjct:  238 NISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHR 327          

HSP 9 Score: 52.7582 bits (125), Expect = 8.732e-7
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            AL +A+H GH+ +   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   G
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344224)

HSP 1 Score: 69.3218 bits (168), Expect = 6.418e-12
Identity = 33/90 (36.67%), Postives = 55/90 (61.11%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQ 734
            AL +AS  GH+ + S+L++ GA V+ +TK G TALH+A+   + E++ LLL   A+++++  NG TP+ +A +  H +  R L      Q
Sbjct:   47 ALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQ 136          

HSP 2 Score: 68.5514 bits (166), Expect = 9.807e-12
Identity = 37/94 (39.36%), Postives = 55/94 (58.51%), Query Frame = 3
Query:  414 ILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            +L D +    +  ++    L IASH G+  + + LI+ GA VNYS K   + LH+AA   K+ ++ LLL KG NI+ K  +GLTP+  A + GH
Sbjct:  190 LLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGH 283          

HSP 3 Score: 61.6178 bits (148), Expect = 1.527e-9
Identity = 30/85 (35.29%), Postives = 47/85 (55.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFM 719
             L ++S  GH E+ + LI+  A VN+  K G T +HL A +D   + ++L   GANID+    G TP+ +A+ +G  +  R L  
Sbjct:  637 PLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQ 721          

HSP 4 Score: 60.077 bits (144), Expect = 3.901e-9
Identity = 30/76 (39.47%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
             L IAS  G++++   L++ GA+V+ +TK   TALH+AA + + E+  +L+  GA +D     G TP+ L  KYGH
Sbjct:  472 PLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 5 Score: 58.151 bits (139), Expect = 1.833e-8
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L++  A VN  ++ G T L++AA ++   ++ LLL  GAN  L   +G TP+ +A + GH
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGH 155          

HSP 6 Score: 56.6102 bits (135), Expect = 5.048e-8
Identity = 29/79 (36.71%), Postives = 44/79 (55.70%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
             L +ASH G   +   L++ GA V+ +T +G T LH  A +    I++LLL   AN + +  NG TP+ +A K G+ S 
Sbjct:  703 PLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV 781          

HSP 7 Score: 56.225 bits (134), Expect = 6.310e-8
Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            AL IA+  G  E+ + LI+ GA ++ +TK G T LHL A     ++  LLL K A++D +  NG+TP+ +A  Y ++
Sbjct:  505 ALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQ 581          

HSP 8 Score: 56.225 bits (134), Expect = 6.530e-8
Identity = 31/92 (33.70%), Postives = 48/92 (52.17%), Query Frame = 3
Query:  453 RANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            + NI+ L +A+  G   + S L++ G  +   T+ G T LH AA     +++D+LL +GA I  K  NGL P+ +A +  H    R L   R
Sbjct:  236 KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHR 327          

HSP 9 Score: 51.6026 bits (122), Expect = 1.682e-6
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            AL +A+H GH+ +   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   G
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303117)

HSP 1 Score: 68.9366 bits (167), Expect = 6.420e-12
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+ + S+L++ GA V+ +TK G TALH+A+   + E++ LLL   A+++++  NG TP+ +A +  H +  R L 
Sbjct:   47 ALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLL 130          

HSP 2 Score: 68.1662 bits (165), Expect = 1.167e-11
Identity = 35/76 (46.05%), Postives = 49/76 (64.47%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IASH G+  + + LI+ GA VNYS K   + LH+AA   K+ ++ LLL KG NI+ K  +GLTP+  A + GH+
Sbjct:  209 LHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHE 284          

HSP 3 Score: 61.2326 bits (147), Expect = 1.839e-9
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L ++S  GH E+ + LI+  A VN+  K G T +HL A +D   + ++L   GANID+    G TP+ +A+ +G  +  R L 
Sbjct:  638 LHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 720          

HSP 4 Score: 60.077 bits (144), Expect = 3.958e-9
Identity = 30/75 (40.00%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            L IAS  G++++   L++ GA+V+ +TK   TALH+AA + + E+  +L+  GA +D     G TP+ L  KYGH
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 5 Score: 57.7658 bits (138), Expect = 2.012e-8
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L++  A VN  ++ G T L++AA ++   ++ LLL  GAN  L   +G TP+ +A + GH
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGH 155          

HSP 6 Score: 57.7658 bits (138), Expect = 2.231e-8
Identity = 29/78 (37.18%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +ASH G   +   L++ GA V+ +T +G T LH  A +    I++LLL   AN + +  NG TP+ +A K G+ S 
Sbjct:  704 LHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV 781          

HSP 7 Score: 56.225 bits (134), Expect = 7.055e-8
Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            AL IA+  G  E+ + LI+ GA ++ +TK G T LHL A     ++  LLL K A++D +  NG+TP+ +A  Y ++
Sbjct:  505 ALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQ 581          

HSP 8 Score: 55.0694 bits (131), Expect = 1.427e-7
Identity = 31/90 (34.44%), Postives = 47/90 (52.22%), Query Frame = 3
Query:  459 NIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            NI+ L +A+  G   + S L++ G  +   T+ G T LH AA     +++D+LL +GA I  K  NGL P+ +A +  H    R L   R
Sbjct:  238 NISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHR 327          

HSP 9 Score: 52.373 bits (124), Expect = 9.261e-7
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            AL +A+H GH+ +   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   G
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303121)

HSP 1 Score: 68.9366 bits (167), Expect = 6.593e-12
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+ + S+L++ GA V+ +TK G TALH+A+   + E++ LLL   A+++++  NG TP+ +A +  H +  R L 
Sbjct:   47 ALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLL 130          

HSP 2 Score: 68.1662 bits (165), Expect = 1.147e-11
Identity = 35/76 (46.05%), Postives = 49/76 (64.47%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IASH G+  + + LI+ GA VNYS K   + LH+AA   K+ ++ LLL KG NI+ K  +GLTP+  A + GH+
Sbjct:  209 LHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHE 284          

HSP 3 Score: 61.2326 bits (147), Expect = 1.732e-9
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L ++S  GH E+ + LI+  A VN+  K G T +HL A +D   + ++L   GANID+    G TP+ +A+ +G  +  R L 
Sbjct:  638 LHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 720          

HSP 4 Score: 60.077 bits (144), Expect = 3.793e-9
Identity = 30/75 (40.00%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            L IAS  G++++   L++ GA+V+ +TK   TALH+AA + + E+  +L+  GA +D     G TP+ L  KYGH
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          

HSP 5 Score: 57.7658 bits (138), Expect = 1.978e-8
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L++  A VN  ++ G T L++AA ++   ++ LLL  GAN  L   +G TP+ +A + GH
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGH 155          

HSP 6 Score: 57.7658 bits (138), Expect = 2.212e-8
Identity = 29/78 (37.18%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +ASH G   +   L++ GA V+ +T +G T LH  A +    I++LLL   AN + +  NG TP+ +A K G+ S 
Sbjct:  704 LHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV 781          

HSP 7 Score: 56.225 bits (134), Expect = 6.879e-8
Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            AL IA+  G  E+ + LI+ GA ++ +TK G T LHL A     ++  LLL K A++D +  NG+TP+ +A  Y ++
Sbjct:  505 ALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQ 581          

HSP 8 Score: 55.0694 bits (131), Expect = 1.415e-7
Identity = 31/90 (34.44%), Postives = 47/90 (52.22%), Query Frame = 3
Query:  459 NIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            NI+ L +A+  G   + S L++ G  +   T+ G T LH AA     +++D+LL +GA I  K  NGL P+ +A +  H    R L   R
Sbjct:  238 NISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHR 327          

HSP 9 Score: 52.373 bits (124), Expect = 9.424e-7
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            AL +A+H GH+ +   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   G
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 66.2402 bits (160), Expect = 1.129e-12
Identity = 33/84 (39.29%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++LIK GA V+ +TK G TALH+A+   +++++  L+  GANI+ +  NG TP+ +A +  H    + L 
Sbjct:   40 ALHLASKEGHVEVVTELIKLGATVDAATKKGNTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLL 123          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 71.2478 bits (173), Expect = 1.629e-12
Identity = 33/84 (39.29%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++L+K GA V+ +TK G TALH+A+   ++E++  L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   61 ALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLL 144          

HSP 2 Score: 60.4622 bits (145), Expect = 3.825e-9
Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL IAS  G LE+  +L++ GA  N +T  G T LHL+A +   EI  LLL +G+++      G TP+ +A KYG 
Sbjct:  494 ALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQ 569          

HSP 3 Score: 60.077 bits (144), Expect = 5.126e-9
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  LE+ + L++ GA+ N  T+ G + LHLAA +   +++ LLL K AN+++ + NGLTP+ LA
Sbjct:  627 LHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLA 696          

HSP 4 Score: 59.3066 bits (142), Expect = 9.364e-9
Identity = 34/92 (36.96%), Postives = 50/92 (54.35%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK 743
            L +A+  G ++L S L+   A VN   K G T LHLAA  DK+ + ++LL  GA ID +  +G TP+ +A  YG+      L   + +  AK
Sbjct:  660 LHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAK 751          

HSP 5 Score: 56.6102 bits (135), Expect = 6.537e-8
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            R   AL +A+  G +++   L++ GAKV+   K  +TALH+A+   K EI+  LL KGA  +    +G TP+ L+ + GH+
Sbjct:  457 RGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQ 537          

HSP 6 Score: 55.4546 bits (132), Expect = 1.333e-7
Identity = 28/78 (35.90%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +AS RG+  +   L+  G+K+   TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C
Sbjct:  264 LHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNC 341          

HSP 7 Score: 54.299 bits (129), Expect = 3.428e-7
Identity = 26/82 (31.71%), Postives = 47/82 (57.32%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            E     L IA+H G++ + + L+  GA V++  +   T LH+A+ +    ++ LLL +G+ I+ K  +GLTP+    + GH+
Sbjct:  225 ESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHE 306          

HSP 8 Score: 53.1434 bits (126), Expect = 7.170e-7
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +++  GH E+ + L++ G+ ++ +TK G T LH+AA   + E+ +LLL K A  D    +GLTP+ +A  Y
Sbjct:  528 LHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHY 600          

HSP 9 Score: 52.373 bits (124), Expect = 1.307e-6
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHL 713
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA++     +GLTP+ +A   GH++  + L
Sbjct:  362 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 444          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 71.2478 bits (173), Expect = 1.701e-12
Identity = 33/84 (39.29%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++L+K GA V+ +TK G TALH+A+   ++E++  L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   56 ALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLL 139          

HSP 2 Score: 60.077 bits (144), Expect = 4.784e-9
Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL IAS  G LE+  +L++ GA  N +T  G T LHL+A +   EI  LLL +G+++      G TP+ +A KYG 
Sbjct:  489 ALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQ 564          

HSP 3 Score: 60.077 bits (144), Expect = 5.781e-9
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  LE+ + L++ GA+ N  T+ G + LHLAA +   +++ LLL K AN+++ + NGLTP+ LA
Sbjct:  622 LHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLA 691          

HSP 4 Score: 59.3066 bits (142), Expect = 1.011e-8
Identity = 34/92 (36.96%), Postives = 50/92 (54.35%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK 743
            L +A+  G ++L S L+   A VN   K G T LHLAA  DK+ + ++LL  GA ID +  +G TP+ +A  YG+      L   + +  AK
Sbjct:  655 LHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAK 746          

HSP 5 Score: 56.6102 bits (135), Expect = 7.183e-8
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            R   AL +A+  G +++   L++ GAKV+   K  +TALH+A+   K EI+  LL KGA  +    +G TP+ L+ + GH+
Sbjct:  452 RGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQ 532          

HSP 6 Score: 55.4546 bits (132), Expect = 1.392e-7
Identity = 28/78 (35.90%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +AS RG+  +   L+  G+K+   TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C
Sbjct:  259 LHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNC 336          

HSP 7 Score: 53.9138 bits (128), Expect = 3.898e-7
Identity = 25/76 (32.89%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+  GA V++  +   T LH+A+ +    ++ LLL +G+ I+ K  +GLTP+    + GH+
Sbjct:  226 LHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHE 301          

HSP 8 Score: 53.1434 bits (126), Expect = 8.437e-7
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +++  GH E+ + L++ G+ ++ +TK G T LH+AA   + E+ +LLL K A  D    +GLTP+ +A  Y
Sbjct:  523 LHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHY 595          

HSP 9 Score: 52.373 bits (124), Expect = 1.329e-6
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHL 713
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA++     +GLTP+ +A   GH++  + L
Sbjct:  357 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 439          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 69.3218 bits (168), Expect = 6.149e-12
Identity = 33/84 (39.29%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++L+K GA V+ +TK G TALH+A+   ++E++  L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   78 ALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLL 161          

HSP 2 Score: 58.5362 bits (140), Expect = 1.696e-8
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            AL IAS  G LE+  +L++ GA  N +T  G T LHL+A +   EI  LLL +G+++      G TP+ +A KYG
Sbjct:  503 ALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYG 577          

HSP 3 Score: 58.151 bits (139), Expect = 1.801e-8
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  LE+ + L++ GA+ N  T+ G + LHLAA +   +++ LLL K AN+++ + NGLTP+ LA
Sbjct:  636 LHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLA 705          

HSP 4 Score: 57.3806 bits (137), Expect = 3.236e-8
Identity = 34/92 (36.96%), Postives = 50/92 (54.35%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK 743
            L +A+  G ++L S L+   A VN   K G T LHLAA  DK+ + ++LL  GA ID +  +G TP+ +A  YG+      L   + +  AK
Sbjct:  669 LHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAK 760          

HSP 5 Score: 54.299 bits (129), Expect = 3.113e-7
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            R   AL +A+  G +++   L++ GAKV+   K  +TALH+A+   K EI+  LL KGA  +    +G TP+ L+ + GH+
Sbjct:  466 RGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQ 546          

HSP 6 Score: 53.5286 bits (127), Expect = 5.082e-7
Identity = 29/83 (34.94%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  G+K+   TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  273 LHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 355          

HSP 7 Score: 53.1434 bits (126), Expect = 6.577e-7
Identity = 28/100 (28.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIA-LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            T S+ +L   +    ++ ++    L IA+H G++ + + L+  GA V++  +   T LH+A+ +    ++ LLL +G+ I+ K  +GLTP+    + GH+
Sbjct:  216 TKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHE 315          

HSP 8 Score: 51.2174 bits (121), Expect = 2.834e-6
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +++  GH E+ + L++ G+ ++ +TK G T LH+AA   + E+ +LLL K A  D    +GLTP+ +A  Y
Sbjct:  537 LHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHY 609          

HSP 9 Score: 50.8322 bits (120), Expect = 3.928e-6
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHL 713
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA++     +GLTP+ +A   GH++  + L
Sbjct:  371 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 453          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 69.3218 bits (168), Expect = 6.149e-12
Identity = 33/84 (39.29%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++L+K GA V+ +TK G TALH+A+   ++E++  L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   78 ALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLL 161          

HSP 2 Score: 58.5362 bits (140), Expect = 1.696e-8
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            AL IAS  G LE+  +L++ GA  N +T  G T LHL+A +   EI  LLL +G+++      G TP+ +A KYG
Sbjct:  503 ALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYG 577          

HSP 3 Score: 58.151 bits (139), Expect = 1.801e-8
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  LE+ + L++ GA+ N  T+ G + LHLAA +   +++ LLL K AN+++ + NGLTP+ LA
Sbjct:  636 LHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLA 705          

HSP 4 Score: 57.3806 bits (137), Expect = 3.236e-8
Identity = 34/92 (36.96%), Postives = 50/92 (54.35%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK 743
            L +A+  G ++L S L+   A VN   K G T LHLAA  DK+ + ++LL  GA ID +  +G TP+ +A  YG+      L   + +  AK
Sbjct:  669 LHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAK 760          

HSP 5 Score: 54.299 bits (129), Expect = 3.113e-7
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            R   AL +A+  G +++   L++ GAKV+   K  +TALH+A+   K EI+  LL KGA  +    +G TP+ L+ + GH+
Sbjct:  466 RGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQ 546          

HSP 6 Score: 53.5286 bits (127), Expect = 5.082e-7
Identity = 29/83 (34.94%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  G+K+   TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  273 LHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 355          

HSP 7 Score: 53.1434 bits (126), Expect = 6.577e-7
Identity = 28/100 (28.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIA-LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            T S+ +L   +    ++ ++    L IA+H G++ + + L+  GA V++  +   T LH+A+ +    ++ LLL +G+ I+ K  +GLTP+    + GH+
Sbjct:  216 TKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHE 315          

HSP 8 Score: 51.2174 bits (121), Expect = 2.834e-6
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +++  GH E+ + L++ G+ ++ +TK G T LH+AA   + E+ +LLL K A  D    +GLTP+ +A  Y
Sbjct:  537 LHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHY 609          

HSP 9 Score: 50.8322 bits (120), Expect = 3.928e-6
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHL 713
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA++     +GLTP+ +A   GH++  + L
Sbjct:  371 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 453          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000031606.1 (ankyrin repeat domain 60 [Source:NCBI gene;Acc:100379950])

HSP 1 Score: 186.037 bits (471), Expect = 2.822e-54
Identity = 105/285 (36.84%), Postives = 168/285 (58.95%), Query Frame = 3
Query:  102 LLPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWH--VWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETK-YLNP-PMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEE 944
            LL T E F++      T + +L+ + E+A GIPA++Q L Y+D+ DL D +T +   I+   T+++  W      +L+    + D+ K+  +GVT DS++ TP+S +L  + K  W+  RA+ AL IASHRGH  +   L++ GA V+  T LG + LH+AAA    + ID LL  GA I   D NG + + LA+ +G K  E  LF+++W++RA  +  K +L+P  +   Q +DSSL  W+ GP ++ Y   L+  GE+ G+ +NAP+++ ++R   P K EE
Sbjct:   28 LLETGEMFRVPGCSRLTKVAELKEKLELAAGIPAHLQRLSYIDEGDLPDKSTFKYNGIIPKGTISLRSWSQDGCSDLVKAAAEGDLPKLKYLGVTADSNYNTPNSLLLSLEAKCDWVAARASTALYIASHRGHTAMVRFLLRNGANVHGKTLLGSSPLHVAAAMGNCDCIDELLAYGAEIQDTDGNGHSALDLASLWGQKKAENRLFLYQWKKRASKVSLKSHLDPKELFPHQKYDSSLRTWRCGPQAKNYMVNLVTHGEYSGTNINAPRKSNNQR--RPAKHEE 310          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 74.3294 bits (181), Expect = 2.740e-13
Identity = 33/76 (43.42%), Postives = 53/76 (69.74%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+E+ S+LI+ GA V+ STK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H
Sbjct:   55 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENH 130          

HSP 2 Score: 58.5362 bits (140), Expect = 2.635e-8
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +ASH G++++ + L++ G+KVN  TK G T LH AA +  + II++LL  GA+ +    NG T + +A + G+ S 
Sbjct:  712 LHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISV 789          

HSP 3 Score: 57.7658 bits (138), Expect = 4.228e-8
Identity = 26/76 (34.21%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+  GA V+++ +   T LH+A+ +  + ++ LLL +G+ ID K  +GLTP+    + GH+
Sbjct:  217 LHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHE 292          

HSP 4 Score: 55.8398 bits (133), Expect = 1.745e-7
Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L ++S  GH ++ S L++ GA     TK G T LH+AA   K E++ LLL K A+ D    +GLTP+ +A  Y
Sbjct:  514 LHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHY 586          

HSP 5 Score: 55.4546 bits (132), Expect = 2.219e-7
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  474 IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L  +GA ID       TP+ +A+ YG+
Sbjct:  648 LAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGN 720          

HSP 6 Score: 55.4546 bits (132), Expect = 2.398e-7
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  G+K++  T+ G T LH  A     +++ +LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  250 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 332          

HSP 7 Score: 55.0694 bits (131), Expect = 3.183e-7
Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GH+ + S+L   GA  N +   G TALH+AA   +SE++  LL  GA ++ K  +  TP+ ++ + G
Sbjct:  405 QAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLG 488          

HSP 8 Score: 54.299 bits (129), Expect = 4.724e-7
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  TK G   +HLAA +   +++ LLL + AN+++ + +GLTP+ LA
Sbjct:  613 LHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLA 682          

HSP 9 Score: 53.5286 bits (127), Expect = 7.638e-7
Identity = 28/80 (35.00%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA  D    +G TP+ L+++ GH
Sbjct:  443 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGH 522          

HSP 10 Score: 52.373 bits (124), Expect = 2.048e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +A+H GH ++   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   GH
Sbjct:  348 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGH 423          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 74.3294 bits (181), Expect = 2.837e-13
Identity = 33/76 (43.42%), Postives = 53/76 (69.74%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+E+ S+LI+ GA V+ STK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H
Sbjct:   55 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENH 130          

HSP 2 Score: 58.5362 bits (140), Expect = 2.612e-8
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +ASH G++++ + L++ G+KVN  TK G T LH AA +  + II++LL  GA+ +    NG T + +A + G+ S 
Sbjct:  719 LHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISV 796          

HSP 3 Score: 57.7658 bits (138), Expect = 4.301e-8
Identity = 26/76 (34.21%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+  GA V+++ +   T LH+A+ +  + ++ LLL +G+ ID K  +GLTP+    + GH+
Sbjct:  224 LHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHE 299          

HSP 4 Score: 55.8398 bits (133), Expect = 1.775e-7
Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L ++S  GH ++ S L++ GA     TK G T LH+AA   K E++ LLL K A+ D    +GLTP+ +A  Y
Sbjct:  521 LHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHY 593          

HSP 5 Score: 55.4546 bits (132), Expect = 2.258e-7
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  474 IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L  +GA ID       TP+ +A+ YG+
Sbjct:  655 LAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGN 727          

HSP 6 Score: 55.0694 bits (131), Expect = 2.460e-7
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  G+K++  T+ G T LH  A     +++ +LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  257 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 339          

HSP 7 Score: 54.6842 bits (130), Expect = 3.294e-7
Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GH+ + S+L   GA  N +   G TALH+AA   +SE++  LL  GA ++ K  +  TP+ ++ + G
Sbjct:  412 QAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLG 495          

HSP 8 Score: 54.299 bits (129), Expect = 4.889e-7
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  TK G   +HLAA +   +++ LLL + AN+++ + +GLTP+ LA
Sbjct:  620 LHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLA 689          

HSP 9 Score: 53.5286 bits (127), Expect = 7.572e-7
Identity = 28/80 (35.00%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA  D    +G TP+ L+++ GH
Sbjct:  450 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGH 529          

HSP 10 Score: 52.373 bits (124), Expect = 2.065e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +A+H GH ++   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   GH
Sbjct:  355 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGH 430          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 74.3294 bits (181), Expect = 3.007e-13
Identity = 33/76 (43.42%), Postives = 53/76 (69.74%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+E+ S+LI+ GA V+ STK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H
Sbjct:   63 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENH 138          

HSP 2 Score: 58.5362 bits (140), Expect = 2.567e-8
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +ASH G++++ + L++ G+KVN  TK G T LH AA +  + II++LL  GA+ +    NG T + +A + G+ S 
Sbjct:  728 LHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISV 805          

HSP 3 Score: 57.7658 bits (138), Expect = 3.748e-8
Identity = 27/82 (32.93%), Postives = 49/82 (59.76%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            E     L IA+H G++ + + L+  GA V+++ +   T LH+A+ +  + ++ LLL +G+ ID K  +GLTP+    + GH+
Sbjct:  227 ESGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHE 308          

HSP 4 Score: 55.8398 bits (133), Expect = 1.776e-7
Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L ++S  GH ++ S L++ GA     TK G T LH+AA   K E++ LLL K A+ D    +GLTP+ +A  Y
Sbjct:  530 LHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHY 602          

HSP 5 Score: 55.4546 bits (132), Expect = 2.358e-7
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  474 IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L  +GA ID       TP+ +A+ YG+
Sbjct:  664 LAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGN 736          

HSP 6 Score: 55.4546 bits (132), Expect = 2.378e-7
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  G+K++  T+ G T LH  A     +++ +LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  266 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 348          

HSP 7 Score: 55.0694 bits (131), Expect = 3.157e-7
Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GH+ + S+L   GA  N +   G TALH+AA   +SE++  LL  GA ++ K  +  TP+ ++ + G
Sbjct:  421 QAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLG 504          

HSP 8 Score: 54.299 bits (129), Expect = 4.933e-7
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  TK G   +HLAA +   +++ LLL + AN+++ + +GLTP+ LA
Sbjct:  629 LHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLA 698          

HSP 9 Score: 53.5286 bits (127), Expect = 7.448e-7
Identity = 28/80 (35.00%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA  D    +G TP+ L+++ GH
Sbjct:  459 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGH 538          

HSP 10 Score: 52.373 bits (124), Expect = 1.980e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +A+H GH ++   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   GH
Sbjct:  364 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGH 439          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 72.7886 bits (177), Expect = 8.249e-13
Identity = 33/76 (43.42%), Postives = 53/76 (69.74%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+E+ S+LI+ GA V+ STK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H
Sbjct:   55 ALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENH 130          

HSP 2 Score: 57.3806 bits (137), Expect = 4.847e-8
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +ASH G++++ + L++ G+KVN  TK G T LH AA +  + II++LL  GA+ +    NG T + +A + G+ S 
Sbjct:  719 LHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISV 796          

HSP 3 Score: 56.6102 bits (135), Expect = 9.728e-8
Identity = 26/76 (34.21%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+  GA V+++ +   T LH+A+ +  + ++ LLL +G+ ID K  +GLTP+    + GH+
Sbjct:  224 LHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHE 299          

HSP 4 Score: 54.6842 bits (130), Expect = 3.719e-7
Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L ++S  GH ++ S L++ GA     TK G T LH+AA   K E++ LLL K A+ D    +GLTP+ +A  Y
Sbjct:  521 LHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHY 593          

HSP 5 Score: 54.299 bits (129), Expect = 4.492e-7
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  474 IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L  +GA ID       TP+ +A+ YG+
Sbjct:  655 LAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGN 727          

HSP 6 Score: 54.299 bits (129), Expect = 5.244e-7
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  G+K++  T+ G T LH  A     +++ +LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  257 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 339          

HSP 7 Score: 53.5286 bits (127), Expect = 7.851e-7
Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GH+ + S+L   GA  N +   G TALH+AA   +SE++  LL  GA ++ K  +  TP+ ++ + G
Sbjct:  412 QAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLG 495          

HSP 8 Score: 53.1434 bits (126), Expect = 1.060e-6
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  TK G   +HLAA +   +++ LLL + AN+++ + +GLTP+ LA
Sbjct:  620 LHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLA 689          

HSP 9 Score: 51.9878 bits (123), Expect = 2.726e-6
Identity = 28/80 (35.00%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA  D    +G TP+ L+++ GH
Sbjct:  450 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGH 529          

HSP 10 Score: 51.2174 bits (121), Expect = 4.010e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +A+H GH ++   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   GH
Sbjct:  355 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGH 430          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd60 (ankyrin repeat domain 60 [Source:MGI Symbol;Acc:MGI:1917315])

HSP 1 Score: 143.665 bits (361), Expect = 1.382e-38
Identity = 73/239 (30.54%), Postives = 135/239 (56.49%), Query Frame = 3
Query:  111 TNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHV--WKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKT 821
            T E F++        +R+L+ E ++  GIP N+Q L++LD+  L+DDAT++  D++  A +++ +WH   W EL+   V+ D +K+  +G+++D+ + T +S+    ++ RQW  +RA +AL I++HRGH++    L+  GA     + LGRT LH+ AA  +++ +  LL  GA+I  +D    TP+T+A +      E  +F+  W  ++ +      +P ++  +  + S P   T
Sbjct:   77 TGELFRVANCRNDMTVRELKEELDLMVGIPFNLQRLHFLDRGILMDDATLKFYDVIPGALISLCIWHYDGWTELVLAAVEGDPSKMSCLGISEDTFYRTANSQHFKGEQWRQWTAQRAFVALYISAHRGHVDAVQYLLGLGANCLAKSPLGRTPLHVVAAMGRTDCVQPLLEHGASIHDRDLKSDTPITIARRLKRGHLEHKMFLLYWMVKSGSR-----DPDLVGRKALEKSSPGMAT 310          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd60 (ankyrin repeat domain 60 [Source:MGI Symbol;Acc:MGI:1917315])

HSP 1 Score: 113.62 bits (283), Expect = 9.399e-29
Identity = 58/195 (29.74%), Postives = 109/195 (55.90%), Query Frame = 3
Query:  243 VDDATIQSCDIVSNATLTMDMWHV--WKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKT 821
            +DDAT++  D++  A +++ +WH   W EL+   V+ D +K+  +G+++D+ + T +S+    ++ RQW  +RA +AL I++HRGH++    L+  GA     + LGRT LH+ AA  +++ +  LL  GA+I  +D    TP+T+A +      E  +F+  W  ++ +      +P ++  +  + S P   T
Sbjct:    1 MDDATLKFYDVIPGALISLCIWHYDGWTELVLAAVEGDPSKMSCLGISEDTFYRTANSQHFKGEQWRQWTAQRAFVALYISAHRGHVDAVQYLLGLGANCLAKSPLGRTPLHVVAAMGRTDCVQPLLEHGASIHDRDLKSDTPITIARRLKRGHLEHKMFLLYWMVKSGSR-----DPDLVGRKALEKSSPGMAT 190          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 66.6254 bits (161), Expect = 6.491e-12
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ S+L++  A V+ +TK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   47 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 130          

HSP 2 Score: 53.9138 bits (128), Expect = 1.081e-7
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE+L  +       ++ N AL IAS  G  E+   L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  L   +G TP+ +A + GH
Sbjct:   61 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGH 155          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 67.0106 bits (162), Expect = 7.736e-12
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ S+L++  A V+ +TK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   51 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 134          

HSP 2 Score: 54.299 bits (129), Expect = 1.175e-7
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE+L  +       ++ N AL IAS  G  E+   L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  L   +G TP+ +A + GH
Sbjct:   65 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGH 159          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 68.9366 bits (167), Expect = 9.910e-12
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ S+L++  A V+ +TK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 160          

HSP 2 Score: 59.6918 bits (143), Expect = 7.045e-9
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 3
Query:  453 RANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETK 758
            R  IA + +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L+ +GA++D +   G TP+ +   YG+      +  F  Q  AK N +TK
Sbjct:  670 RQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIK----IVNFLLQHSAKVNAKTK 769          

HSP 3 Score: 57.3806 bits (137), Expect = 4.010e-8
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE+L  +       ++ N AL IAS  G  E+   L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  L   +G TP+ +A + GH
Sbjct:   91 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGH 185          

HSP 4 Score: 55.4546 bits (132), Expect = 1.643e-7
Identity = 26/76 (34.21%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+   A V+++ +   T LH+A+ +  + ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  247 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHE 322          

HSP 5 Score: 54.299 bits (129), Expect = 3.980e-7
Identity = 25/70 (35.71%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  T+ G  ++HLAA +   +++ LLL + AN++L + +GLTP+ LA
Sbjct:  643 LHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLA 712          

HSP 6 Score: 54.299 bits (129), Expect = 4.049e-7
Identity = 29/88 (32.95%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA+ +    +G TP+ LA + GH+     L 
Sbjct:  473 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLL 560          

HSP 7 Score: 53.9138 bits (128), Expect = 4.726e-7
Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +A+  GH ++ + L+  GA ++ +TK G T LH+AA   K E+  LLL K A+ D    +GLTP+ +A  Y
Sbjct:  544 LHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHY 616          

HSP 8 Score: 53.5286 bits (127), Expect = 6.720e-7
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  GAK++  T+ G T LH  A     +++++LL + A I  K  NGL+P+ +A +  H +C + L 
Sbjct:  280 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL 362          

HSP 9 Score: 52.373 bits (124), Expect = 1.279e-6
Identity = 25/84 (29.76%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GH+ + S+L+  GA  N +   G TALH+AA   ++E++  L+  GA ++ K  +  TP+ ++ + G
Sbjct:  435 QAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLG 518          

HSP 10 Score: 51.9878 bits (123), Expect = 2.016e-6
Identity = 26/74 (35.14%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            L I++  G  ++  +L++ GA  N +T  G T LHLAA +   ++   LL  GA++ +    G TP+ +A KYG
Sbjct:  511 LHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYG 584          

HSP 11 Score: 51.2174 bits (121), Expect = 3.070e-6
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +A+H GH ++   L+   A  N     G T LH+A  K++  +++LLL  GA+I     +GLTP+ +A   GH
Sbjct:  378 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGH 453          

HSP 12 Score: 50.8322 bits (120), Expect = 3.675e-6
Identity = 28/78 (35.90%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +  H G++++ + L++  AKVN  TK G TALH AA +  + II++LL   A+ +    NG T + +A + G+ S 
Sbjct:  742 LHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISV 819          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BZ19|ANR60_HUMAN (Ankyrin repeat domain-containing protein 60 OS=Homo sapiens OX=9606 GN=ANKRD60 PE=4 SV=3)

HSP 1 Score: 148.673 bits (374), Expect = 2.579e-39
Identity = 75/206 (36.41%), Postives = 123/206 (59.71%), Query Frame = 3
Query:  111 TNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWH--VWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMF 722
            T E F++        +R+L+ E ++  GIP N+Q L YLD+  L+DD T++  D+V    +++ +WH   W EL+   V+ D +K+  +G+T+DS + T +SE    ++ + W  +RA +AL +ASHRGH +    L++ GA     + LGRT LH+AAA  +S+ I LLL  GA+I  +D  G TP+++A++  H   ER + + 
Sbjct:  103 TGEMFRVANCRGDMTVRELKEELDLMVGIPFNLQRLQYLDEGVLMDDTTLKFHDVVPGGIISLCIWHHDGWTELVLAAVEGDPSKLSCLGLTEDSFYRTANSEHFEGEKWKHWTSQRAFVALYVASHRGHFDAVQYLLEHGASCLSRSPLGRTPLHVAAAMGRSDCIILLLQHGASIHDRDAKGETPISIAHRLNHTLSERQMVLL 308          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 68.9366 bits (167), Expect = 6.465e-11
Identity = 30/76 (39.47%), Postives = 52/76 (68.42%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+E+ S+L++  A V+ +TK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENH 152          

HSP 2 Score: 60.4622 bits (145), Expect = 2.871e-8
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 3
Query:  453 RANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETK 758
            R  IA + +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L+ +GA++D +   G TP+ +   YG+      +  F  Q  AK N +TK
Sbjct:  662 RQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIK----IVNFLLQHSAKVNAKTK 761          

HSP 3 Score: 58.5362 bits (140), Expect = 1.128e-7
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE+L  +       ++ N AL IAS  G  E+   L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  L   +G TP+ +A + GH
Sbjct:   91 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGH 185          

HSP 4 Score: 56.6102 bits (135), Expect = 4.948e-7
Identity = 26/76 (34.21%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+   A V+++ +   T LH+A+ +  + ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  239 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHE 314          

HSP 5 Score: 55.0694 bits (131), Expect = 1.511e-6
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  GAK++  T+ G T LH  A     +++++LL + A I  K  NGL+P+ +A +  H +C + L 
Sbjct:  272 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLL 354          

HSP 6 Score: 54.6842 bits (130), Expect = 1.733e-6
Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA+ +    +G TP+ L+ + GH+     L 
Sbjct:  465 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLL 552          

HSP 7 Score: 54.6842 bits (130), Expect = 1.748e-6
Identity = 25/70 (35.71%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  T+ G  ++HLAA +   +++ LLL + AN++L + +GLTP+ LA
Sbjct:  635 LHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLA 704          

HSP 8 Score: 54.299 bits (129), Expect = 2.465e-6
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +++  GH ++ + L+  GA ++ +TK G T LH+AA   K E+ +LLL K A+ D    +GLTP+ +A  Y
Sbjct:  536 LHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHY 608          

HSP 9 Score: 52.7582 bits (125), Expect = 8.549e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +A+H GH ++   L+   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   GH
Sbjct:  370 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGH 445          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 68.9366 bits (167), Expect = 6.813e-11
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ S+L++  A V+ +TK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 160          

HSP 2 Score: 59.6918 bits (143), Expect = 4.761e-8
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 3
Query:  453 RANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETK 758
            R  IA + +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L+ +GA++D +   G TP+ +   YG+      +  F  Q  AK N +TK
Sbjct:  670 RQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIK----IVNFLLQHSAKVNAKTK 769          

HSP 3 Score: 57.3806 bits (137), Expect = 2.781e-7
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE+L  +       ++ N AL IAS  G  E+   L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  L   +G TP+ +A + GH
Sbjct:   91 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGH 185          

HSP 4 Score: 55.4546 bits (132), Expect = 1.139e-6
Identity = 26/76 (34.21%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+   A V+++ +   T LH+A+ +  + ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  247 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHE 322          

HSP 5 Score: 54.299 bits (129), Expect = 2.784e-6
Identity = 25/70 (35.71%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  T+ G  ++HLAA +   +++ LLL + AN++L + +GLTP+ LA
Sbjct:  643 LHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLA 712          

HSP 6 Score: 53.9138 bits (128), Expect = 3.728e-6
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  GAK++  T+ G T LH  A     +++++LL + A I  K  NGL+P+ +A +  H +C + L 
Sbjct:  280 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLL 362          

HSP 7 Score: 52.7582 bits (125), Expect = 6.918e-6
Identity = 28/88 (31.82%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA+ +    +G TP+ L+ + GH+     L 
Sbjct:  473 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLL 560          

HSP 8 Score: 52.7582 bits (125), Expect = 8.284e-6
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +++  GH ++ + L+  GA ++ +TK G T LH+AA   K E+  LLL K A+ D    +GLTP+ +A  Y
Sbjct:  544 LHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHY 616          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.153e-10
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ S+L++  A V+ +TK G TALH+A+   ++E++ +L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   60 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 143          

HSP 2 Score: 59.3066 bits (142), Expect = 7.159e-8
Identity = 37/104 (35.58%), Postives = 59/104 (56.73%), Query Frame = 3
Query:  453 RANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETK 758
            R  IA + +A+  GH+++ S L+   A VN S K G T LHLAA +D+  + ++L+ +GA++D +   G TP+ +   YG+      +  F  Q  AK N +TK
Sbjct:  645 RQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIK----IVNFLLQHSAKVNAKTK 744          

HSP 3 Score: 56.9954 bits (136), Expect = 4.009e-7
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 3
Query:  408 SEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            SE+L  +       ++ N AL IAS  G  E+   L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  L   +G TP+ +A + GH
Sbjct:   74 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGH 168          

HSP 4 Score: 55.0694 bits (131), Expect = 1.508e-6
Identity = 26/76 (34.21%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+   A V+++ +   T LH+A+ +  + ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  222 LHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHE 297          

HSP 5 Score: 53.5286 bits (127), Expect = 3.951e-6
Identity = 25/70 (35.71%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ + L++ GA  N  T+ G  ++HLAA +   +++ LLL + AN++L + +GLTP+ LA
Sbjct:  618 LHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLA 687          

HSP 6 Score: 53.5286 bits (127), Expect = 4.019e-6
Identity = 29/88 (32.95%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            R   AL +A+  G  E+   L++ GA+V    K  +T LH++A   K++I+  LL +GA+ +    +G TP+ LA + GH+     L 
Sbjct:  448 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLL 535          

HSP 7 Score: 53.5286 bits (127), Expect = 4.692e-6
Identity = 29/73 (39.73%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +A+  GH ++ + L+  GA ++ +TK G T LH+AA   K E+  LLL K A+ D    +GLTP+ +A  Y
Sbjct:  519 LHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHY 591          

HSP 8 Score: 53.1434 bits (126), Expect = 6.124e-6
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L+  GAK++  T+ G T LH  A     +++++LL + A I  K  NGL+P+ +A +  H +C + L 
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL 337          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 2.541e-10
Identity = 30/84 (35.71%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +A+  GH+ L  +L+  G+ V+ +TK G TALH+A+   ++E++ +L+ +GANI+ +  NG TP+ +A +  H    ++L 
Sbjct:   67 ALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLL 150          

HSP 2 Score: 62.3882 bits (150), Expect = 8.248e-9
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            E     L IA+H G++ + + L+  GA V+++ + G T LH+A+ +  + ++ LLL +G  ID K  +GLTP+  A + GH
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGH 311          

HSP 3 Score: 62.003 bits (149), Expect = 1.185e-8
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            L +AS  GH ++ + L+  GA ++ STK G T+LHLAA +DK  + D+L   GA+ D     G TP+ +A  YG+
Sbjct:  666 LHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGN 740          

HSP 4 Score: 58.9214 bits (141), Expect = 9.600e-8
Identity = 27/86 (31.40%), Postives = 49/86 (56.98%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            L +AS RG+  +   L+  G +++  T+ G T LH AA     ++++LLL + A +  +  NGL+P+ +A +  H  C +HL  ++
Sbjct:  270 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYK 355          

HSP 5 Score: 58.151 bits (139), Expect = 1.665e-7
Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L+K GA +N  ++ G T L++AA ++  +++  LL  GAN      +G TP+ +A + GH
Sbjct:   96 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGH 175          

HSP 6 Score: 56.9954 bits (136), Expect = 3.800e-7
Identity = 29/70 (41.43%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +++ S L+  GA+ N  TK G T LHLA+ +  ++++ LLL KGANI +   +GLT + LA
Sbjct:  633 LHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLA 702          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8GZ11 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027713g2 PE=4 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 2.005e-104
Identity = 169/436 (38.76%), Postives = 263/436 (60.32%), Query Frame = 3
Query:  111 TNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNEDNKEINKVEKFDQW-LKQKTRQQKINEAIKKKKEDDQRTIEEEKRRQRIAKF-KEIHGSEDVNDSIVTRGDLGDSVNRMGLTNKPVLDTKARIKELLMKYGLTDSDETPS-TVYEQWLLQRKIMGKAVIDDNLSIYGGYLPYQQMIREFCSKKC 1409
            T+E      + P + IRDL+   E+ TGIP  +Q L YLD  DL D+ TI+  +IV  AT+ M +WH W++L+      DI  +F++GVT+DS F TP+SE +  K++ +WL++RA +AL IA HR H E+ S+L+ +GA VN +T LGR+ LH+AAAK+  +II+LLL  GA++DL+D NG  P+ +A ++GHK CER LFMFRWQQRAK+ + ++LNP +  FQ  DS+ PKW+ G + Q Y +K+ PP EF+G+AL+AP+RNWHRR SA P  EE+  +       +  ++QW  K++  ++K+ E  ++ +E ++   + ++  Q++A+  ++ +   D +      G  G ++  +   +    D +   ++   +         P    YEQWL  R+        D+L       PYQ MI+EFC +KC
Sbjct:   21 TDETICFARVTPKSTIRDLKGYIELETGIPCELQKLNYLDAGDLPDEQTIKKIEIVPKATINMQVWHTWRDLVEACCSRDIEWLFSLGVTKDSKFQTPTSEYMLPKQRLEWLRQRAGVALFIACHRSHYEMASQLLSSGANVNATTALGRSPLHVAAAKNNGDIINLLLESGADVDLEDKNGQNPLAVAAEFGHKGCERRLFMFRWQQRAKSAKPQFLNPTLKEFQRSDSAYPKWRVGESLQVYLQKVQPPEEFIGTALHAPRRNWHRRSSATP--EELLTQRTASGRAI-SYEQWQQKKRNERRKVIEDERQAREQEEAKRKRQELDQQLAQLTRQAYAQHDGSAG----GPGGHALPPIAGHDGQQADPQHPGQQQQRRSAFRQRRLDPRLNAYEQWLKDRQER-----QDSLPAAAPPPPYQVMIQEFCRRKC 444          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267GEP8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007773g1 PE=4 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 2.894e-104
Identity = 169/436 (38.76%), Postives = 263/436 (60.32%), Query Frame = 3
Query:  111 TNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNEDNKEINKVEKFDQW-LKQKTRQQKINEAIKKKKEDDQRTIEEEKRRQRIAKF-KEIHGSEDVNDSIVTRGDLGDSVNRMGLTNKPVLDTKARIKELLMKYGLTDSDETPS-TVYEQWLLQRKIMGKAVIDDNLSIYGGYLPYQQMIREFCSKKC 1409
            T+E      + P + IRDL+   E+ TGIP  +Q L YLD  DL D+ TI+  +IV  AT+ M +WH W++L+      DI  +F++GVT+DS F TP+SE +  K++ +WL++RA +AL IA HR H E+ S+L+ +GA VN +T LGR+ LH+AAAK+  +II+LLL  GA++DL+D NG  P+ +A ++GHK CER LFMFRWQQRAK+ + ++LNP +  FQ  DS+ PKW+ G + Q Y +K+ PP EF+G+AL+AP+RNWHRR SA P  EE+  +       +  ++QW  K++  ++K+ E  ++ +E ++   + ++  Q++A+  ++ +   D +      G  G ++  +   +    D +   ++   +         P    YEQWL  R+        D+L       PYQ MI+EFC +KC
Sbjct:   21 TDETICFARLTPKSTIRDLKGYIELETGIPCELQKLNYLDAGDLPDEQTIKKIEIVPKATINMQVWHTWRDLVEACCSRDIEWLFSLGVTKDSKFQTPTSEYMLPKQRLEWLRQRAGVALFIACHRSHYEMASQLLSSGANVNATTALGRSPLHVAAAKNNGDIINLLLESGADVDLEDKNGQNPLAVAAEFGHKGCERRLFMFRWQQRAKSAKPQFLNPTLKEFQRSDSAYPKWRVGESLQVYLQKVQPPEEFIGTALHAPRRNWHRRSSATP--EELLTQRTASGRAI-SYEQWQQKKRNERRKVIEDERQAREQEEAKRKRQELDQQLAQLTRQAYAQHDGSAG----GPGGHALPPIAGHDGQQADPQHPGQQQQRRSAFRQRRLDPRLNAYEQWLKDRQER-----QDSLPAAAPPPPYQVMIQEFCRRKC 444          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267DXX8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027713g1 PE=4 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 3.366e-104
Identity = 169/436 (38.76%), Postives = 262/436 (60.09%), Query Frame = 3
Query:  111 TNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNEDNKEINKVEKFDQW-LKQKTRQQKINEAIKKKKEDDQRTIEEEKRRQRIAKF-KEIHGSEDVNDSIVTRGDLGDSVNRMGLTNKPVLDTKARIKELLMKYGLTDSDETPS-TVYEQWLLQRKIMGKAVIDDNLSIYGGYLPYQQMIREFCSKKC 1409
            T+E      + P + IRDL+   E+ TGIP  +Q L YLD  DL D+ TI+  +IV  AT+ M +WH W++L+      DI  +F++GVT+DS F TP+SE +  K++ +WL++RA +AL IA HR H E+ S+L+ +GA VN +T LGR+ LH+AAAK+  +II+LLL  GA++DL+D NG  P+ +A ++GHK CER LFMFRWQQRAK+ + ++LNP +  FQ  DS+ PKW+ G + Q Y +K+ PP EF+G+AL+AP+RNWHRR SA P  EE+  +       +  ++QW  K++  ++K+ E  ++ +E ++   + ++  Q++A+  ++ +   D +      G  G ++  +   +    D     ++   +         P    YEQWL  R+        D+L       PYQ MI+EFC +KC
Sbjct:   21 TDETICFARVTPKSTIRDLKGYIELETGIPCELQKLNYLDAGDLPDEQTIKKIEIVPKATINMQVWHTWRDLVEACCSRDIEWLFSLGVTKDSKFQTPTSEYMLPKQRLEWLRQRAGVALFIACHRSHYEMASQLLSSGANVNATTALGRSPLHVAAAKNNGDIINLLLESGADVDLEDKNGQNPLAVAAEFGHKGCERRLFMFRWQQRAKSAKPQFLNPTLKEFQRSDSAYPKWRVGESLQVYLQKVQPPEEFIGTALHAPRRNWHRRSSATP--EELLTQRTASGRAI-SYEQWQQKKRNERRKVIEDERQAREQEEAKRKRQELDQQLAQLTRQAYAQHDGSAG----GPGGHALPPIAGHDGQQADPHHPGQQQQRRSAFRQRRLDPRLNAYEQWLKDRQER-----QDSLPAAAPPPPYQVMIQEFCRRKC 444          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3KBN0 (uncharacterized protein LOC106180414 OS=Lingula unguis OX=7574 GN=LOC106180414 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 1.390e-88
Identity = 141/287 (49.13%), Postives = 185/287 (64.46%), Query Frame = 3
Query:  105 LPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNEDNK 965
            L T E F L  I P   I +L+S  E A GIP ++Q L YLD+ DL DD  I+  DIV   TL + +WH+WK L+     ND+  +  MGV+   DF TP+SE +  K K  W+ ERA +AL IASHRGHL++  KLI+AGA VN  T  GR+ALH+AAA+   +I+DLLL KG+NI+  D  G + + +A K+GHK CERHLF+FRWQ+RAK  +  + + P+MA Q FDS  P W  G   Q Y +K+LPPGEF G+A +AP RN  R  SAP + E+ + E NK
Sbjct:   23 LETGEVFPLKNITPDMKISELKSYIEFAAGIPYHMQRLNYLDEGDLQDDTDIRYNDIVPGGTLALKVWHMWKNLVEAAASNDVEAVMKMGVSNKIDFKTPNSEYMGSKNKAVWIAERAFVALYIASHRGHLKMVQKLIQAGANVNAQTPKGRSALHVAAAQGHGKIVDLLLEKGSNINAADQFGDSALQIATKFGHKGCERHLFLFRWQERAKKTKPSFQDIPLMAHQFFDSKFPVWLHGNHGQVYFQKILPPGEFEGTAFHAP-RNKERPSSAPKEREKGSRESNK 308          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3KGR0 (ankycorbin OS=Lingula unguis OX=7574 GN=LOC106181726 PE=4 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 2.192e-87
Identity = 140/287 (48.78%), Postives = 185/287 (64.46%), Query Frame = 3
Query:  105 LPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNEDNK 965
            L T E F L  I P   I +L+S  E A GIP ++Q L YLD+ DL DD  I+  DIV   TL + +WH+WK L+     ND+  +  MGV+   DF TP+SE +  K K  W+ ERA +AL IASHRGHL++  KLI+AGA VN  T  GR+ALH+AAA+   +I+DLLL KG+NI+  D  G + + +A K+GHK CERHLF+FRWQ+RAK  +  + + P+MA Q FDS  P W  G   Q Y +K+LPPGEF G+A +AP RN  R  SAP + E+ + E +K
Sbjct:   23 LETGEVFPLKNITPDMKISELKSYIEFAAGIPYHMQRLNYLDEGDLQDDTDIRYNDIVPGGTLALKVWHMWKNLVEAAASNDVEAVMKMGVSNKIDFKTPNSEYMGSKNKAVWIAERAFVALYIASHRGHLKMVQKLIQAGANVNAQTPKGRSALHVAAAQGHGKIVDLLLEKGSNINAADQFGDSALQIATKFGHKGCERHLFLFRWQERAKKTKPSFQDIPLMAHQFFDSKFPVWLHGNHGQVYFQKILPPGEFEGTAFHAP-RNKERPSSAPKEREKGSRESDK 308          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 71.633 bits (174), Expect = 9.708e-13
Identity = 34/84 (40.48%), Postives = 55/84 (65.48%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++LIK GA V+ +TK G TALH+A+   +S+++  L+  GAN++ +  NG TP+ +A +  H    R+L 
Sbjct:   24 ALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLL 107          

HSP 2 Score: 57.7658 bits (138), Expect = 2.467e-8
Identity = 28/76 (36.84%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+  GA V++  +   T LH+A+ +  S ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  186 LHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHE 261          

HSP 3 Score: 55.4546 bits (132), Expect = 1.172e-7
Identity = 29/83 (34.94%), Postives = 49/83 (59.04%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L++ GA+++  TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  219 LHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 301          

HSP 4 Score: 53.5286 bits (127), Expect = 4.486e-7
Identity = 31/81 (38.27%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            R   AL +A+  G  E+   L++ GA V+  +K  +T LH+++   K EII  LL  GA  D    +G TP+ LA + GHK
Sbjct:  412 RGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHK 492          

HSP 5 Score: 53.1434 bits (126), Expect = 6.895e-7
Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +A+  GH ++ S L+  GA +  +TK G T LH+AA   K E+ +LLL K A  D    +GLTP+ +A  Y
Sbjct:  483 LHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHY 555          

HSP 6 Score: 51.2174 bits (121), Expect = 2.181e-6
Identity = 25/84 (29.76%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GH  + ++L+  GA  N +   G TALH+AA   ++E++  L+  GA +D K  +  TP+ ++++ G
Sbjct:  374 QAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLG 457          

HSP 7 Score: 51.2174 bits (121), Expect = 2.181e-6
Identity = 32/98 (32.65%), Postives = 55/98 (56.12%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETK 758
            L +AS  G++++ + L+   A +N   K G T LHLAA +D+  + ++L+  GA +D +   G TP+ +A  YG+      +  F  + +AK N +TK
Sbjct:  615 LHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVK----MVHFLLKNQAKVNAKTK 708          

HSP 8 Score: 50.8322 bits (120), Expect = 3.322e-6
Identity = 27/74 (36.49%), Postives = 44/74 (59.46%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            L I+S  G  E+  +L++ GA  + +T  G T LHLAA +   ++  +LL +GA++ +    G TP+ +A KYG
Sbjct:  450 LHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYG 523          

HSP 9 Score: 50.447 bits (119), Expect = 3.844e-6
Identity = 27/78 (34.62%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKS 698
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   GH++
Sbjct:  317 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHEN 394          

HSP 10 Score: 49.6766 bits (117), Expect = 6.603e-6
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +E+ + L++ GA  N  T+ G + LHLA+ +   +++ LL+ + A I+L + +GLTP+ LA
Sbjct:  582 LHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLA 651          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 3.828e-12
Identity = 30/84 (35.71%), Postives = 57/84 (67.86%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +A+  GH++L  +L++ G+ V+ +TK G TALH+A+   ++E++ +L+ +GA+I+ +  NG TP+ +A++  H    R+L 
Sbjct:   68 ALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLL 151          

HSP 2 Score: 65.0846 bits (157), Expect = 1.129e-10
Identity = 32/83 (38.55%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  444 LQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            L ++    L +AS  GH ++ + L++ GA+VN  TK G TALHLAA +D+  + ++L+  GA++D +   G TP+ +A  YG+
Sbjct:  654 LTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGN 736          

HSP 3 Score: 59.6918 bits (143), Expect = 5.566e-9
Identity = 42/135 (31.11%), Postives = 72/135 (53.33%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKL-GRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQ---QRAKNMETKYLNPPMMAFQ 788
            T S+ +L   +    +Q ++    L IA+H G++ + + L+  GA V+++ +  G T LH+A+ +  + ++ LLL +G+ ID K  +GLTP+  A + GH +    L + R      R KN     L+P  MA Q
Sbjct:  206 TKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTA-VELLLERGAPILARTKN----GLSPLHMAAQ 335          

HSP 4 Score: 58.5362 bits (140), Expect = 1.328e-8
Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            L +AS RG+  +   L+  G++++  T+ G T LH AA       ++LLL +GA I  +  NGL+P+ +A +  H  C +HL   +
Sbjct:  264 LHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHK 349          

HSP 5 Score: 53.9138 bits (128), Expect = 3.388e-7
Identity = 27/80 (33.75%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  E+   L+K GA +N  ++ G T L++A+ ++  +++  LL  G N      +G TP+ +A + GH
Sbjct:   97 KGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGH 176          

HSP 6 Score: 52.373 bits (124), Expect = 1.146e-6
Identity = 27/80 (33.75%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R   AL +A+  G +E+   L++ GA V+   +  +T LH+A+   K+EI+ LLL   A+ D    NG TP+ ++ + G 
Sbjct:  459 RGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ 538          

HSP 7 Score: 51.9878 bits (123), Expect = 1.520e-6
Identity = 27/84 (32.14%), Postives = 45/84 (53.57%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GHL +   L++ GA  + S   G TALH+AA   + E++  LL  GA +D +     TP+ +A++ G
Sbjct:  421 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLG 504          

HSP 8 Score: 51.2174 bits (121), Expect = 2.655e-6
Identity = 28/73 (38.36%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L I++  G L++ S L++AGA  + +TK G T LH+A+     ++  LLL + A  D    NGLTP+ +A  Y
Sbjct:  530 LHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHY 602          

HSP 9 Score: 50.8322 bits (120), Expect = 3.645e-6
Identity = 27/70 (38.57%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  +E+ + L++  A+ N  TK G T LHLA+ +  S++  LLL KGA +++   +GLT + LA
Sbjct:  629 LHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLA 698          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 70.0922 bits (170), Expect = 3.837e-12
Identity = 33/90 (36.67%), Postives = 55/90 (61.11%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQ 734
            AL +AS  GH+E+ ++L+K GA V+ +TK G TALH+A+   +++++  L+  GAN++ +  NG TP+ +A +  H    R L      Q
Sbjct:   23 ALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQ 112          

HSP 2 Score: 60.4622 bits (145), Expect = 3.381e-9
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  LE+ + L++ GA+ N  T+ G + LHLAA +   +++ LLL K AN+++ + NGLTP+ LA
Sbjct:  589 LHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLA 658          

HSP 3 Score: 59.3066 bits (142), Expect = 7.995e-9
Identity = 32/81 (39.51%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            R   AL +A+  G  ++   L++ GAKV+   K  +TALH+A+   K+EI+ LLL KGA       +G TP+ LA + GH+
Sbjct:  419 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQ 499          

HSP 4 Score: 58.5362 bits (140), Expect = 1.485e-8
Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+  GA V++  +   T LH+AA +    ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  193 LHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHE 268          

HSP 5 Score: 56.6102 bits (135), Expect = 4.864e-8
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETKYLNPPM 776
            L +A+  G ++L S L+   A VN   K G T LHLAA +D+  + ++LL  GA +D     G TP+ +A  YG+      +  F  + +AK N +TK    P+
Sbjct:  622 LHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMK----MVSFLLENQAKINSKTKSGYTPL 721          

HSP 6 Score: 56.225 bits (134), Expect = 7.670e-8
Identity = 28/78 (35.90%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +A+ RG+  +   L+  GAK++  TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C
Sbjct:  226 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNC 303          

HSP 7 Score: 55.8398 bits (133), Expect = 8.358e-8
Identity = 28/80 (35.00%), Postives = 47/80 (58.75%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            + N AL IAS  G  ++  +L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  +   +G TP+ +A + GH
Sbjct:   52 KGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGH 131          

HSP 8 Score: 53.5286 bits (127), Expect = 5.069e-7
Identity = 32/87 (36.78%), Postives = 43/87 (49.43%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            AL IAS  G  E+   L++ GA  + +T  G T LHLA  +   E   LLL  GA++      G TP+ +A KYG     + L   R
Sbjct:  456 ALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR 542          

HSP 9 Score: 52.373 bits (124), Expect = 1.155e-6
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHL 713
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA++     +GLTP+ +A   GH++  + L
Sbjct:  324 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 406          

HSP 10 Score: 51.9878 bits (123), Expect = 1.655e-6
Identity = 28/77 (36.36%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKS 698
            L +A H G++++ S L++  AK+N  TK G T LH AA +  + II++LL   A+ +    NG T +++A + G+ S
Sbjct:  688 LHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYIS 764          

HSP 11 Score: 51.2174 bits (121), Expect = 2.841e-6
Identity = 30/73 (41.10%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +A   GH E  S L++ GA ++ +TK G T LH+AA   + E   LLL K A  D     GLTP+ +A  Y
Sbjct:  490 LHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHY 562          

HSP 12 Score: 50.447 bits (119), Expect = 5.000e-6
Identity = 25/84 (29.76%), Postives = 45/84 (53.57%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GH  +  +L   GA  N +   G TALH+AA   +++++  LL  GA +D+K  +  T + +A++ G
Sbjct:  381 QAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLG 464          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 67.781 bits (164), Expect = 1.623e-11
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++L+K GA V+ +TK G TALH+A+   +++++  L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   43 ALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 126          

HSP 2 Score: 58.5362 bits (140), Expect = 1.136e-8
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  LE+ + L++ GA+ N  T+ G + LHLAA +   +++ LLL K AN+++ + NGLTP+ LA
Sbjct:  609 LHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLA 678          

HSP 3 Score: 57.3806 bits (137), Expect = 3.251e-8
Identity = 32/81 (39.51%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            R   AL +A+  G  ++   L++ GAKV+   K  +TALH+A+   K+EI+ LLL KGA       +G TP+ LA + GH+
Sbjct:  439 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQ 519          

HSP 4 Score: 56.6102 bits (135), Expect = 4.549e-8
Identity = 28/76 (36.84%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+  GA V++  +   T LH+AA +    ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  213 LHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHE 288          

HSP 5 Score: 55.4546 bits (132), Expect = 1.142e-7
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETKYLNPPM 776
            L +A+  G ++L S L+   A VN   K G T LHLAA +D+  + ++LL  GA +D     G TP+ +A  YG+      +  F  + +AK N +TK    P+
Sbjct:  642 LHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMK----MVSFLLENQAKINSKTKSGYTPL 741          

HSP 6 Score: 54.299 bits (129), Expect = 2.543e-7
Identity = 28/78 (35.90%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +A+ RG+  +   L+  GAK++  TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C
Sbjct:  246 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNC 323          

HSP 7 Score: 53.9138 bits (128), Expect = 3.377e-7
Identity = 28/81 (34.57%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            ++ N AL IAS  G  ++  +L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  +   +G TP+ +A + GH
Sbjct:   71 KKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGH 151          

HSP 8 Score: 51.6026 bits (122), Expect = 1.966e-6
Identity = 32/87 (36.78%), Postives = 43/87 (49.43%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            AL IAS  G  E+   L++ GA  + +T  G T LHLA  +   E   LLL  GA++      G TP+ +A KYG     + L   R
Sbjct:  476 ALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR 562          

HSP 9 Score: 50.8322 bits (120), Expect = 3.377e-6
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHL 713
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA++     +GLTP+ +A   GH++  + L
Sbjct:  344 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 426          

HSP 10 Score: 50.447 bits (119), Expect = 3.711e-6
Identity = 28/77 (36.36%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKS 698
            L +A H G++++ S L++  AK+N  TK G T LH AA +  + II++LL   A+ +    NG T +++A + G+ S
Sbjct:  708 LHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYIS 784          

HSP 11 Score: 49.2914 bits (116), Expect = 9.378e-6
Identity = 30/73 (41.10%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +A   GH E  S L++ GA ++ +TK G T LH+AA   + E   LLL K A  D     GLTP+ +A  Y
Sbjct:  510 LHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHY 582          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 67.781 bits (164), Expect = 1.764e-11
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++L+K GA V+ +TK G TALH+A+   +++++  L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   79 ALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 162          

HSP 2 Score: 58.5362 bits (140), Expect = 1.291e-8
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLA 677
            L IA+ +  LE+ + L++ GA+ N  T+ G + LHLAA +   +++ LLL K AN+++ + NGLTP+ LA
Sbjct:  637 LHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLA 706          

HSP 3 Score: 57.3806 bits (137), Expect = 2.903e-8
Identity = 31/100 (31.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIALL-IASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            T S+ +L   +    ++ ++    L IA+H G++ + + L+  GA V++  +   T LH+AA +    ++ LLL +GA ID K  +GLTP+    + GH+
Sbjct:  217 TKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHE 316          

HSP 4 Score: 56.9954 bits (136), Expect = 3.825e-8
Identity = 32/81 (39.51%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            R   AL +A+  G  ++   L++ GAKV+   K  +TALH+A+   K+EI+ LLL KGA       +G TP+ LA + GH+
Sbjct:  467 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQ 547          

HSP 5 Score: 55.4546 bits (132), Expect = 1.223e-7
Identity = 36/104 (34.62%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK-NMETKYLNPPM 776
            L +A+  G ++L S L+   A VN   K G T LHLAA +D+  + ++LL  GA +D     G TP+ +A  YG+      +  F  + +AK N +TK    P+
Sbjct:  670 LHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMK----MVSFLLENQAKINSKTKSGYTPL 769          

HSP 6 Score: 54.299 bits (129), Expect = 3.018e-7
Identity = 28/78 (35.90%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSC 701
            L +A+ RG+  +   L+  GAK++  TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C
Sbjct:  274 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNC 351          

HSP 7 Score: 53.9138 bits (128), Expect = 3.974e-7
Identity = 28/81 (34.57%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            ++ N AL IAS  G  ++  +L+  GA VN  ++ G T L++AA ++  E++  LL  GA+  +   +G TP+ +A + GH
Sbjct:  107 KKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGH 187          

HSP 8 Score: 51.2174 bits (121), Expect = 2.142e-6
Identity = 32/87 (36.78%), Postives = 43/87 (49.43%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            AL IAS  G  E+   L++ GA  + +T  G T LHLA  +   E   LLL  GA++      G TP+ +A KYG     + L   R
Sbjct:  504 ALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR 590          

HSP 9 Score: 50.447 bits (119), Expect = 3.680e-6
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHL 713
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA++     +GLTP+ +A   GH++  + L
Sbjct:  372 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL 454          

HSP 10 Score: 50.447 bits (119), Expect = 4.407e-6
Identity = 28/77 (36.36%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKS 698
            L +A H G++++ S L++  AK+N  TK G T LH AA +  + II++LL   A+ +    NG T +++A + G+ S
Sbjct:  736 LHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYIS 812          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ANKRD60 (ankyrin repeat domain 60 [Source:HGNC Symbol;Acc:HGNC:16217])

HSP 1 Score: 130.954 bits (328), Expect = 6.233e-36
Identity = 75/199 (37.69%), Postives = 109/199 (54.77%), Query Frame = 3
Query:  102 LLPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWH--VWKELITTVVKNDIAKIFTMGVTQD---SDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANK 683
            L+ + E   L   +  T +R ++   EI  GIP+++Q L YLD+ DL D+AT+ S D V+ ATL + +W    W  L+T  ++ D  ++  +GVT D    DF TP +  L   +   W   RA +AL +A+HR H  L   L++ GA  + +T  GRTALH AAA    E +  LL  GA  D +D  GLT + LA +
Sbjct:    4 LVDSGELVDLPGCHRDTRVRQVKELLEITAGIPSDLQRLSYLDEGDLADEATLCSLDTVAGATLGVRVWQHDGWHRLVTAALRGD-PEVLRLGVTDDLSYGDFRTPHAARLSAADLSAWRSRRAFVALFVAAHRNHAGLVGLLLRHGASASATTPCGRTALHAAAASGSLEALHKLLRHGAPADARDAAGLTALELARR 201          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.143e-10
Identity = 30/76 (39.47%), Postives = 54/76 (71.05%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+++ ++L+K  A+++ +TK+G TALH+AA   +++I+ +L+  GANI+ +  NG TP+ +A +  H
Sbjct:   46 ALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENH 121          

HSP 2 Score: 60.4622 bits (145), Expect = 5.497e-10
Identity = 30/76 (39.47%), Postives = 50/76 (65.79%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L IA+H G++ + + L+  GA V+++ + G T LH+AA +  + ++ LLL +GA ID K  +GLTP+  A + GH+
Sbjct:  216 LHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHE 291          

HSP 3 Score: 54.6842 bits (130), Expect = 3.537e-8
Identity = 32/76 (42.11%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            L  AS  GH ++ S L++ GA ++  TK G T LH+A+   + E+  LLL K A+ D K  NGLTP+ +A  Y H+
Sbjct:  513 LYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQ 588          

HSP 4 Score: 53.9138 bits (128), Expect = 5.689e-8
Identity = 28/80 (35.00%), Postives = 48/80 (60.00%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R    L +AS  G LE+   L+++GA+V    +  +T LH+A+   K+EI+ LLL +G++ +    +G TP+  A++ GH
Sbjct:  442 RGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGH 521          

HSP 5 Score: 51.9878 bits (123), Expect = 2.286e-7
Identity = 33/105 (31.43%), Postives = 56/105 (53.33%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMA 782
            L +A+ RG+  +   L+  GAK++  T+ G T LH AA     ++I++LL + A I  K  NGL+P+ +A +  H +C +   +   Q    ++   YL P  +A
Sbjct:  249 LHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQ--LLLGRQAPVDDVTLDYLTPLHVA 351          

HSP 6 Score: 50.447 bits (119), Expect = 7.141e-7
Identity = 28/80 (35.00%), Postives = 47/80 (58.75%), Query Frame = 3
Query:  456 ANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
             N AL IA+  G  ++   L++ GA +N  ++ G T L++AA ++  EI+  LL  GAN  +   +G TP+ +A + GH+
Sbjct:   76 GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHE 155          

HSP 7 Score: 50.0618 bits (118), Expect = 1.062e-6
Identity = 30/94 (31.91%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNM 749
            L +A+H GH  +   L+  G + N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A+  GH +  + L        A N+
Sbjct:  348 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNV 441          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.374e-10
Identity = 30/76 (39.47%), Postives = 54/76 (71.05%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+++ ++L+K  A+++ +TK+G TALH+AA   +++I+ +L+  GANI+ +  NG TP+ +A +  H
Sbjct:   47 ALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENH 122          

HSP 2 Score: 60.8474 bits (146), Expect = 4.103e-10
Identity = 33/100 (33.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIA-LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            T ++ +L   E    +  ++    L IA+H G++ + + L+  GA V+++ + G T LH+AA +  + ++ LLL +GA ID K  +GLTP+  A + GH+
Sbjct:  185 TNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHE 284          

HSP 3 Score: 53.5286 bits (127), Expect = 7.354e-8
Identity = 28/80 (35.00%), Postives = 48/80 (60.00%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            R    L +AS  G LE+   L+++GA+V    +  +T LH+A+   K+EI+ LLL +G++ +    +G TP+  A++ GH
Sbjct:  435 RGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGH 514          

HSP 4 Score: 51.6026 bits (122), Expect = 2.957e-7
Identity = 33/105 (31.43%), Postives = 56/105 (53.33%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMA 782
            L +A+ RG+  +   L+  GAK++  T+ G T LH AA     ++I++LL + A I  K  NGL+P+ +A +  H +C +   +   Q    ++   YL P  +A
Sbjct:  242 LHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQ--LLLGRQAPVDDVTLDYLTPLHVA 344          

HSP 5 Score: 50.0618 bits (118), Expect = 8.854e-7
Identity = 28/80 (35.00%), Postives = 47/80 (58.75%), Query Frame = 3
Query:  456 ANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
             N AL IA+  G  ++   L++ GA +N  ++ G T L++AA ++  EI+  LL  GAN  +   +G TP+ +A + GH+
Sbjct:   77 GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHE 156          

HSP 6 Score: 50.0618 bits (118), Expect = 1.017e-6
Identity = 32/78 (41.03%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDC--NGLTPMTLANKYGHK 695
            L  AS  GH ++ S L++ GA ++  TK G T LH+A+   + E+  LLL K A+ D K    NGLTP+ +A  Y H+
Sbjct:  506 LYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQ 583          

HSP 7 Score: 49.6766 bits (117), Expect = 1.240e-6
Identity = 30/94 (31.91%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNM 749
            L +A+H GH  +   L+  G + N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A+  GH +  + L        A N+
Sbjct:  341 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNV 434          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007071.1 (pep scaffold:Pmarinus_7.0:GL486086:7043:13224:-1 gene:ENSPMAG00000006394.1 transcript:ENSPMAT00000007071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 2.473e-9
Identity = 33/79 (41.77%), Postives = 47/79 (59.49%), Query Frame = 3
Query:  489 GHLELCSKLIKAGAKVN---YSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            GH+ +   L++ GAKVN   Y T  G T+LH A  K   E++ LLL +GA ++ +D  G+TP+ LA +YG   C R L 
Sbjct:   58 GHVAVVKALLRNGAKVNGPQYWT--GWTSLHQATWKGHVELLQLLLERGARVEARDDYGITPLFLAAQYGQAPCLRILL 134          

HSP 2 Score: 47.7506 bits (112), Expect = 1.973e-6
Identity = 27/80 (33.75%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  477 ASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            A+ +GH+EL   L++ GA+V      G T L LAA   ++  + +LL  G +++ K  +  TP+ +A + GH  C R L 
Sbjct:   88 ATWKGHVELLQLLLERGARVEARDDYGITPLFLAAQYGQAPCLRILLQHGPDVNAKSKDWATPLFIAAQEGHTECLRLLL 167          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 3.169e-9
Identity = 30/85 (35.29%), Postives = 47/85 (55.29%), Query Frame = 3
Query:  459 NIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHL 713
            + AL IA+ +GH + C  +I  GA ++   K G T L LAA     +++ LL+  GA++D  D   +TP+  A + GH    R+L
Sbjct: 1171 DTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYL 1255          

HSP 2 Score: 56.9954 bits (136), Expect = 8.620e-9
Identity = 30/75 (40.00%), Postives = 44/75 (58.67%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            L+ A+  GHLEL   L+ AGA V+ +T  G TAL  A     +++ DLLL  GA+++ +   G TP+  A + GH
Sbjct:  434 LMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGH 508          

HSP 3 Score: 48.1358 bits (113), Expect = 4.343e-6
Identity = 27/82 (32.93%), Postives = 46/82 (56.10%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            +  + AL+ A   GH+E+   L+++GA+VN       + L LAA     E+  LL+ +GAN++  +  G TP+  A + GH+
Sbjct:  298 DEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHE 379          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 51.6026 bits (122), Expect = 2.483e-7
Identity = 36/122 (29.51%), Postives = 58/122 (47.54%), Query Frame = 3
Query:  372 GVTQDSDFATPSSEILFDKEKRQ----WLQERANIALLIASHRGHLELCSKLIKAGA-KVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCN--GLTPMTLANKYGHKSCERHLF 716
            G    S+ +  SS I   K  +Q    +        L IA  +G  ++  K+I+ G   +N     G TALH AA +   EI++LL+  GA++++K     G TP+  A+  GH    ++L 
Sbjct:  298 GSVSRSNDSNKSSHIAVSKRPKQKKGIYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLL 419          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 45.8246 bits (107), Expect = 9.740e-6
Identity = 25/89 (28.09%), Postives = 48/89 (53.93%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAK-VNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            + N  + +A  +GH +    L++   + +N+  + GR  +H+A   D  + + LL+  GA++ + D NG TP+ +  +YG  SC + L 
Sbjct:   74 KGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLL 162          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO32461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV01])

HSP 1 Score: 219.55 bits (558), Expect = 1.596e-68
Identity = 112/265 (42.26%), Postives = 158/265 (59.62%), Query Frame = 3
Query:  111 TNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIK-AGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKR 902
            T E F L  +Y    IR+L+S  E+  GIP+N+Q L YLD+ D++DD+ ++  D+V+NAT+ + +W  W  L+  V K DI K F   +    ++      +L+ K K     +RA +AL IA+HRG   L  KLI  A A VN  T  GR+ LH AA++  S  ID +L KGA+ID +D  G TP+ +A++ G K  ERHLF+F+WQ RA  M++K  N  +M  Q FDS  P W  G  +Q Y  + LPPGEF G+  +AP+R
Sbjct:    1 TGERFLLKKVYAEMKIRELKSYAELVAGIPSNLQRLQYLDEGDMLDDSDLRHNDVVANATVNLKLWRSWDSLVAAVCKGDIEKTFQQDIVISKEWEKLDP-VLY-KNKMSACSDRAGVALFIAAHRGQEGLIRKLIDDAKANVNMKTPFGRSPLHAAASQGHSSTIDTMLEKGADIDEEDTQGKTPLMVASQCGFKDSERHLFLFQWQTRAAKMKSKTENKSLMMHQQFDSQFPTWIRGGYAQMYFCQTLPPGEFAGTGFSAPRR 263          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO32452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV03])

HSP 1 Score: 111.309 bits (277), Expect = 6.033e-26
Identity = 69/226 (30.53%), Postives = 126/226 (55.75%), Query Frame = 3
Query:  105 LPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAKIFTMGVT--QDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLI-KAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR-----WQQRAKNMETK 758
            LPT +   L  +     +  L+S  E+ TGIP +IQ L++++K +L DDAT+   ++     + + M   ++ L     + D+ ++F  GV    +S+F   +  +       + + +RA  AL +ASHRG+L L  +L+ ++ A +N  T+ GRT+LH+AA +     + LLL +GA  +  D NG T ++LA++ GH  CER L++++     + ++  N+E++
Sbjct:   12 LPTEDVCTLRDLTTDMHVFQLKSRIELKTGIPGDIQRLHFMNK-ELYDDATLAKVNLKQGCIVRIKMDSNYESLFDACWRGDLYEVFQNGVQFLDESEFQGYNIALW-----NRLVVQRATHALFMASHRGYLGLVIELLNQSAADINGKTRFGRTSLHVAAYQGFVGCVSLLLSEGALCNQVDFNGKTALSLASENGHMYCERRLWLYQLSLNAFNEKRDNLESR 231          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO43344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ47])

HSP 1 Score: 95.1301 bits (235), Expect = 1.057e-20
Identity = 60/179 (33.52%), Postives = 95/179 (53.07%), Query Frame = 3
Query:  105 LPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAK------IFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKL--GRTALHLAAAKDKSEIIDLLL 617
             PT+E F +  + P   ++DL++  E+ TG+P ++  L YLD  DL DD  +   ++V  AT+ + +W  W  L+T   K D          F  GV   S   TP+   L     R++  E+A +AL IASHRGH+ + S+L+++G  V   TKL  GR+ LH A  + +   + +L+
Sbjct:  760 FPTDEKFTISRVCPGMTVKDLKNRIELETGVPRHLLRLRYLDGYDLTDDRRLSYYNMVPAATVQVLLWPEWVSLVTAACKGDYYGNQIGVFNFFRGVLA-SQIRTPAK--LGQNTPREF-NEKALVALYIASHRGHVNVVSRLVESG--VYPCTKLPSGRSPLHAAVNRKQITCVSILI 932          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO39766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S939])

HSP 1 Score: 58.151 bits (139), Expect = 4.325e-9
Identity = 29/72 (40.28%), Postives = 46/72 (63.89%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANK 683
            +L+AS+ GH ++   LIKAGA +N    +G TALHLA+   ++ ++ LLL   A++ + +  G TP  +ANK
Sbjct:   63 VLLASYFGHKDVVEILIKAGADINAQNGMGYTALHLASFTGRTAVVLLLLENNADVTIINGEGKTPSQVANK 134          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJZ9])

HSP 1 Score: 50.8322 bits (120), Expect = 4.224e-8
Identity = 30/84 (35.71%), Postives = 45/84 (53.57%), Query Frame = 3
Query:  462 IALLIASHRGHLELCSKLIKAGAKVNYSTKL------GRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            +AL  A   G  ++   LIK G+ +  +T +      GRTALH AA +   E+I LL+ +GA+I  +D  G TP+  A  +  K
Sbjct:    1 MALHYAVREGFADIARLLIKKGSNLEATTDMDAHDMFGRTALHYAAQQGHMEMIKLLVTRGADIHTRDSEGQTPLFQATIFDQK 84          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 1.493e-11
Identity = 32/76 (42.11%), Postives = 52/76 (68.42%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +AS  GH+E+ ++LIK GA V+ +TK G TALH+A+   ++E++  L+  GAN++ +  NG TP+ +A +  H
Sbjct:   53 ALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENH 128          

HSP 2 Score: 53.9138 bits (128), Expect = 1.941e-7
Identity = 29/100 (29.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIA-LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            T ++ +L   +    ++ ++    L IA+H G++ + + L+  GA V++  +   T LH+A+ +  S ++ LLL +G+ ID +  +GLTP+  A + GH+
Sbjct:  191 TKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHE 290          

HSP 3 Score: 53.1434 bits (126), Expect = 3.344e-7
Identity = 30/83 (36.14%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +AS RG+  +   L++ G+K++  TK G T LH AA     +++++LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  248 LHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 330          

HSP 4 Score: 50.0618 bits (118), Expect = 3.561e-6
Identity = 29/95 (30.53%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNM 749
            AL +A+H GH ++   ++   A  N     G T LH+A  K++ ++++LLL  GA+I     +GLTP+ +A   GH++    L  +       N+
Sbjct:  346 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGASPNTSNV 440          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 2.809e-11
Identity = 32/84 (38.10%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +AS  GH+E+ ++L+K GA V+ +TK G TALH+++   ++E++  L+  GAN++ +  NG TP+ +A +  H    R L 
Sbjct:   53 ALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLL 136          

HSP 2 Score: 51.6026 bits (122), Expect = 1.241e-6
Identity = 29/100 (29.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIA-LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            T ++ +L   +    ++ ++    L IA+H G++ + + L+   A V++  +   T LH+AA +  S ++ LLL +GA I+ K  +GLTP+    + GH+
Sbjct:  191 TKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHE 290          

HSP 3 Score: 49.6766 bits (117), Expect = 5.297e-6
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            L +A+ RG+  +   L+  GA++   TK G T LH  A     +++++LL +GA I  K  NGL+P+ +A +  H +C + L 
Sbjct:  248 LHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 330          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 65.855 bits (159), Expect = 7.557e-11
Identity = 31/84 (36.90%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +A+  GH++L  +L+  GA V+ STK G TALH+++   ++E++  L+ +GA+I+ +  NG TP+ +A +  H    R+L 
Sbjct:   68 ALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLL 151          

HSP 2 Score: 65.0846 bits (157), Expect = 1.326e-10
Identity = 31/74 (41.89%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            L +AS  GH ++ + L+  GA++N  TK G TALHLAA +D+  + ++L+  GAN+D +   G TP+ +A  YG
Sbjct:  659 LHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYG 732          

HSP 3 Score: 62.7734 bits (151), Expect = 6.179e-10
Identity = 32/101 (31.68%), Postives = 61/101 (60.40%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIA-LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKS 698
            T S+ +L   +    +Q ++    L IA+H G++ + + L+  GA V+++ + G T LH+A+ +  + ++ LLL +G+ ID K  +GLTP+  A + GH++
Sbjct:  206 TKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEA 306          

HSP 4 Score: 54.299 bits (129), Expect = 2.689e-7
Identity = 28/86 (32.56%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            L +AS RG+  +   L+  G++++  T+ G T LH AA       +++LL KGA +  +  NGL+P+ +A +  H  C +HL   +
Sbjct:  263 LHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK 348          

HSP 5 Score: 51.9878 bits (123), Expect = 1.318e-6
Identity = 27/81 (33.33%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            ++ N AL I+S  G  E+   L+K GA +N  ++ G T L++AA ++  +++  LL  G N      +G TP+ +A + GH
Sbjct:   96 KKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGH 176          

HSP 6 Score: 49.6766 bits (117), Expect = 6.623e-6
Identity = 26/84 (30.95%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GHL +   L++ GA  + S   G T+LH+AA   ++E++  LL  GA +D +     TP+ +A++ G
Sbjct:  418 QAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLG 501          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 65.4698 bits (158), Expect = 7.901e-11
Identity = 31/84 (36.90%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +A+  GH++L  +L+  GA V+ STK G TALH+++   ++E++  L+ +GA+I+ +  NG TP+ +A +  H    R+L 
Sbjct:   83 ALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLL 166          

HSP 2 Score: 64.6994 bits (156), Expect = 1.387e-10
Identity = 31/74 (41.89%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            L +AS  GH ++ + L+  GA++N  TK G TALHLAA +D+  + ++L+  GAN+D +   G TP+ +A  YG
Sbjct:  674 LHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYG 747          

HSP 3 Score: 62.7734 bits (151), Expect = 6.404e-10
Identity = 32/101 (31.68%), Postives = 61/101 (60.40%), Query Frame = 3
Query:  399 TPSSEILFDKEKRQWLQERANIA-LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKS 698
            T S+ +L   +    +Q ++    L IA+H G++ + + L+  GA V+++ + G T LH+A+ +  + ++ LLL +G+ ID K  +GLTP+  A + GH++
Sbjct:  221 TKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEA 321          

HSP 4 Score: 54.299 bits (129), Expect = 2.908e-7
Identity = 28/86 (32.56%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFR 725
            L +AS RG+  +   L+  G++++  T+ G T LH AA       +++LL KGA +  +  NGL+P+ +A +  H  C +HL   +
Sbjct:  278 LHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK 363          

HSP 5 Score: 51.9878 bits (123), Expect = 1.389e-6
Identity = 27/81 (33.33%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  450 ERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            ++ N AL I+S  G  E+   L+K GA +N  ++ G T L++AA ++  +++  LL  G N      +G TP+ +A + GH
Sbjct:  111 KKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGH 191          

HSP 6 Score: 49.6766 bits (117), Expect = 6.860e-6
Identity = 26/84 (30.95%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  438 QWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYG 689
            Q + E     + +A+  GHL +   L++ GA  + S   G T+LH+AA   ++E++  LL  GA +D +     TP+ +A++ G
Sbjct:  433 QAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLG 516          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd29 (ankyrin repeat domain 29 [Source:NCBI gene;Acc:101171068])

HSP 1 Score: 62.003 bits (149), Expect = 2.542e-10
Identity = 34/102 (33.33%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  411 EILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            E++       + +E  + AL  +S  G+ ++   L + GA   + TK G TAL +A     S+++DLLL  GAN+  +  +G TP+ LA + GH +  RHL 
Sbjct:   57 ELIMQGADINYQRETGSSALFFSSQHGYHDVVKLLFEFGASTEFQTKDGGTALTVACQYGHSKVVDLLLRNGANVHDQLNDGATPLFLAAQGGHVTVIRHLL 158          

HSP 2 Score: 57.7658 bits (138), Expect = 6.037e-9
Identity = 27/77 (35.06%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            AL++ASH GH +   +LI  GA +NY  + G +AL  ++     +++ LL   GA+ + +  +G T +T+A +YGH 
Sbjct:   42 ALMVASHGGHYDCVKELIMQGADINYQRETGSSALFFSSQHGYHDVVKLLFEFGASTEFQTKDGGTALTVACQYGHS 118          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000060742.1 (SMESG000060742.1)

HSP 1 Score: 912.909 bits (2358), Expect = 0.000e+0
Identity = 436/437 (99.77%), Postives = 436/437 (99.77%), Query Frame = 3
Query:  102 LLPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNEDNKEINKVEKFDQWLKQKTRQQKINEAIKKKKEDDQRTIEEEKRRQRIAKFKEIHGSEDVNDSIVTRGDLGDSVNRMGLTNKPVLDTKARIKELLMKYGLTDSDETPSTVYEQWLLQRKIMGKAVIDDNLSIYGGYLPYQQMIREFCSKKCH 1412
            LLPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELIT VVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNEDNKEINKVEKFDQWLKQKTRQQKINEAIKKKKEDDQRTIEEEKRRQRIAKFKEIHGSEDVNDSIVTRGDLGDSVNRMGLTNKPVLDTKARIKELLMKYGLTDSDETPSTVYEQWLLQRKIMGKAVIDDNLSIYGGYLPYQQMIREFCSKKCH
Sbjct:   15 LLPTNENFKLDLIYPSTFIRDLRSETEIATGIPANIQHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITAVVKNDIAKIFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLPKWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNEDNKEINKVEKFDQWLKQKTRQQKINEAIKKKKEDDQRTIEEEKRRQRIAKFKEIHGSEDVNDSIVTRGDLGDSVNRMGLTNKPVLDTKARIKELLMKYGLTDSDETPSTVYEQWLLQRKIMGKAVIDDNLSIYGGYLPYQQMIREFCSKKCH 451          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.246e-10
Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            LL ASH GH E+ S L+K  A+V+   + G TALHLAA K    + ++LLL  A ++ K   GLTP+ LA + G+K
Sbjct:  827 LLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYK 902          

HSP 2 Score: 51.6026 bits (122), Expect = 1.484e-6
Identity = 34/113 (30.09%), Postives = 52/113 (46.02%), Query Frame = 3
Query:  411 EILFDKEKRQWL--QERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK 743
            E+L DK K   L   +  N  + + S  GH E    L++ G  ++   K G   LH AA      ++  LL KGAN++ +  +  TP+ +A KYG+      L  +  Q   K
Sbjct:  515 ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK 627          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.283e-10
Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            LL ASH GH E+ S L+K  A+V+   + G TALHLAA K    + ++LLL  A ++ K   GLTP+ LA + G+K
Sbjct:  827 LLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYK 902          

HSP 2 Score: 51.6026 bits (122), Expect = 1.540e-6
Identity = 34/113 (30.09%), Postives = 52/113 (46.02%), Query Frame = 3
Query:  411 EILFDKEKRQWL--QERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK 743
            E+L DK K   L   +  N  + + S  GH E    L++ G  ++   K G   LH AA      ++  LL KGAN++ +  +  TP+ +A KYG+      L  +  Q   K
Sbjct:  515 ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK 627          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020706.1 (SMESG000020706.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.401e-10
Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            LL ASH GH E+ S L+K  A+V+   + G TALHLAA K    + ++LLL  A ++ K   GLTP+ LA + G+K
Sbjct:  827 LLFASHNGHHEIVSILLKNNARVDVFDEHGMTALHLAAEKGHKNVANVLLLHKAFVNAKSKGGLTPLHLAAQNGYK 902          

HSP 2 Score: 51.2174 bits (121), Expect = 1.724e-6
Identity = 34/113 (30.09%), Postives = 52/113 (46.02%), Query Frame = 3
Query:  411 EILFDKEKRQWL--QERANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAK 743
            E+L DK K   L   +  N  + + S  GH E    L++ G  ++   K G   LH AA      ++  LL KGAN++ +  +  TP+ +A KYG+      L  +  Q   K
Sbjct:  515 ELLIDKFKCNVLTRDKEGNTLMHVTSISGHPETTMSLLRRGVPLHMPNKTGSVCLHAAAQSGHVNVVKTLLDKGANVNARTKDLYTPLHIAVKYGNPGVVETLIGYGAQVNFK 627          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.212e-10
Identity = 28/76 (36.84%), Postives = 50/76 (65.79%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGH 692
            AL +A+  GH+ +  +LIK   +++ +TK G +ALH+A+   K E++ +L+  GAN++L+  NG TP+ +A +  H
Sbjct:   47 ALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENH 122          

HSP 2 Score: 62.3882 bits (150), Expect = 5.767e-10
Identity = 40/114 (35.09%), Postives = 58/114 (50.88%), Query Frame = 3
Query:  411 EILFDKEKRQWLQERANIALLIASHR-GHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNM 749
            ++L D       + R  +  L  S R GH +LC KLI  GA V   T+ G T+LH+AA  D  +   +LLLK ANI+    + LTP+ +   YG++   R L   R    A+ +
Sbjct:  256 QLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARAL 369          

HSP 3 Score: 61.2326 bits (147), Expect = 1.515e-9
Identity = 34/84 (40.48%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  465 ALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLF 716
            AL +A+  G  E  S L+ +GAK+   TK G T LH+AA  DK  +  +LL K AN +    NGLTP+ +A  Y H+   + L 
Sbjct:  506 ALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLL 589          

HSP 4 Score: 57.7658 bits (138), Expect = 1.735e-8
Identity = 30/73 (41.10%), Postives = 47/73 (64.38%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKY 686
            L +A+  G+LEL +  +++G+  N +T+   TALH+AA + +SE I LLL  GA I+ +   G TP+ +A KY
Sbjct:  474 LHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKY 546          

HSP 5 Score: 54.299 bits (129), Expect = 2.327e-7
Identity = 28/81 (34.57%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  453 RANIALLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHK 695
            + N AL IAS  G  E+   L++ GA VN  +  G T L++AA ++  E++  L+  GA+  +   +G TP+ +A + GH+
Sbjct:   76 KGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHE 156          

HSP 6 Score: 51.6026 bits (122), Expect = 1.241e-6
Identity = 31/107 (28.97%), Postives = 51/107 (47.66%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQ 788
            L +AS  GH ++ S L++  A VN+  K G T++HL A +DK  +  +L+  GA+I        TP+  A  +G  +  ++L     Q +          P  +A Q
Sbjct:  639 LQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQ 745          

HSP 7 Score: 49.6766 bits (117), Expect = 4.939e-6
Identity = 29/81 (35.80%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  468 LLIASHRGHLELCSKLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGLTPMTLANKYGHKS-CER 707
            L IA+H G+ +    LI+  A VN+  K   T LH+AA   +S ++ LL+  GA +  +  +GLTP+  + + GH   CE+
Sbjct:  210 LHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEK 290          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD605.371e-4036.41ankyrin repeat domain 60 [Source:HGNC Symbol;Acc:H... [more]
ANK31.346e-1139.47ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK33.466e-1136.90ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK24.979e-1135.71ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.022e-1135.71ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.488e-1136.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.488e-1136.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.547e-1136.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.547e-1136.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.564e-1136.90AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank25.654e-1238.10gene:FBgn0261788 transcript:FBtr0303125[more]
Ank26.266e-1238.10gene:FBgn0261788 transcript:FBtr0303123[more]
Ank26.418e-1236.67gene:FBgn0261788 transcript:FBtr0344224[more]
Ank26.420e-1238.10gene:FBgn0261788 transcript:FBtr0303117[more]
Ank26.593e-1238.10gene:FBgn0261788 transcript:FBtr0303121[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b1.129e-1239.29ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a1.629e-1239.29ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX469921.11.701e-1239.29ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a6.149e-1239.29ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a6.149e-1239.29ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031606.12.822e-5436.84ankyrin repeat domain 60 [Source:NCBI gene;Acc:100... [more]
tpm42.740e-1343.42tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.837e-1343.42tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm43.007e-1343.42tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm48.249e-1343.42tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd601.382e-3830.54ankyrin repeat domain 60 [Source:MGI Symbol;Acc:MG... [more]
Ankrd609.399e-2929.74ankyrin repeat domain 60 [Source:MGI Symbol;Acc:MG... [more]
Ank36.491e-1238.10ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank37.736e-1238.10ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank39.910e-1238.10ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BZ19|ANR60_HUMAN2.579e-3936.41Ankyrin repeat domain-containing protein 60 OS=Hom... [more]
sp|Q12955|ANK3_HUMAN6.465e-1139.47Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|O70511|ANK3_RAT6.813e-1138.10Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|G5E8K5|ANK3_MOUSE1.153e-1038.10Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q8C8R3|ANK2_MOUSE2.541e-1035.71Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GZ112.005e-10438.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GEP82.894e-10438.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DXX83.366e-10438.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3KBN01.390e-8849.13uncharacterized protein LOC106180414 OS=Lingula un... [more]
A0A1S3KGR02.192e-8748.78ankycorbin OS=Lingula unguis OX=7574 GN=LOC1061817... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b9.708e-1340.48ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ENSAMXT00000017800.23.828e-1235.71pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank3a3.837e-1236.67ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.623e-1138.10ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.764e-1138.10ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD606.233e-3637.69ankyrin repeat domain 60 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000000093.11.143e-1039.47pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.374e-1039.47pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007071.12.473e-941.77pep scaffold:Pmarinus_7.0:GL486086:7043:13224:-1 g... [more]
ENSPMAT00000002048.13.169e-935.29pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HOS42.483e-729.51Subunit of the Set3 complex; complex is a meiotic-... [more]
AVO29.740e-628.09Component of a complex containing the Tor2p kinase... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO324611.596e-6842.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324526.033e-2630.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433441.057e-2033.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397664.325e-940.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359874.224e-835.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040233.11.493e-1142.11pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
ENSORLT00000039903.12.809e-1138.10pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
ENSORLT00000039458.17.557e-1136.90ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.17.901e-1136.90ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ankrd292.542e-1033.33ankyrin repeat domain 29 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060742.10.000e+099.77SMESG000060742.1[more]
SMESG000020706.11.246e-1046.05SMESG000020706.1[more]
SMESG000020706.11.283e-1046.05SMESG000020706.1[more]
SMESG000020706.11.401e-1046.05SMESG000020706.1[more]
SMESG000000606.12.212e-1036.84SMESG000000606.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015384 ID=SMED30015384|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1448bp
CAACATGACTCGATGAGTTTAAATACGTTAAAGTTATTTATAAAATATTA
TAAAACACAATGAAAAATGTTAAAAAGAAACAAATAAATATCAACATTAA
TTTGTTACCAACGAATGAAAATTTTAAATTAGATTTAATCTATCCATCAA
CTTTCATTAGAGATCTTCGATCTGAGACAGAAATAGCAACAGGAATACCT
GCAAATATCCAACATTTGTATTATCTGGATAAATGCGATCTAGTCGATGA
CGCAACGATTCAGAGCTGTGATATTGTATCAAATGCCACTTTAACCATGG
ACATGTGGCACGTATGGAAGGAATTAATAACAACCGTTGTCAAAAATGAT
ATTGCCAAAATTTTCACTATGGGAGTAACTCAAGATTCTGATTTTGCTAC
TCCATCTTCAGAGATATTATTCGATAAAGAAAAGCGCCAGTGGTTACAGG
AGCGAGCAAATATTGCCTTACTAATTGCATCCCACAGGGGTCATTTAGAA
CTTTGCTCAAAATTGATTAAAGCAGGAGCTAAGGTCAATTATTCAACGAA
ACTCGGTAGAACCGCTCTGCACCTTGCAGCGGCGAAAGATAAAAGCGAAA
TAATAGATTTGTTATTACTAAAAGGAGCAAACATAGACCTAAAAGACTGC
AACGGTTTAACACCAATGACGCTGGCCAATAAATATGGACATAAAAGCTG
TGAAAGACATTTGTTTATGTTTCGCTGGCAGCAACGTGCTAAAAATATGG
AGACTAAATATCTTAATCCTCCAATGATGGCTTTTCAAATGTTTGATTCT
TCCTTACCAAAGTGGAAAACTGGACCAGCTTCACAATTTTACTGTGAAAA
ACTTTTGCCTCCTGGGGAATTCCTAGGTTCAGCTTTAAATGCACCGAAAC
GAAACTGGCATAGGCGTGGTTCAGCTCCTCCTAAAACAGAAGAAGTAACA
AATGAAGATAATAAAGAAATAAACAAAGTTGAAAAATTCGATCAATGGTT
GAAACAAAAAACGAGGCAGCAAAAAATAAATGAAGCTATCAAGAAAAAGA
AAGAAGACGATCAGCGAACAATTGAAGAAGAAAAACGCAGACAAAGAATA
GCAAAATTTAAAGAAATTCACGGATCGGAAGATGTGAACGATTCGATAGT
CACTCGTGGAGATTTAGGTGATTCTGTGAATCGAATGGGTTTAACAAATA
AGCCTGTGTTAGACACAAAAGCAAGGATAAAGGAATTGTTGATGAAATAC
GGGCTAACGGATTCCGACGAAACTCCGTCAACAGTTTACGAACAATGGTT
GTTACAGCGAAAAATTATGGGAAAAGCTGTGATTGATGACAACCTTTCAA
TTTATGGTGGATATTTACCCTATCAACAAATGATTCGAGAATTTTGTTCT
AAGAAATGTCATTAAATATAAATAAAATTTTTCTTGTGTTTAAAAAAA
back to top

protein sequence of SMED30015384-orf-1

>SMED30015384-orf-1 ID=SMED30015384-orf-1|Name=SMED30015384-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=452bp
MKNVKKKQINININLLPTNENFKLDLIYPSTFIRDLRSETEIATGIPANI
QHLYYLDKCDLVDDATIQSCDIVSNATLTMDMWHVWKELITTVVKNDIAK
IFTMGVTQDSDFATPSSEILFDKEKRQWLQERANIALLIASHRGHLELCS
KLIKAGAKVNYSTKLGRTALHLAAAKDKSEIIDLLLLKGANIDLKDCNGL
TPMTLANKYGHKSCERHLFMFRWQQRAKNMETKYLNPPMMAFQMFDSSLP
KWKTGPASQFYCEKLLPPGEFLGSALNAPKRNWHRRGSAPPKTEEVTNED
NKEINKVEKFDQWLKQKTRQQKINEAIKKKKEDDQRTIEEEKRRQRIAKF
KEIHGSEDVNDSIVTRGDLGDSVNRMGLTNKPVLDTKARIKELLMKYGLT
DSDETPSTVYEQWLLQRKIMGKAVIDDNLSIYGGYLPYQQMIREFCSKKC
H*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR039323ANKRD60
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0001085RNA polymerase II transcription factor binding
GO:0001105RNA polymerase II transcription coactivator activity
GO:0002039p53 binding
GO:0003677DNA binding
GO:0003714transcription corepressor activity
GO:0031432titin binding
GO:0042826histone deacetylase binding
GO:0070412R-SMAD binding
Vocabulary: cellular component
TermDefinition
GO:0001650fibrillar center
GO:0005634nucleus
GO:0005667transcription factor complex
GO:0005737cytoplasm
GO:0005829cytosol
GO:0030016myofibril
GO:0030017sarcomere
GO:0031674I band
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0035690cellular response to drug
GO:0035914skeletal muscle cell differentiation
GO:0035994response to muscle stretch
GO:0042692muscle cell differentiation
GO:0043065positive regulation of apoptotic process
GO:0043517positive regulation of DNA damage response, signal transduction by p53 class mediator
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0050714positive regulation of protein secretion
GO:0055008cardiac muscle tissue morphogenesis
GO:0071222cellular response to lipopolysaccharide
GO:0071260cellular response to mechanical stimulus
GO:0071347cellular response to interleukin-1
GO:0071356cellular response to tumor necrosis factor
GO:0071560cellular response to transforming growth factor beta stimulus
GO:1903507negative regulation of nucleic acid-templated transcription
GO:2000279negative regulation of DNA biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 324..344
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..82
e-value: 3.2E-7
score: 32.0
NoneNo IPR availableCDDcd17063Ubl_ANKRD60coord: 11..83
e-value: 2.71881E-19
score: 80.014
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 198..227
e-value: 4400.0
score: 0.2
coord: 165..194
e-value: 1.8E-4
score: 30.8
coord: 132..161
e-value: 2.2
score: 17.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 132..164
score: 8.736
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 165..197
score: 13.598
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 137..214
e-value: 2.4E-9
score: 37.7
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 132..219
score: 24.559
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 85..228
e-value: 1.8E-24
score: 88.3
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 134..223
IPR039323Ankyrin repeat domain-containing protein 60PANTHERPTHR22677FAMILY NOT NAMEDcoord: 13..362
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 8..80