RING-CH-type domain-containing protein

Overview
NameRING-CH-type domain-containing protein
Smed IDSMED30015368
Length (bp)827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-CH-type domain-containing protein (SMED30015368) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-CH-type domain-containing protein (SMED30015368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-CH-type domain-containing protein (SMED30015368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-CH-type domain-containing protein (SMED30015368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:HGNC Symbol;Acc:HGNC:28728])

HSP 1 Score: 67.3958 bits (163), Expect = 1.349e-12
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL        N      +R  +   +VC   +  +  I  W 
Sbjct:   71 CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWL-------RNPGPQHEKRT-LFGDMVCFLFITPLATISGWL 165          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF2 (membrane associated ring-CH-type finger 2 [Source:HGNC Symbol;Acc:HGNC:28038])

HSP 1 Score: 65.4698 bits (158), Expect = 5.913e-12
Identity = 31/105 (29.52%), Postives = 52/105 (49.52%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLI 447
            CR+C +  +   L+SPC C G++G +HK+CLEKWL+++    CE+C  EF V       + WL     P   ++  ++        +VC   +  +  I  W  +
Sbjct:   64 CRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKD---PGPRTEKRTL-----CCDMVCFLFITPLAAISGWLCL 160          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF2 (membrane associated ring-CH-type finger 2 [Source:HGNC Symbol;Acc:HGNC:28038])

HSP 1 Score: 65.4698 bits (158), Expect = 5.913e-12
Identity = 31/105 (29.52%), Postives = 52/105 (49.52%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLI 447
            CR+C +  +   L+SPC C G++G +HK+CLEKWL+++    CE+C  EF V       + WL     P   ++  ++        +VC   +  +  I  W  +
Sbjct:   64 CRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKD---PGPRTEKRTL-----CCDMVCFLFITPLAAISGWLCL 160          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:HGNC Symbol;Acc:HGNC:28728])

HSP 1 Score: 63.1586 bits (152), Expect = 7.438e-12
Identity = 24/52 (46.15%), Postives = 35/52 (67.31%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFV 288
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V
Sbjct:   71 CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAV 122          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Match: MARCHF2 (membrane associated ring-CH-type finger 2 [Source:HGNC Symbol;Acc:HGNC:28038])

HSP 1 Score: 60.4622 bits (145), Expect = 1.277e-10
Identity = 24/52 (46.15%), Postives = 36/52 (69.23%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFV 288
            CR+C +  +   L+SPC C G++G +HK+CLEKWL+++    CE+C  EF V
Sbjct:   64 CRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAV 115          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Match: marc-3 (MARCH (Membrane-Associated Ring finger (C3HC4)) homolog [Source:UniProtKB/TrEMBL;Acc:Q93227])

HSP 1 Score: 55.8398 bits (133), Expect = 1.018e-8
Identity = 37/123 (30.08%), Postives = 56/123 (45.53%), Query Frame = 1
Query:  169 LISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQ-----NNSTIEESSTLEI 522
            LISPC C G++G+ H++CLE WLT      CEIC F F +   + +F  ++    +    S+ N          I   FVLL IL    + + +S        R+      N   +E+  LE+
Sbjct:   34 LISPCKCSGTMGLFHRSCLEHWLTLTSTTNCEICKFAFKIKQKSRNFIDYIRQGGYKKLQSNRNPF--------IDFAFVLL-ILPFAFFGVFMSVEGALYAGRKYHYAFENRDNDENGNLEV 147          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Match: marc-1 (MARCH (Membrane-Associated Ring finger (C3HC4)) homolog [Source:UniProtKB/TrEMBL;Acc:B2D6L6])

HSP 1 Score: 51.2174 bits (121), Expect = 1.523e-7
Identity = 20/50 (40.00%), Postives = 30/50 (60.00%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEF 282
            CR+C      GD++ PC C G++G +H+ CL KW+  +    CEIC  E+
Sbjct:   52 CRIC--QMHEGDMVRPCDCAGTMGDVHEECLTKWVNMSNKKTCEICKSEY 99          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Match: marc-2 (MARCH (Membrane-Associated Ring finger (C3HC4)) homolog [Source:UniProtKB/TrEMBL;Acc:Q18997])

HSP 1 Score: 48.1358 bits (113), Expect = 1.532e-6
Identity = 21/55 (38.18%), Postives = 31/55 (56.36%), Query Frame = 1
Query:  109 RLSSLSFKCRVCLDSCDMGD-LISPCFCKGSIGVIHKNCLEKWLTAARIGQCEIC 270
             +S+ +  CR+C D+    D LI PC C G++  +H  CLE+W+      QC IC
Sbjct:   17 EVSTKTVICRICFDNDTSSDSLIKPCSCSGTVAYVHNGCLEQWVRTTSNIQCTIC 71          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Match: marc-6 (MARCH (Membrane-Associated Ring finger (C3HC4)) homolog [Source:UniProtKB/TrEMBL;Acc:Q400N4])

HSP 1 Score: 49.2914 bits (116), Expect = 1.672e-6
Identity = 20/50 (40.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEF 282
            CRVC    + G L  PC C GSI  +H+ CL +WL  ++   CE+C  ++
Sbjct:   53 CRVC--RGNEGSLYYPCLCTGSIKYVHQECLVEWLKYSKKEVCELCNHKY 100          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Match: CG4080 (gene:FBgn0035983 transcript:FBtr0309506)

HSP 1 Score: 65.0846 bits (157), Expect = 1.186e-11
Identity = 26/65 (40.00%), Postives = 40/65 (61.54%), Query Frame = 1
Query:  133 CRVCL-DSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLS 324
            CR+C  +S     L++PC+C GS+  +H+ CL++WLTA+    CE+C F F + T    F+ W S
Sbjct:   43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEWRS 107          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Match: CG4080 (gene:FBgn0035983 transcript:FBtr0076494)

HSP 1 Score: 65.0846 bits (157), Expect = 1.186e-11
Identity = 26/65 (40.00%), Postives = 40/65 (61.54%), Query Frame = 1
Query:  133 CRVCL-DSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLS 324
            CR+C  +S     L++PC+C GS+  +H+ CL++WLTA+    CE+C F F + T    F+ W S
Sbjct:   43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEWRS 107          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Match: CG13442 (gene:FBgn0034546 transcript:FBtr0086240)

HSP 1 Score: 62.3882 bits (150), Expect = 8.808e-11
Identity = 26/73 (35.62%), Postives = 47/73 (64.38%), Query Frame = 1
Query:   64 VNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEF 282
            +N++ +S+++ P     S  S  CR+C ++ +   L+SPC CKGS+  +H +CLE W++ +R   CE+C F++
Sbjct:  149 LNYESASNESMP-----SVGSLVCRICHNADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQY 216          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Match: CG17717 (gene:FBgn0029877 transcript:FBtr0070944)

HSP 1 Score: 53.5286 bits (127), Expect = 4.765e-8
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  133 CRVCL-DSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWL 321
            CR+C  +  DM  +  PC CKGS+G IH  CL++W+   R  +CEIC   F ++   AS  + +
Sbjct:   91 CRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEICNAVFNIAEERASLKQMI 154          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: zgc:158785 (zgc:158785 [Source:ZFIN;Acc:ZDB-GENE-070112-1712])

HSP 1 Score: 75.0998 bits (183), Expect = 1.173e-15
Identity = 33/105 (31.43%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLI 447
            CR+C +    GDL+SPC C GS+ ++H+ CLE+WLTA+    CE+C F++ +      F+ WLS        + S   QR  +   ++C   +  +  +  W  +
Sbjct:   50 CRICHEDSAAGDLLSPCECAGSLAMVHRVCLEQWLTASGTSSCELCHFQYALERLPKPFTEWLS--------APSMQQQRRTLCGDVICFLFITPLASLSGWLCV 146          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: march2 (membrane-associated ring finger (C3HC4) 2 [Source:NCBI gene;Acc:555611])

HSP 1 Score: 65.4698 bits (158), Expect = 4.774e-12
Identity = 32/108 (29.63%), Postives = 53/108 (49.07%), Query Frame = 1
Query:  133 CRVC---LDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLI 447
            CR+C    D C+   L+SPC C G++G +HK+CLEKWL+++    CE+C  EF +       + WL     P   ++  ++        +VC   +  +  I  W  +
Sbjct:   64 CRICHEGQDVCNSEGLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTIERRPRPLTEWLRD---PGPRNEKRTL-----FCDMVCFLFITPLAAISGWLCL 163          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: CR392032.1 (membrane-associated ring finger (C3HC4) 11 [Source:NCBI gene;Acc:798174])

HSP 1 Score: 58.5362 bits (140), Expect = 1.801e-9
Identity = 35/126 (27.78%), Postives = 62/126 (49.21%), Query Frame = 1
Query:   76 QSSSQTEPIGARLSSLS----FKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEF-FVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIW 438
            QS+ +TE +G+  S+ S      CR+C    + G+L+SPC C GS+   H+ CL KW++      CE+C + F  +  +  S  +W   T           ++++ V++  +    LLA +   +W
Sbjct:   84 QSAVKTETVGSSCSNESCIPTPGCRICFQGAEQGELLSPCRCAGSVRHAHQQCLLKWISEKGSWSCELCNYRFNILPIHIKSPQQWQRVTM--------TLVEKVQVIAVFLGGLFLLASVSWLLW 201          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: march11 (membrane-associated ring finger (C3HC4) 11 [Source:ZFIN;Acc:ZDB-GENE-070912-276])

HSP 1 Score: 57.7658 bits (138), Expect = 2.783e-9
Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 1
Query:   76 QSSSQTEPIGARLSSLS----FKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFV 288
            QS+ +TE +G+  S+ S      CR+C    + G+L+SPC C GS+   H+ CL KW++      CE+C + F +
Sbjct:   84 QSAVKTETVGSSCSNESCVPTPGCRICFQGAEQGELLSPCRCAGSVRHAHQQCLLKWISEKGSWSCELCNYRFNI 158          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Match: march8 (membrane-associated ring finger (C3HC4) 8 [Source:ZFIN;Acc:ZDB-GENE-080204-8])

HSP 1 Score: 54.6842 bits (130), Expect = 6.852e-9
Identity = 21/63 (33.33%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  133 CRVC-LDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRW 318
            CR+C  +  D   LI+PC C GS+  +H+ CL++W+ ++    CE+C ++F + T      +W
Sbjct:   53 CRICHCEGDDESPLITPCHCTGSLRFVHQACLQQWIKSSDTRCCELCKYDFIMETKLKPLRKW 115          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: march3 (membrane associated ring-CH-type finger 3 [Source:NCBI gene;Acc:493225])

HSP 1 Score: 67.0106 bits (162), Expect = 1.664e-12
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL        N      +R  +   +VC   +  +  I  W 
Sbjct:   69 CRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFSVERKPRPLVEWL-------RNPGPQHEKRT-LFGDMVCFLFITPLATISGWL 163          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: march3 (membrane associated ring-CH-type finger 3 [Source:NCBI gene;Acc:493225])

HSP 1 Score: 67.0106 bits (162), Expect = 1.700e-12
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL        N      +R  +   +VC   +  +  I  W 
Sbjct:   70 CRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFSVERKPRPLVEWL-------RNPGPQHEKRT-LFGDMVCFLFITPLATISGWL 164          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: marchf2 (membrane associated ring-CH-type finger 2 [Source:NCBI gene;Acc:549760])

HSP 1 Score: 65.0846 bits (157), Expect = 9.184e-12
Identity = 31/103 (30.10%), Postives = 50/103 (48.54%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +  +   L+SPC C G++G +HK CLEKWL+++    CE+C  EF V       + WL     P   ++  ++        +VC   +  +  I  W 
Sbjct:   76 CRICHEGGNGERLLSPCDCTGTLGTVHKTCLEKWLSSSNTSYCELCHTEFAVERRPRPVTEWLKD---PGPRNEKRTL-----FCDMVCFLFITPLAAISGWL 170          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: faf1 (Fas (TNFRSF6) associated factor 1 [Source:Xenbase;Acc:XB-GENE-940895])

HSP 1 Score: 58.151 bits (139), Expect = 2.350e-9
Identity = 23/63 (36.51%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  133 CRVC-LDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRW 318
            CR+C  +  D   LI+PC C GS+  +H+ CL++W+ ++    CE+C FEF + T      +W
Sbjct:   57 CRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKFEFIMETKLKPLRKW 119          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Match: faf1 (Fas (TNFRSF6) associated factor 1 [Source:Xenbase;Acc:XB-GENE-940895])

HSP 1 Score: 58.5362 bits (140), Expect = 2.693e-9
Identity = 23/63 (36.51%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  133 CRVCL-DSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRW 318
            CR+C  +  D   LI+PC C GS+  +H+ CL++W+ ++    CE+C FEF + T      +W
Sbjct:  117 CRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKFEFIMETKLKPLRKW 179          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March2 (membrane-associated ring finger (C3HC4) 2 [Source:MGI Symbol;Acc:MGI:1925915])

HSP 1 Score: 67.3958 bits (163), Expect = 2.828e-13
Identity = 26/64 (40.62%), Postives = 40/64 (62.50%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLS 324
            CR+C +  +  +L+SPC C G++G +HK+CLEKWL+++    CE+C  EF V       + WL 
Sbjct:    3 CRICHEGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLK 66          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March3 (membrane-associated ring finger (C3HC4) 3 [Source:MGI Symbol;Acc:MGI:2443667])

HSP 1 Score: 67.3958 bits (163), Expect = 5.446e-13
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL        N      +R  +   +VC   +  +  I  W 
Sbjct:   71 CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWL-------RNPGPQHEKRT-LFGDMVCFLFITPLATISGWL 165          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March3 (membrane-associated ring finger (C3HC4) 3 [Source:MGI Symbol;Acc:MGI:2443667])

HSP 1 Score: 67.3958 bits (163), Expect = 8.904e-13
Identity = 31/103 (30.10%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL     P    +  ++        +VC   +  +  I  W 
Sbjct:   71 CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRN---PGPQHEKRTL-----FGDMVCFLFITPLATISGWL 165          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March2 (membrane-associated ring finger (C3HC4) 2 [Source:MGI Symbol;Acc:MGI:1925915])

HSP 1 Score: 67.781 bits (164), Expect = 9.121e-13
Identity = 33/117 (28.21%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF-LILSNNNVTMETR 480
            CR+C +  +  +L+SPC C G++G +HK+CLEKWL+++    CE+C  EF V       + WL     P   ++  ++        +VC   +  +  I  W  L  + +++ + +R
Sbjct:   64 CRICHEGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKD---PGPRTEKRTL-----CCDMVCFVFITPLAAISGWLCLRGAQDHLRLHSR 172          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Match: March2 (membrane-associated ring finger (C3HC4) 2 [Source:MGI Symbol;Acc:MGI:1925915])

HSP 1 Score: 67.781 bits (164), Expect = 9.121e-13
Identity = 33/117 (28.21%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF-LILSNNNVTMETR 480
            CR+C +  +  +L+SPC C G++G +HK+CLEKWL+++    CE+C  EF V       + WL     P   ++  ++        +VC   +  +  I  W  L  + +++ + +R
Sbjct:   64 CRICHEGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKD---PGPRTEKRTL-----CCDMVCFVFITPLAAISGWLCLRGAQDHLRLHSR 172          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q32L65|MARH2_BOVIN (E3 ubiquitin-protein ligase MARCHF2 OS=Bos taurus OX=9913 GN=MARCHF2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.796e-12
Identity = 31/105 (29.52%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLI 447
            CR+C +  +   L+SPC C G++G +HK+CLE+WL+++    CE+C  EF V   + S + WL     P   ++  ++        +VC   +  +  I  W  +
Sbjct:   64 CRICHEGANGESLLSPCGCSGTLGAVHKSCLERWLSSSNTSYCELCHTEFAVEKRSRSLTEWLKD---PGPRTEKRTL-----CCDVVCFLFITPLAAISGWLCL 160          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BRX9|MARH3_MOUSE (E3 ubiquitin-protein ligase MARCHF3 OS=Mus musculus OX=10090 GN=Marchf3 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.809e-12
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL        N      +R  +   +VC   +  +  I  W 
Sbjct:   71 CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWL-------RNPGPQHEKRT-LFGDMVCFLFITPLATISGWL 165          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86UD3|MARH3_HUMAN (E3 ubiquitin-protein ligase MARCHF3 OS=Homo sapiens OX=9606 GN=MARCHF3 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.476e-12
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL        N      +R  +   +VC   +  +  I  W 
Sbjct:   71 CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWL-------RNPGPQHEKRT-LFGDMVCFLFITPLATISGWL 165          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A0JN69|MARH3_BOVIN (E3 ubiquitin-protein ligase MARCHF3 OS=Bos taurus OX=9913 GN=MARCHF3 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.476e-12
Identity = 32/103 (31.07%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL        N      +R  +   +VC   +  +  I  W 
Sbjct:   71 CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWL-------RNPGPQHEKRT-LFGDMVCFLFITPLATISGWL 165          
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XIE5|MARH3_RAT (E3 ubiquitin-protein ligase MARCHF3 OS=Rattus norvegicus OX=10116 GN=Marchf3 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.800e-12
Identity = 31/103 (30.10%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +     DL+SPC C G++G IH++CLE WL+++    CE+C F F V         WL     P    +  ++        +VC   +  +  I  W 
Sbjct:   71 CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRN---PGPQHEKRTL-----FGDMVCFLFITPLATISGWL 165          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A4Z2DMP7 (E3 ubiquitin-protein ligase MARCH2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010900 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.224e-21
Identity = 65/204 (31.86%), Postives = 106/204 (51.96%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIXXXXXXXXXXXXXXXXXWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPAL 744
            CR+CL S D  DLISPC C G+IG++H+ CLEKWL  +R+  CEICG++F +  +   FS+WL             S +R  + + ++CL ++L +L +C W  I SN    +           S+T      +F L  L +LL++V  +W + ++R++++SWK ++        ++Q  + LS  I   +     F    P L
Sbjct:   50 CRICLGSTDFEDLISPCHCTGTIGIVHQRCLEKWLNLSRLRTCEICGYKFEILKSYPRFSKWLW-----MGGKGDGSHRRRHLWTDLICLIIMLPLLTLCAWLAISSNQEEDI-----------SNTKRFPWQSFFLGSLCSLLLLVFNIWLMFSLRYHHQSWKLWR--------TEQCYIVLSESIKKKKVMNTKFSPNNPNL 229          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A183QQI8 (RING-CH-type domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.190e-15
Identity = 39/92 (42.39%), Postives = 54/92 (58.70%), Query Frame = 1
Query:  109 RLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVL 384
            R++     CR+CL S D  +LISPC+C G+IG++H+ CLEKWL  +R   CEICGF F VS +   F +      F FS    + I+ I + 
Sbjct:   17 RINGDVIYCRICLGSSDFEELISPCYCAGTIGIVHQRCLEKWLNLSRSRACEICGFTFEVSKHYPHFCK------FSFSMCPLDRIKYISIF 102          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A183MHG1 (RING-CH-type domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS15486 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.043e-14
Identity = 39/91 (42.86%), Postives = 53/91 (58.24%), Query Frame = 1
Query:   79 SSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSR--WLSGTFFPFS 345
            S      +  R+ +    CR+CL S D  +LISPC+C G+IG++H+ CLEKWL  +R   CEICGF F V  +   F +  +LS  F  FS
Sbjct:   24 SVCHKHDVFLRIKNDVIYCRICLGSSDFEELISPCYCAGTIGIVHQRCLEKWLNLSRSKTCEICGFTFEVLKHYPHFCKVCFLSNYFDEFS 114          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A553NCR9 (RING-CH-type domain-containing protein OS=Tigriopus californicus OX=6832 GN=TCAL_00377 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.099e-14
Identity = 46/133 (34.59%), Postives = 67/133 (50.38%), Query Frame = 1
Query:   64 VNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNN 462
            VN  Q S+ +  I          CR+C +   +  LISPC C GS+G IH+ CLEKWL+      CE+CG +F V  N  S +RWL  +  PFS++  N      ++   +C F+L  +  I  +  +L   N
Sbjct:    8 VNISQGSTVSHVI----------CRICHEGDRLIPLISPCACSGSVGTIHQVCLEKWLSTVNKDDCELCGRKFLVHKNPKSITRWLLRS--PFSDAHRN------IIGDTICFFILTPMSLISAYLCVLGAVN 122          
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Match: A0A4S2LI31 (RING-CH-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007031 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.297e-14
Identity = 64/194 (32.99%), Postives = 105/194 (54.12%), Query Frame = 1
Query:  112 LSSLSFKCRVCLDSCDM-GDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNS---------DSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIXXXXXXXXXXXXXXXXXWAILAIRHNYRSWKR---YQMRCSRID 654
            LS   F+CR+CLD  ++ G L+SPC CKG++G++H+NCL++WL  +   +CE+CG+E+ +   T S  R L     P S +          SN+ +R  +L+ I+CL +L     I ++F I+      ME    N    ++  L +         L  LL+++ T W ILAIRH+  +++R   YQ +  R++
Sbjct:  295 LSFNQFRCRICLDEGELEGPLMSPCRCKGTVGLVHRNCLQRWLYESGKVKCELCGYEYIM---TPSRRRSLPTFTRPRSYTRLDLFCAWIRSNTTRRH-LLADIICLVLLTPSTYIGVYFCIVGAMGFAME----NPFAWQAIGLWL---------LAILLIILLTSWMILAIRHHLSTFQRHMYYQRQRERLE 471          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055541.1 (E3 ubiquitin-protein ligase MARCH3-like [Source:NCBI gene;Acc:103046723])

HSP 1 Score: 78.1814 bits (191), Expect = 1.059e-16
Identity = 34/105 (32.38%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLI 447
            CR+C +    GDL+SPC C G++ ++H+ CLE WLTA+    CE+C FEF +      F+ WL+          + S+QR  +   I+C   +  +  +  W  +
Sbjct:   64 CRICHEGLSAGDLLSPCECAGTLAMVHRVCLEHWLTASGTSHCELCHFEFALERLPKPFTEWLA----------TPSMQRRTLCGDIICFLFITPLASLSGWLCV 158          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036351.1 (E3 ubiquitin-protein ligase MARCH3-like [Source:NCBI gene;Acc:103046723])

HSP 1 Score: 77.0258 bits (188), Expect = 1.563e-16
Identity = 37/121 (30.58%), Postives = 61/121 (50.41%), Query Frame = 1
Query:   85 SQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLI 447
            S T+ +   L+     CR+C +    GDL+SPC C G++ ++H+ CLE WLTA+    CE+C FEF +      F+ WL+          + S+QR  +   I+C   +  +  +  W  +
Sbjct:   27 SLTQSVSLSLNGEEPFCRICHEGLSAGDLLSPCECAGTLAMVHRVCLEHWLTASGTSHCELCHFEFALERLPKPFTEWLA----------TPSMQRRTLCGDIICFLFITPLASLSGWLCV 137          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:NCBI gene;Acc:103035346])

HSP 1 Score: 67.3958 bits (163), Expect = 9.069e-13
Identity = 32/103 (31.07%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C D     +L+SPC C G++G IH++CLE WL+A+    CE+C ++F V         WL        N   +  +R  +   +VC  ++  +  I  W 
Sbjct:   86 CRICHDGGGQEELLSPCECAGTLGTIHRSCLEHWLSASSTSFCELCHYQFSVQRKARPLLEWL-------RNPGLHQEKRT-LFGDMVCFLLITPLATISGWL 180          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: march2 (membrane associated ring-CH-type finger 2 [Source:NCBI gene;Acc:103021975])

HSP 1 Score: 65.4698 bits (158), Expect = 3.761e-12
Identity = 30/103 (29.13%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            CR+C +  +   L+SPC C G++G +HK+CLEKWL+++    CE+C  EF +       + WL     P   ++  ++        +VC   +  +  I  W 
Sbjct:   64 CRICHEGGNSEGLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTIERRPRPLTEWLRD---PGPRNEKRTL-----FCDMVCFLFITPLAAISGWL 158          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Match: march8 (membrane-associated ring finger (C3HC4) 8 [Source:ZFIN;Acc:ZDB-GENE-080204-8])

HSP 1 Score: 56.225 bits (134), Expect = 9.320e-9
Identity = 23/63 (36.51%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  133 CRVC-LDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRW 318
            CR+C  +  D   LI+PC C GS+  +H+ CL++W+ ++    CE+C FEF + T      +W
Sbjct:  187 CRICHCEGDDESPLITPCHCTGSLRFVHQACLQQWIKSSDTRCCELCKFEFIMETKLKPLRKW 249          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:HGNC Symbol;Acc:HGNC:28728])

HSP 1 Score: 77.0258 bits (188), Expect = 2.552e-17
Identity = 47/185 (25.41%), Postives = 85/185 (45.95%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIXXXXXXXXXXXXXXXXXWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSA 687
            CR+C +     +L+SPC C G++G +H++CLE WL A+    CE+C F+F V       ++WL         + S   +R  +LS  +C   +  + GI  W L L      +E+  N S +E +  + +             L+ +   W  +++R++ R ++ ++    R+ L       L A
Sbjct:   11 CRICHEGSAQEELLSPCECTGTLGWVHRSCLEHWLAASNTSYCELCHFQFLVERKPQPLTQWL--------RNPSPKQERRTLLSDTLCFLFITPLAGISGW-LCLRGAADHLES-GNRSQLEAAGLIGL----------TVALLTIYLFWTAVSVRYHIRLYQEWRKTHHRVKLLTPRPTGLPA 175          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: MARCHF3 (membrane associated ring-CH-type finger 3 [Source:HGNC Symbol;Acc:HGNC:28728])

HSP 1 Score: 77.0258 bits (188), Expect = 2.896e-17
Identity = 37/115 (32.17%), Postives = 61/115 (53.04%), Query Frame = 1
Query:  100 IGARLSSL-SFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF 441
            +  R++S+ S  CR+C ++    +L+SPC C G++G +H+ CLE+WL A+    CE+C F+F V      FS+WL           S   +R  +LS  +C   +  + G+  W 
Sbjct:   20 VAERVASVESPFCRICHEAGSAEELLSPCECMGTLGWVHRACLERWLAASNTSYCELCHFQFLVERTPQPFSQWL--------RRPSPKQERRTLLSDTLCFLFISPLAGVSGWL 126          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: march8 (membrane-associated ring finger (C3HC4) 8 [Source:ZFIN;Acc:ZDB-GENE-080204-8])

HSP 1 Score: 49.6766 bits (117), Expect = 1.866e-7
Identity = 17/54 (31.48%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  157 DMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRW 318
            + G L +PC C GS+  +H+ CL++W+ ++    CE+C + F + T      +W
Sbjct:   29 EEGPLTAPCQCTGSLQFVHQACLQQWIKSSGASCCELCNYSFVMETTLKPLRKW 82          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: MARCHF4 (membrane associated ring-CH-type finger 4 [Source:HGNC Symbol;Acc:HGNC:29269])

HSP 1 Score: 46.595 bits (109), Expect = 1.665e-6
Identity = 24/88 (27.27%), Postives = 45/88 (51.14%), Query Frame = 1
Query:  163 GDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFV-STNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAIL 423
            G+L++PC C GS+   H+ CL  W++      CE+C ++F V   NT   ++W   +  P     + ++        + CLF+L +++
Sbjct:    4 GELLNPCRCNGSVRWTHQPCLLTWISERGSWSCELCYYKFRVRPVNTKHPTQWQGVSLSPIERVQAAAV-------SLGCLFLLASLV 84          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002279.1 (pep scaffold:Pmarinus_7.0:GL492175:3127:4977:-1 gene:ENSPMAG00000002079.1 transcript:ENSPMAT00000002279.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.2838 bits (103), Expect = 2.556e-6
Identity = 21/51 (41.18%), Postives = 28/51 (54.90%), Query Frame = 1
Query:  133 CRVCL-DSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEF 282
            CRVC  +      L  PC C GSI  IH++CL +WL  ++   CE+C   F
Sbjct:    5 CRVCRSEGTAEKPLYHPCVCTGSIKYIHQDCLLQWLKHSKKEYCELCKHRF 55          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO37249 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD2])

HSP 1 Score: 70.0922 bits (170), Expect = 5.545e-15
Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSI 366
            CR+C DS    D+ISPC C G++G +H  CLE+WL+A+   +CEIC +E+ +     +F +WL     P S ++   I
Sbjct:    1 CRICRDSTAGCDVISPCHCSGTLGRVHVRCLEEWLSASNKNECEICKYEYHLQRTPKTFRQWLKN---PRSRTERRYI 75          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO37870 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEJ1])

HSP 1 Score: 58.5362 bits (140), Expect = 1.389e-10
Identity = 22/63 (34.92%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  133 CRVCLDSCDMGD-LISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRW 318
            CR+C    +    LISPC C GS+  +H+ CL++W+ ++   +CE+C +EF +      F +W
Sbjct:   10 CRICHCEAEPDQPLISPCHCSGSLQYVHQTCLQRWIKSSDTKKCELCNYEFIMEAKMKPFRKW 72          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO31642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXB2])

HSP 1 Score: 60.077 bits (144), Expect = 1.420e-10
Identity = 30/102 (29.41%), Postives = 51/102 (50.00%), Query Frame = 1
Query:  133 CRVCLDSCD----MGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSD-----SNSIQRIPVLSKIVCLFVL 411
            CR+C ++        +LI PC C G++G  H++C+E+WLT     +C IC F F   T     ++W   T+ P +  D        + ++ VL ++  LF +
Sbjct:   68 CRICQNTVQRMIGKEELIKPCLCNGTLGYAHRSCMEQWLTLTEKKKCTICEFTFKTKTVLKPITQW---TWLPMTTEDIIMLVGTILSQLTVLLQLGALFYV 166          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4C7])

HSP 1 Score: 50.447 bits (119), Expect = 2.604e-7
Identity = 40/157 (25.48%), Postives = 63/157 (40.13%), Query Frame = 1
Query:   43 LKMSNSIVNFQQSSSQTE-----PIGARLSSLSF--------KCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSI---QRIPVLSKIVCLFVLLAILGICIWFLILSNNNV 465
            L M   + N   S S  +     PI      L F        +CR+C    D   LISPC C GS   +H++CL  W   +R  +CE+C  +  V   T     W           D  S+    ++ +    V LF +  I+G  ++   + +++V
Sbjct:   45 LNMDGDVSNASNSKSSPKLEFELPIEDSKQELGFFAEFEYENECRICHTEGDEV-LISPCKCSGSTKWVHESCLVLWFQVSRTSKCELCAEKISVKKYTKPVREW--------RRPDVKSVGPCSKVDLWYLFVTLFSVSTIIGFVVFQACVKSDDV 192          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Match: EDO33161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSY5])

HSP 1 Score: 49.2914 bits (116), Expect = 7.980e-7
Identity = 22/69 (31.88%), Postives = 32/69 (46.38%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFP 339
            CR+C    +   LISPC C G++  +H +CL  WL      +CE+C +   V   T    +W      P
Sbjct:  196 CRICHCGGESEVLISPCLCMGTVRFVHHSCLMDWLQRCVKTKCELCLYPVAVRRKTKPLKKWRPPDEKP 264          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000017494.2 (E3 ubiquitin-protein ligase MARCH2 [Source:NCBI gene;Acc:101156120])

HSP 1 Score: 68.9366 bits (167), Expect = 2.209e-13
Identity = 33/117 (28.21%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWF-LILSNNNVTMETR 480
            CR+C +      L+SPC C G++G +HK+CLEKWL+++    CE+C  EF +       ++WL     P   S+  ++     L  + C  ++  +  I  W  L  + +++ +++R
Sbjct:   67 CRICHEGAGGETLLSPCDCTGTLGKVHKSCLEKWLSSSNTSYCELCHTEFTIERRPQPLTQWLKD---PGPRSEKRTL-----LCDMACFLLITPLAAISGWLCLRGAQDHLQLKSR 175          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: march2 (E3 ubiquitin-protein ligase MARCH2 [Source:NCBI gene;Acc:101160153])

HSP 1 Score: 64.3142 bits (155), Expect = 1.028e-11
Identity = 26/63 (41.27%), Postives = 38/63 (60.32%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWL 321
            CR+C +     DL+SPC C G+ G +HK+CLEKWL+++    CE+C  EF +       + WL
Sbjct:   66 CRICHEGGSSEDLLSPCDCTGTQGAVHKSCLEKWLSSSNTSYCELCHTEFCIERQQRPLTEWL 128          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: march2 (E3 ubiquitin-protein ligase MARCH2 [Source:NCBI gene;Acc:101160153])

HSP 1 Score: 63.929 bits (154), Expect = 1.787e-11
Identity = 26/63 (41.27%), Postives = 38/63 (60.32%), Query Frame = 1
Query:  133 CRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWL 321
            CR+C +     DL+SPC C G+ G +HK+CLEKWL+++    CE+C  EF +       + WL
Sbjct:  116 CRICHEGGSSEDLLSPCDCTGTQGAVHKSCLEKWLSSSNTSYCELCHTEFCIERQQRPLTEWL 178          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: march8 (membrane associated ring-CH-type finger 8 [Source:NCBI gene;Acc:101161433])

HSP 1 Score: 55.4546 bits (132), Expect = 1.232e-8
Identity = 21/63 (33.33%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  133 CRVC-LDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRW 318
            CR+C  +  +   LI+PC C GS+  +H+ CL++W+ ++    CE+C +EF + T      +W
Sbjct:   75 CRICHCEGDEESPLITPCHCTGSLRFVHQGCLQQWIKSSDTRCCELCKYEFIMETKFKPLRKW 137          
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Match: march8 (membrane associated ring-CH-type finger 8 [Source:NCBI gene;Acc:101161433])

HSP 1 Score: 55.0694 bits (131), Expect = 1.315e-8
Identity = 21/63 (33.33%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  133 CRVC-LDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRW 318
            CR+C  +  +   LI+PC C GS+  +H+ CL++W+ ++    CE+C +EF + T      +W
Sbjct:   51 CRICHCEGDEESPLITPCHCTGSLRFVHQGCLQQWIKSSDTRCCELCKYEFIMETKFKPLRKW 113          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000044972.1 (SMESG000044972.1)

HSP 1 Score: 473.011 bits (1216), Expect = 3.935e-171
Identity = 249/250 (99.60%), Postives = 249/250 (99.60%), Query Frame = 1
Query:   49 MSNSIVNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIXXXXXXXXXXXXXXXXXWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV 798
            MSNSIVNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLL ILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIAFVLTFLVALLVVVSTVWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV
Sbjct:    1 MSNSIVNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLTILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIAFVLTFLVALLVVVSTVWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV 250          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031839.1 (SMESG000031839.1)

HSP 1 Score: 470.315 bits (1209), Expect = 5.652e-170
Identity = 246/250 (98.40%), Postives = 247/250 (98.80%), Query Frame = 1
Query:   49 MSNSIVNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIXXXXXXXXXXXXXXXXXWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV 798
            MSNSIVNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVST TASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLL ILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIAFVLTFLVAL VVVSTVWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDS+DFTVNKPQSTV
Sbjct:    1 MSNSIVNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTKTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLTILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIAFVLTFLVALFVVVSTVWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSIDFTVNKPQSTV 250          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000044972.1 (SMESG000044972.1)

HSP 1 Score: 400.208 bits (1027), Expect = 7.297e-143
Identity = 212/213 (99.53%), Postives = 212/213 (99.53%), Query Frame = 1
Query:  160 MGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIXXXXXXXXXXXXXXXXXWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV 798
            MGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLL ILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIAFVLTFLVALLVVVSTVWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV
Sbjct:    1 MGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLTILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIAFVLTFLVALLVVVSTVWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV 213          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031839.1 (SMESG000031839.1)

HSP 1 Score: 396.741 bits (1018), Expect = 1.519e-141
Identity = 209/213 (98.12%), Postives = 210/213 (98.59%), Query Frame = 1
Query:  160 MGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIXXXXXXXXXXXXXXXXXWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV 798
            MGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVST TASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLL ILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIAFVLTFLVAL VVVSTVWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDS+DFTVNKPQSTV
Sbjct:    1 MGDLISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTKTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLTILGICIWFLILSNNNVTMETRQNNSTIEESSTLEIHSIAFVLTFLVALFVVVSTVWAILAIRHNYRSWKRYQMRCSRIDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSIDFTVNKPQSTV 213          
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Match: SMESG000003896.1 (SMESG000003896.1)

HSP 1 Score: 67.781 bits (164), Expect = 6.891e-13
Identity = 41/123 (33.33%), Postives = 62/123 (50.41%), Query Frame = 1
Query:   82 SSQTEPIGARLSSLSFKCRVCLDSCDMGD-LISPCFCKGSIGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSNSDSNSIQRIPVLSKIVCLFVLLAILGICIWFLI 447
            +S+T     R+S L  KCR+CLD    G+ L+SPC CKG++G++H  CLE+W+  +   QCEIC   + +    A    WL   +          +QR   +   +C   L+    I I+F I
Sbjct:  113 TSKTTENPVRISVL--KCRICLDLEKNGEKLMSPCRCKGTVGLMHSTCLEEWIRISEKEQCEICKCNYDMRKKRADMHMWLRHIY----------MQR-SFIGDAMCFIFLIPSTTIAIFFCI 222          
The following BLAST results are available for this feature:
BLAST of RING-CH-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARCHF31.349e-1231.07membrane associated ring-CH-type finger 3 [Source:... [more]
MARCHF25.913e-1229.52membrane associated ring-CH-type finger 2 [Source:... [more]
MARCHF25.913e-1229.52membrane associated ring-CH-type finger 2 [Source:... [more]
MARCHF37.438e-1246.15membrane associated ring-CH-type finger 3 [Source:... [more]
MARCHF21.277e-1046.15membrane associated ring-CH-type finger 2 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
marc-31.018e-830.08MARCH (Membrane-Associated Ring finger (C3HC4)) ho... [more]
marc-11.523e-740.00MARCH (Membrane-Associated Ring finger (C3HC4)) ho... [more]
marc-21.532e-638.18MARCH (Membrane-Associated Ring finger (C3HC4)) ho... [more]
marc-61.672e-640.00MARCH (Membrane-Associated Ring finger (C3HC4)) ho... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG40801.186e-1140.00gene:FBgn0035983 transcript:FBtr0309506[more]
CG40801.186e-1140.00gene:FBgn0035983 transcript:FBtr0076494[more]
CG134428.808e-1135.62gene:FBgn0034546 transcript:FBtr0086240[more]
CG177174.765e-839.06gene:FBgn0029877 transcript:FBtr0070944[more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1587851.173e-1531.43zgc:158785 [Source:ZFIN;Acc:ZDB-GENE-070112-1712][more]
march24.774e-1229.63membrane-associated ring finger (C3HC4) 2 [Source:... [more]
CR392032.11.801e-927.78membrane-associated ring finger (C3HC4) 11 [Source... [more]
march112.783e-936.00membrane-associated ring finger (C3HC4) 11 [Source... [more]
march86.852e-933.33membrane-associated ring finger (C3HC4) 8 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
march31.664e-1231.07membrane associated ring-CH-type finger 3 [Source:... [more]
march31.700e-1231.07membrane associated ring-CH-type finger 3 [Source:... [more]
marchf29.184e-1230.10membrane associated ring-CH-type finger 2 [Source:... [more]
faf12.350e-936.51Fas (TNFRSF6) associated factor 1 [Source:Xenbase;... [more]
faf12.693e-936.51Fas (TNFRSF6) associated factor 1 [Source:Xenbase;... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
March22.828e-1340.63membrane-associated ring finger (C3HC4) 2 [Source:... [more]
March35.446e-1331.07membrane-associated ring finger (C3HC4) 3 [Source:... [more]
March38.904e-1330.10membrane-associated ring finger (C3HC4) 3 [Source:... [more]
March29.121e-1328.21membrane-associated ring finger (C3HC4) 2 [Source:... [more]
March29.121e-1328.21membrane-associated ring finger (C3HC4) 2 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32L65|MARH2_BOVIN2.796e-1229.52E3 ubiquitin-protein ligase MARCHF2 OS=Bos taurus ... [more]
sp|Q8BRX9|MARH3_MOUSE3.809e-1231.07E3 ubiquitin-protein ligase MARCHF3 OS=Mus musculu... [more]
sp|Q86UD3|MARH3_HUMAN6.476e-1231.07E3 ubiquitin-protein ligase MARCHF3 OS=Homo sapien... [more]
sp|A0JN69|MARH3_BOVIN6.476e-1231.07E3 ubiquitin-protein ligase MARCHF3 OS=Bos taurus ... [more]
sp|Q5XIE5|MARH3_RAT6.800e-1230.10E3 ubiquitin-protein ligase MARCHF3 OS=Rattus norv... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DMP72.224e-2131.86E3 ubiquitin-protein ligase MARCH2 OS=Schistosoma ... [more]
A0A183QQI84.190e-1542.39RING-CH-type domain-containing protein OS=Schistos... [more]
A0A183MHG11.043e-1442.86RING-CH-type domain-containing protein OS=Schistos... [more]
A0A553NCR91.099e-1434.59RING-CH-type domain-containing protein OS=Tigriopu... [more]
A0A4S2LI311.297e-1432.99RING-CH-type domain-containing protein OS=Opisthor... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000055541.11.059e-1632.38E3 ubiquitin-protein ligase MARCH3-like [Source:NC... [more]
ENSAMXT00000036351.11.563e-1630.58E3 ubiquitin-protein ligase MARCH3-like [Source:NC... [more]
MARCHF39.069e-1331.07membrane associated ring-CH-type finger 3 [Source:... [more]
march23.761e-1229.13membrane associated ring-CH-type finger 2 [Source:... [more]
march89.320e-936.51membrane-associated ring finger (C3HC4) 8 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MARCHF32.552e-1725.41membrane associated ring-CH-type finger 3 [Source:... [more]
MARCHF32.896e-1732.17membrane associated ring-CH-type finger 3 [Source:... [more]
march81.866e-731.48membrane-associated ring finger (C3HC4) 8 [Source:... [more]
MARCHF41.665e-627.27membrane associated ring-CH-type finger 4 [Source:... [more]
ENSPMAT00000002279.12.556e-641.18pep scaffold:Pmarinus_7.0:GL492175:3127:4977:-1 ge... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372495.545e-1539.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378701.389e-1034.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316421.420e-1029.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414972.604e-725.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331617.980e-731.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017494.22.209e-1328.21E3 ubiquitin-protein ligase MARCH2 [Source:NCBI ge... [more]
march21.028e-1141.27E3 ubiquitin-protein ligase MARCH2 [Source:NCBI ge... [more]
march21.787e-1141.27E3 ubiquitin-protein ligase MARCH2 [Source:NCBI ge... [more]
march81.232e-833.33membrane associated ring-CH-type finger 8 [Source:... [more]
march81.315e-833.33membrane associated ring-CH-type finger 8 [Source:... [more]
back to top
BLAST of RING-CH-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044972.13.935e-17199.60SMESG000044972.1[more]
SMESG000031839.15.652e-17098.40SMESG000031839.1[more]
SMESG000044972.17.297e-14399.53SMESG000044972.1[more]
SMESG000031839.11.519e-14198.12SMESG000031839.1[more]
SMESG000003896.16.891e-1333.33SMESG000003896.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015368 ID=SMED30015368|Name=RING-CH-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=827bp
TTTAAGTATTTCAACATAATCGGTAATTAACTAGCAGAAATATTAAAAAT
GTCAAATTCAATTGTAAATTTTCAACAATCATCATCTCAAACTGAACCGA
TTGGAGCACGATTGTCATCTTTAAGTTTCAAATGTCGAGTGTGTCTTGAT
TCTTGTGATATGGGAGATTTGATAAGCCCTTGTTTTTGTAAAGGAAGTAT
TGGAGTAATACACAAAAATTGTTTGGAAAAATGGCTGACTGCAGCAAGAA
TAGGACAATGTGAAATTTGTGGCTTTGAATTTTTCGTATCGACTAATACG
GCTTCATTTTCAAGATGGTTATCAGGAACTTTCTTTCCATTTTCAAATTC
TGATTCTAATTCAATCCAGCGGATTCCAGTTTTGTCTAAGATTGTTTGTT
TATTTGTGTTACTGGCGATTCTTGGAATATGTATTTGGTTTCTGATTCTT
TCTAACAATAATGTCACTATGGAAACCAGACAAAATAATTCTACGATTGA
AGAATCTTCGACATTGGAAATTCACTCTATAGCATTCGTATTAACATTTC
TAGTTGCTTTATTGGTTGTCGTTTCAACAGTCTGGGCGATTCTAGCTATC
AGACATAACTATCGGTCATGGAAAAGATATCAAATGCGGTGCAGTCGCAT
TGATTTATCTCAACAAGAAACGGTTCGGTTGTCTGCTGACATTTCGGACA
CTCAAACCCGATATCAGTCGTTTGGTATGAGAACACCGGCATTACCTTCA
CATAGAGATTCATTAGATTTTACTGTTAATAAACCGCAGTCGACTGTCTA
AACTTAGCAAGTTTTCCGTAATTTAAT
back to top

protein sequence of SMED30015368-orf-1

>SMED30015368-orf-1 ID=SMED30015368-orf-1|Name=SMED30015368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=251bp
MSNSIVNFQQSSSQTEPIGARLSSLSFKCRVCLDSCDMGDLISPCFCKGS
IGVIHKNCLEKWLTAARIGQCEICGFEFFVSTNTASFSRWLSGTFFPFSN
SDSNSIQRIPVLSKIVCLFVLLAILGICIWFLILSNNNVTMETRQNNSTI
EESSTLEIHSIAFVLTFLVALLVVVSTVWAILAIRHNYRSWKRYQMRCSR
IDLSQQETVRLSADISDTQTRYQSFGMRTPALPSHRDSLDFTVNKPQSTV
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR011016Znf_RING-CH
IPR013083Znf_RING/FYVE/PHD
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0016874ligase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011016Zinc finger, RING-CH-typeSMARTSM00744ringv_2coord: 28..75
e-value: 1.7E-13
score: 60.8
IPR011016Zinc finger, RING-CH-typePFAMPF12906RINGvcoord: 29..74
e-value: 5.2E-12
score: 45.7
IPR011016Zinc finger, RING-CH-typePROSITEPS51292ZF_RING_CHcoord: 21..81
score: 18.84
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 14..89
e-value: 2.4E-17
score: 64.2
NoneNo IPR availablePANTHERPTHR46065FAMILY NOT NAMEDcoord: 19..209
NoneNo IPR availablePANTHERPTHR46065:SF3FI20425P1coord: 19..209
NoneNo IPR availableCDDcd149827tmA_purinoceptor-likecoord: 71..195
e-value: 0.00534703
score: 35.3186
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 26..79
NoneNo IPR availableTMHMMTMhelixcoord: 115..134
NoneNo IPR availableTMHMMTMhelixcoord: 161..183