Lysophosphatidic acid phosphatase type 6

Overview
NameLysophosphatidic acid phosphatase type 6
Smed IDSMED30015365
Length (bp)1803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysophosphatidic acid phosphatase type 6 (SMED30015365) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysophosphatidic acid phosphatase type 6 (SMED30015365) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysophosphatidic acid phosphatase type 6 (SMED30015365) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysophosphatidic acid phosphatase type 6 (SMED30015365) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015365

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30015365h1SMcG0013253 dd_Smed_v4_13744_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015365h1SMcG0013253 dd_Smed_v4_13744_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015365h1SMcG0013253 dd_Smed_v4_13744_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015365h1SMcG0013253 Contig48685uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015365h1SMcG0013253 Contig48685newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015365h1SMcG0013253 Contig13512uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015365h1SMcG0013253 Contig13512newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30015365h1SMcG0013253 dd_Smed_v6_13744_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Human
Match: ACP6 (acid phosphatase 6, lysophosphatidic [Source:HGNC Symbol;Acc:HGNC:29609])

HSP 1 Score: 96.2857 bits (238), Expect = 1.249e-20
Identity = 107/458 (23.36%), Postives = 180/458 (39.30%), Query Frame = 1
Query:  163 VDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYS-TDIKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRP---IIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLG-GSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDK 1521
            VD    +L  V V+ RHGAR+P   L    +  +W+  L  V     F Y+ T++   P      +    E  +   K     GQLT VG +Q  A G  LR+ Y+     L+  F+  E+  RST   R   + + +L+G++       C +    II+T     + LYPN  +C ++           S +                            P  S++  K K+R               D+SD+ +  + + D++ + Q HN  +P+  C +     R+  Q  +   L     E  E + + V P ++ ++ N+ K +                 D+ T      K+ L + HD T IPL++ L I++ +WP F  ++ +ELY+   S  +F ++   GK Q      + C        GL P D  +     Y+    KY   C +
Sbjct:   43 VDRSLLKLKMVQVVFRHGARSPLKPLPLE-EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTL---KGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLF------QCQKEGPIIIHTDEADSEVLYPNYQSCWSLRQRTRGRRQTASLQ----------------------------PGISEDLKKVKDRM------------GIDSSDK-VDFFILLDNVAAEQAHN--LPS--CPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAVGPFLHILESNLLKAM-----------------DSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDHKWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQ----VPRGCPD------GLCPLDMFLNAMSVYTLSPEKYHALCSQ 418          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Human
Match: ACP6 (acid phosphatase 6, lysophosphatidic [Source:HGNC Symbol;Acc:HGNC:29609])

HSP 1 Score: 56.6102 bits (135), Expect = 3.335e-8
Identity = 57/216 (26.39%), Postives = 92/216 (42.59%), Query Frame = 1
Query:  163 VDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYS-TDIKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRP---IIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVD 798
            VD    +L  V V+ RHGAR+P   L    +  +W+  L  V     F Y+ T++   P      +    E  +   K     GQLT VG +Q  A G  LR+ Y+     L+  F+  E+  RST   R   + + +L+G++       C +    II+T     + LYPN  +C ++           S +  + +    +K  +G+D    VD
Sbjct:   43 VDRSLLKLKMVQVVFRHGARSPLKPLPLE-EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTL---KGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLF------QCQKEGPIIIHTDEADSEVLYPNYQSCWSLRQRTRGRRQTASLQPGISEDLKKVKDRMGIDSSDKVD 248          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Human
Match: ACP6 (acid phosphatase 6, lysophosphatidic [Source:HGNC Symbol;Acc:HGNC:29609])

HSP 1 Score: 50.0618 bits (118), Expect = 1.118e-6
Identity = 39/133 (29.32%), Postives = 61/133 (45.86%), Query Frame = 1
Query:  193 VTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYS-TDIKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIY 588
            V V+ RHGAR+P   L    +  +W+  L  V     F Y+ T++   P      +    E  +   K     GQLT VG +Q  A G  LR+ Y+     L+  F+  E+  RST   R   + + +L+G++
Sbjct:    2 VQVVFRHGARSPLKPLPLE-EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTL---KGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLF 130          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Celegans
Match: pho-4 (Intestinal acid PHOsphatase [Source:UniProtKB/TrEMBL;Acc:Q22525])

HSP 1 Score: 50.447 bits (119), Expect = 3.040e-6
Identity = 34/104 (32.69%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  403 SYGQLTLVGQEQAIAFGRELRRIYMMGN--KLLNDKFDENEILCRSTKFPRTFYTLKGILSGIY-----------GVDSFDACNRPI------IYTMPIAMDNL 657
             +GQLT +G  Q +  G++LR  Y+ G   K LN ++++ EI  RST   RT  +    + G+Y           GVD  D    P+      I+T+P A D+L
Sbjct:   63 GWGQLTPIGMRQHMQLGQKLRARYVNGQPYKFLNTRYNQQEIFVRSTDKNRTLLSAFSNMVGMYGNTAQENASIAGVDYPDVVGWPVGFVPIPIHTIPDAEDHL 166          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Celegans
Match: pho-4 (Intestinal acid PHOsphatase [Source:UniProtKB/TrEMBL;Acc:Q22525])

HSP 1 Score: 50.447 bits (119), Expect = 3.040e-6
Identity = 34/104 (32.69%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  403 SYGQLTLVGQEQAIAFGRELRRIYMMGN--KLLNDKFDENEILCRSTKFPRTFYTLKGILSGIY-----------GVDSFDACNRPI------IYTMPIAMDNL 657
             +GQLT +G  Q +  G++LR  Y+ G   K LN ++++ EI  RST   RT  +    + G+Y           GVD  D    P+      I+T+P A D+L
Sbjct:   63 GWGQLTPIGMRQHMQLGQKLRARYVNGQPYKFLNTRYNQQEIFVRSTDKNRTLLSAFSNMVGMYGNTAQENASIAGVDYPDVVGWPVGFVPIPIHTIPDAEDHL 166          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Zebrafish
Match: acp6 (acid phosphatase 6, lysophosphatidic [Source:ZFIN;Acc:ZDB-GENE-050208-290])

HSP 1 Score: 105.916 bits (263), Expect = 3.998e-24
Identity = 106/467 (22.70%), Postives = 181/467 (38.76%), Query Frame = 1
Query:  166 DSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFC---YSTDIKELPAHTVID------------EDSIQEEYMEHNKNKCSY-GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACD 1518
            ++  +EL  + VL RHGARTP                   +  +PD     +S ++ E PAHT ID               +++ Y        +Y GQLT +G +Q    G  LR+ Y+     L   F+  E+  RST   RT  + K +++G++  +     +   I T     + LYPN   C  +   I +  AE S   D+      ++  LGVD  + +D                                            +RDD+ +R+ H   +P         I + +   + + Y        + + + V P +N             L T+ E K  S      +  K   K+ L S HDTTL+P ++ L +++ +WP + ++I +ELY+ + ++  + ++    + Q +      C SN Y      P D+  A    +S PD +Y   C+
Sbjct:   25 EASPYELKLIQVLFRHGARTP-------------------LKSIPDVLEAQWSPELLEAPAHTKIDYMVTDLEGGPRPPAPVEDSYRAKILTGGTYPGQLTTIGMQQLYDLGVRLRKKYIQEEPFLTPTFNPKEVYIRSTNIVRTIESAKCLVAGLFQQEQAGVVS---ILTDKAEKEVLYPNYHGCKLLKMLIGNRWAESSTLPDIAADLQNIQDDLGVDAQQRLD-----------------------------------------FILIRDDMVARETHGLPLPTVLEQWRSTIEQRAVDMIYHIYEPSK---RQNLQMCVGPLLNM------------LVTNMEDKIQS------SPSKQDRKLFLYSVHDTTLMPCLMALGVFDMKWPPYAADITLELYQHRQTNQHYVKVSYIDQDQKI----PGC-SNIY-----CPIDEFKAAMAVHSLPDDRYYALCE 397          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Xenopus
Match: akr1b1 (aldo-keto reductase family 1, member B1 (aldose reductase) [Source:Xenbase;Acc:XB-GENE-5821742])

HSP 1 Score: 82.8037 bits (203), Expect = 1.330e-16
Identity = 84/374 (22.46%), Postives = 149/374 (39.84%), Query Frame = 1
Query:  409 GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAAC---SAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEV-LYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACD 1518
            GQLT VG EQ    G  LRR Y+     L+  +  +E+  RST   R   + + +L+G++            I T     + LYPN   C     +T  +  G A     AD             +++LR             N D +KE      ++  + QE                      VH F  P +  S    + R+  + + ++ Y+ G     + + + V P ++ ++ N+ +               ++ T  +   +G  K+ L + HD TLIPL++ L I+  +WP + S++ +ELY+ + S  +F R+  +G+ Q V    + C S      GL P  + ++   +++     Y   C 
Sbjct:   19 GQLTTVGMEQMFNLGARLRRNYVEEQHFLSPVYKPSEVFVRSTNIVRNLESTRCLLAGLFQQQQEGPAT---IVTADANSEILYPNYHGCHELKQLTSTLTPGAAAQPGMAD------------DLNQLR----------QEMNIDATKEVDFFLLLDNLLAQE----------------------VHGFPCPLKDKS---NLQRIEERTIDIFCYVIGPSN-RKVLRLSVGPFLHTLRRNMLE---------------ARDTAGVAAAQGR-KLYLYAAHDVTLIPLLMALGIFNKKWPPYASDLTLELYQHRPSKEWFVRLNYNGEEQRV----RGCQS------GLCPLQEFLSALSEFALSPEDYKALCS 315          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Xenopus
Match: akr1b1 (aldo-keto reductase family 1, member B1 (aldose reductase) [Source:Xenbase;Acc:XB-GENE-5821742])

HSP 1 Score: 82.4185 bits (202), Expect = 1.362e-16
Identity = 84/374 (22.46%), Postives = 149/374 (39.84%), Query Frame = 1
Query:  409 GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAAC---SAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEV-LYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACD 1518
            GQLT VG EQ    G  LRR Y+     L+  +  +E+  RST   R   + + +L+G++            I T     + LYPN   C     +T  +  G A     AD             +++LR             N D +KE      ++  + QE                      VH F  P +  S    + R+  + + ++ Y+ G     + + + V P ++ ++ N+ +               ++ T  +   +G  K+ L + HD TLIPL++ L I+  +WP + S++ +ELY+ + S  +F R+  +G+ Q V    + C S      GL P  + ++   +++     Y   C 
Sbjct:    7 GQLTTVGMEQMFNLGARLRRNYVEEQHFLSPVYKPSEVFVRSTNIVRNLESTRCLLAGLFQQQQEGPAT---IVTADANSEILYPNYHGCHELKQLTSTLTPGAAAQPGMAD------------DLNQLR----------QEMNIDATKEVDFFLLLDNLLAQE----------------------VHGFPCPLKDKS---NLQRIEERTIDIFCYVIGPSN-RKVLRLSVGPFLHTLRRNMLE---------------ARDTAGVAAAQGR-KLYLYAAHDVTLIPLLMALGIFNKKWPPYASDLTLELYQHRPSKEWFVRLNYNGEEQRV----RGCQS------GLCPLQEFLSALSEFALSPEDYKALCS 303          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Xenopus
Match: akr1b1 (aldo-keto reductase family 1, member B1 (aldose reductase) [Source:Xenbase;Acc:XB-GENE-5821742])

HSP 1 Score: 82.4185 bits (202), Expect = 1.650e-16
Identity = 84/374 (22.46%), Postives = 149/374 (39.84%), Query Frame = 1
Query:  409 GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAAC---SAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEV-LYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACD 1518
            GQLT VG EQ    G  LRR Y+     L+  +  +E+  RST   R   + + +L+G++            I T     + LYPN   C     +T  +  G A     AD             +++LR             N D +KE      ++  + QE                      VH F  P +  S    + R+  + + ++ Y+ G     + + + V P ++ ++ N+ +               ++ T  +   +G  K+ L + HD TLIPL++ L I+  +WP + S++ +ELY+ + S  +F R+  +G+ Q V    + C S      GL P  + ++   +++     Y   C 
Sbjct:   31 GQLTTVGMEQMFNLGARLRRNYVEEQHFLSPVYKPSEVFVRSTNIVRNLESTRCLLAGLFQQQQEGPAT---IVTADANSEILYPNYHGCHELKQLTSTLTPGAAAQPGMAD------------DLNQLR----------QEMNIDATKEVDFFLLLDNLLAQE----------------------VHGFPCPLKDKS---NLQRIEERTIDIFCYVIGPSN-RKVLRLSVGPFLHTLRRNMLE---------------ARDTAGVAAAQGR-KLYLYAAHDVTLIPLLMALGIFNKKWPPYASDLTLELYQHRPSKEWFVRLNYNGEEQRV----RGCQS------GLCPLQEFLSALSEFALSPEDYKALCS 327          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Mouse
Match: Acp6 (acid phosphatase 6, lysophosphatidic [Source:MGI Symbol;Acc:MGI:1931010])

HSP 1 Score: 101.679 bits (252), Expect = 1.522e-22
Identity = 111/456 (24.34%), Postives = 185/456 (40.57%), Query Frame = 1
Query:  163 VDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYS-TDIKELP-AHTVIDEDSIQEEYMEHN-KNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDK 1521
            VD    EL  V V+ RHGAR+P   L    +  +W+  L  +     F Y+ T++   P  H+  D      EY +   +     GQLT VG +Q  A G +LR+ Y+     L+  ++  E+  RST   R   + + +L+G++      A    +I+T   + + LYPN  +C             V KE    + K  +                 +P  S++ +K             VK      + + +  + + D++ + QVH+          +  I + +    LY       E  E I + V P ++ ++ N+ K V                 D  T    T KM L + HD TL+P+++ L I++ +WP F  ++ +ELY+ + S  +F ++  +GK Q      + C     DK  L P D  +     YS    KY   C K
Sbjct:   36 VDRNLLELKMVQVVFRHGARSPLKPLPLE-EQVEWNPKLLEIPPQTRFDYTVTNLAGGPKPHSHYDT-----EYRKTTLRGGVLAGQLTKVGMQQMFALGEKLRKNYVEDIPFLSPVYNPQEVFIRSTNMFRNLESTRCLLAGLFQHQKGSA----VIHTDEASSEVLYPNYQSCW------------VLKEKTRGRKKAAIS----------------QPGISEDLEK-------------VKTGVGINNGDDVDFFVLLDNVAAEQVHSLLNCPALERFAQLIEQRAVDMALYVV---EQEDRESIQMAVGPFLHILEGNLLKTV-----------------DPTTAPSKTRKMYLYATHDVTLLPMLLALGIFDQKWPPFAVDLTMELYQHQESKEWFVQLFYNGKEQ----VPRGCP----DK--LCPLDKFLNTMSVYSVSPEKYRTLCSK 410          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. UniProt/SwissProt
Match: sp|A6H757|PPA6_BOVIN (Lysophosphatidic acid phosphatase type 6 OS=Bos taurus OX=9913 GN=ACP6 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.138e-24
Identity = 113/458 (24.67%), Postives = 179/458 (39.08%), Query Frame = 1
Query:  163 VDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYS-TDIKELP-AHTVIDEDSIQEEYMEHN-KNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEER--IAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDK 1521
            VD    EL  V V+ RHGAR+P   L       +W S L  V       Y+ T++   P  H+  D      +Y E   K     GQLT VG EQ  A G  LR+ Y+     L+  F+  E+  RST   R   + + +L+G++           +I+T   + + LYPN   C  +                        KR  G  +   + P                     E  K+VK+     S + +    + D++ + QVH+          +  I + +    LY       +WE+R  + + V P ++ ++ N+ KVV                 D  T    T K+ L + HD TL+PL++ L I++ +WP F  ++ +ELY+ + S  +F ++   GK Q      K C        GL P D  +     Y+    KY   C +
Sbjct:   43 VDRNLLELKMVQVVFRHGARSPLKPLPQEDQQVEWKSQLLEVPPQTQLEYTVTNLAGGPKPHSPFDS-----QYHETTLKGGMFAGQLTKVGMEQMFALGERLRKNYVEDIPFLSPTFNPLEVFIRSTNIYRNLESTRCLLAGLFQRQKEGPI---VIHTDEASSEVLYPNYQYCWNLQ-----------------------KRTRGRRQAASLQPGI------------------SEDLKKVKEGMGIASSDEVDFLVLLDNMAAEQVHSLPSCPTLKRFAWMIEQRAVDTALYIL-----QWEDREGLQMAVGPFLHILESNLLKVV-----------------DPATPPSKTRKLYLYAAHDVTLMPLLMTLGIFDHKWPPFAVDLTMELYQHRESKEWFVQLYYRGKEQ----VPKGCPD------GLCPLDKFLNTISVYTLSPEKYHMLCSE 419          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. UniProt/SwissProt
Match: sp|Q8BP40|PPA6_MOUSE (Lysophosphatidic acid phosphatase type 6 OS=Mus musculus OX=10090 GN=Acp6 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.064e-21
Identity = 111/456 (24.34%), Postives = 185/456 (40.57%), Query Frame = 1
Query:  163 VDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYS-TDIKELP-AHTVIDEDSIQEEYMEHN-KNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDK 1521
            VD    EL  V V+ RHGAR+P   L    +  +W+  L  +     F Y+ T++   P  H+  D      EY +   +     GQLT VG +Q  A G +LR+ Y+     L+  ++  E+  RST   R   + + +L+G++      A    +I+T   + + LYPN  +C             V KE    + K  +                 +P  S++ +K             VK      + + +  + + D++ + QVH+          +  I + +    LY       E  E I + V P ++ ++ N+ K V                 D  T    T KM L + HD TL+P+++ L I++ +WP F  ++ +ELY+ + S  +F ++  +GK Q      + C     DK  L P D  +     YS    KY   C K
Sbjct:   36 VDRNLLELKMVQVVFRHGARSPLKPLPLE-EQVEWNPKLLEIPPQTRFDYTVTNLAGGPKPHSHYDT-----EYRKTTLRGGVLAGQLTKVGMQQMFALGEKLRKNYVEDIPFLSPVYNPQEVFIRSTNMFRNLESTRCLLAGLFQHQKGSA----VIHTDEASSEVLYPNYQSCW------------VLKEKTRGRKKAAIS----------------QPGISEDLEK-------------VKTGVGINNGDDVDFFVLLDNVAAEQVHSLLNCPALERFAQLIEQRAVDMALYVV---EQEDRESIQMAVGPFLHILEGNLLKTV-----------------DPTTAPSKTRKMYLYATHDVTLLPMLLALGIFDQKWPPFAVDLTMELYQHQESKEWFVQLFYNGKEQ----VPRGCP----DK--LCPLDKFLNTMSVYSVSPEKYRTLCSK 410          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. UniProt/SwissProt
Match: sp|Q9NPH0|PPA6_HUMAN (Lysophosphatidic acid phosphatase type 6 OS=Homo sapiens OX=9606 GN=ACP6 PE=1 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 5.998e-20
Identity = 107/458 (23.36%), Postives = 180/458 (39.30%), Query Frame = 1
Query:  163 VDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYS-TDIKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRP---IIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLG-GSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDK 1521
            VD    +L  V V+ RHGAR+P   L    +  +W+  L  V     F Y+ T++   P      +    E  +   K     GQLT VG +Q  A G  LR+ Y+     L+  F+  E+  RST   R   + + +L+G++       C +    II+T     + LYPN  +C ++           S +                            P  S++  K K+R               D+SD+ +  + + D++ + Q HN  +P+  C +     R+  Q  +   L     E  E + + V P ++ ++ N+ K +                 D+ T      K+ L + HD T IPL++ L I++ +WP F  ++ +ELY+   S  +F ++   GK Q      + C        GL P D  +     Y+    KY   C +
Sbjct:   43 VDRSLLKLKMVQVVFRHGARSPLKPLPLE-EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTL---KGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLF------QCQKEGPIIIHTDEADSEVLYPNYQSCWSLRQRTRGRRQTASLQ----------------------------PGISEDLKKVKDRM------------GIDSSDK-VDFFILLDNVAAEQAHN--LPS--CPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAVGPFLHILESNLLKAM-----------------DSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDHKWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQ----VPRGCPD------GLCPLDMFLNAMSVYTLSPEKYHALCSQ 418          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. UniProt/SwissProt
Match: sp|Q5R8C0|PPA6_PONAB (Lysophosphatidic acid phosphatase type 6 OS=Pongo abelii OX=9601 GN=ACP6 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.598e-19
Identity = 104/454 (22.91%), Postives = 172/454 (37.89%), Query Frame = 1
Query:  193 VTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYMEHNKNKCS--------YGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRP---IIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDK 1521
            V V+ RHGAR+P   L    +  +W+  L  V     F Y          TV +     + Y  ++   C          GQLT VG +Q  A G  LR+ Y+     L+  F   E+  RST   R   + + +L+G++       C +    II+T     + LYPN  +C ++           S +                            P  S++  K K+R               D+SD+ +  + + D++ + Q HN          +  I + +    LY  L   D   E + + V P ++ ++ N+ K +                 D+ T      K+ L + HD TLIPL++ L I++ +WP F  ++ +ELY+   S  +F ++   GK Q      + C        GL P D  +     Y+    KY   C +
Sbjct:   53 VQVVFRHGARSPRKPLPLE-EQVEWNPQLLEVPPQTQFDY----------TVTNLAGGPKPYSPYDAQYCETTLKGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFSPQEVFIRSTNIFRNLESTRCLLAGLF------QCQKEGPIIIHTDEADSEVLYPNYQSCWSLRQRTRGRRQTASLQ----------------------------PGISEDLKKVKDRM------------GIDSSDK-VDFFILLDNMAAEQAHNLPSCPMLKRFAQMIEQRAVDTSLY-ILPKEDR--ESLQMAVGPLLHILESNLLKAM-----------------DSATAPDKIRKLYLYAAHDVTLIPLLMTLGIFDHKWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQ----VPRGCPD------GLCPLDMFLNAMSVYTLSPEKYHALCSQ 418          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. UniProt/SwissProt
Match: sp|Q54PR9|CF60_DICDI (Counting factor 60 OS=Dictyostelium discoideum OX=44689 GN=cf60 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 4.797e-10
Identity = 51/178 (28.65%), Postives = 85/178 (47.75%), Query Frame = 1
Query:  193 VTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYM---EHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFD---ENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNR-PI--IYTMPIAMDNLYPNPAACSAVTPFI 699
            V +L RHG RTP  Y   +  M  W   LG++ +       + +  +P      +   ++ YM   E+    CS GQLT +G +Q +  G+ LR++Y+   +LL  +      + I  RST  PRT  +++G L+ ++   +  + +  PI  I TM    +N+ PNP  C  +   I
Sbjct:   47 VQILTRHGDRTP-LYSTLKPTMNTWDCNLGWLMV-------SSLNNVPGAATDVDRLFRKVYMPNREYFPGNCSDGQLTSLGFQQHLQLGQSLRQLYVDKYELLPSELSVDAASTIWVRSTDVPRTIQSVQGHLTALFPPTTVTSGSGIPIININTMDNYYENMTPNPTLCPELAVLI 216          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. TrEMBL
Match: A7YKU4 (Putative acid phosphatase 6 (Fragment) OS=Clonorchis sinensis OX=79923 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.631e-40
Identity = 112/388 (28.87%), Postives = 177/388 (45.62%), Query Frame = 1
Query:  178 FELINVTVLARHGARTPNYYLDS-RFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYMEHNKNKCSY-GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYG--VDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELY 1329
             +L+ V V  RHGARTP +++ S   D   W+  L  +D LP  CY   I ++ +  VID   +    +        Y G+L   GQE+A A GR L+  Y+     ++   ++ E+ CRST   RT  +L+ +L+GI+G  V         +I   P+  + L+PNP  C AV  F   G++E        ++K  LK +LGV +L   D  +P P     +D                           P+Y VRDD  SR+  NF +P     L P +++L+++E+ +EYLG    W+  + +++S     I  ++                               K QL SCHD+TL+ L+  L  ++G WP F +++I+ELY
Sbjct:   23 LQLVQVQVFFRHGARTPLHHVRSPNVDDAFWTPEL--IDDLPHTCYPFKIMDICSEQVIDLSQVSSLPIPFRLPGGLYTGELIKRGQEEAYALGRRLKSSYIDKRPFISSSINQEEVYCRSTLIRRTIKSLRCVLAGIFGENVKENPRVEPAVINVEPLDREYLFPNPMICKAVDRFAKDGMSECLNSESHRRLKQTLKSVLGVKKL--YDDFRPTP-----WD--------------------------CPVYFVRDDYTSRKSANFPLPPGMDELFPTMHQLAAEELYWEYLGMKQHWDANLHVVMSGVFKMILCSMRHFT------------------------RVPKFQLYSCHDSTLMLLLYALECFDGHWPPFAADLILELY 351          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. TrEMBL
Match: A0A4S2M3I6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002947 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.439e-36
Identity = 108/404 (26.73%), Postives = 181/404 (44.80%), Query Frame = 1
Query:  178 FELINVTVLARHGARTPNYYLDS-RFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYMEHNKNKCSY-GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYG--VDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDG 1377
             +L+ V +  RHGARTP +++ S   D   W+  L  +D LP  CY   I ++ +  V+D   +    +        Y G+L   GQE+A A GR  +  Y+     ++   ++ E+ CRST   RT  +L+ +L+G++G  +         +I    +  + L+PNP  C +V  F   G++E        ++K  LK +LGV +L   D  +P P     +D                           P+Y VRDD  SR+  NF +P     L P +++L+++E+ +EYLG    W+  + +++S     I  ++                               K QL SCHD+TL+ L+  L  ++G WP F +++I+ELY +        +IL +G
Sbjct:    6 LQLVQVQIFFRHGARTPLHHVRSPNVDDAFWTPEL--IDDLPHTCYPFKIMDICSEKVVDLSQVSSLPIPFRLPGGLYTGELIKRGQEEAFALGRRFKSSYIDKISFISSSINQEEVYCRSTMIRRTIKSLRCVLAGMFGENLRGNPKVEPAVINVESLDREYLFPNPVICKSVDRFAKDGMSECLNSEGHRRLKQKLKSVLGVKKL--YDDFRPTP-----WD--------------------------CPVYFVRDDYTSRKSANFPLPPGMDELFPTMHQLATEELYWEYLGMKQHWDVNLHVVMSGVFKMILCSMRHFT------------------------RVPKFQLYSCHDSTLMLLLYALECFDGYWPPFAADLILELYLDAD----VVKILTEG 346          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. TrEMBL
Match: A0A4S2M868 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002947 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.567e-36
Identity = 108/404 (26.73%), Postives = 181/404 (44.80%), Query Frame = 1
Query:  178 FELINVTVLARHGARTPNYYLDS-RFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYMEHNKNKCSY-GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYG--VDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDG 1377
             +L+ V +  RHGARTP +++ S   D   W+  L  +D LP  CY   I ++ +  V+D   +    +        Y G+L   GQE+A A GR  +  Y+     ++   ++ E+ CRST   RT  +L+ +L+G++G  +         +I    +  + L+PNP  C +V  F   G++E        ++K  LK +LGV +L   D  +P P     +D                           P+Y VRDD  SR+  NF +P     L P +++L+++E+ +EYLG    W+  + +++S     I  ++                               K QL SCHD+TL+ L+  L  ++G WP F +++I+ELY +        +IL +G
Sbjct:   17 LQLVQVQIFFRHGARTPLHHVRSPNVDDAFWTPEL--IDDLPHTCYPFKIMDICSEKVVDLSQVSSLPIPFRLPGGLYTGELIKRGQEEAFALGRRFKSSYIDKISFISSSINQEEVYCRSTMIRRTIKSLRCVLAGMFGENLRGNPKVEPAVINVESLDREYLFPNPVICKSVDRFAKDGMSECLNSEGHRRLKQKLKSVLGVKKL--YDDFRPTP-----WD--------------------------CPVYFVRDDYTSRKSANFPLPPGMDELFPTMHQLATEELYWEYLGMKQHWDVNLHVVMSGVFKMILCSMRHFT------------------------RVPKFQLYSCHDSTLMLLLYALECFDGYWPPFAADLILELYLDAD----VVKILTEG 357          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. TrEMBL
Match: A0A4Z2D2R5 (Lysophosphatidic acid phosphatase type 6 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_005130 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.446e-33
Identity = 103/392 (26.28%), Postives = 179/392 (45.66%), Query Frame = 1
Query:  181 ELINVTVLARHGARTPNYYLDSRFDMPD--WSSGLGYVDLLPDFCYSTDIKELPAHTVID--EDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSS 1344
            +L+ V V  RHGARTP +++ S    P+  WS  +     LP   +   + ++    V+    D +   ++    N    G+LT  GQ+ A   G  L++ Y+     L+  F  ++   R+T   RT  +L+ +++G+Y  D+        +    ++ + L+PNP  C  +T   N G++E  K      MK  LK+ILG++RL                      C        V+Q S D      PIY VRDD  +R+   F +P +   L P++++LSS+E+L+E+LG   +W++ + I++S   + I  N+                           +   +  L +CHD++++ L+  L  ++G WP F +++I ELY   SS
Sbjct:    6 KLLQVQVFFRHGARTPLFHVKSS-ACPEALWSPEISTE--LPHTLFPYRLVDISTQKVVQLTPDYLDRLFVLPGGNHV--GELTKGGQQDAYDLGARLKKQYIQSANFLSHTFQPSQFYLRTTFISRTIKSLRCVMAGLYE-DNLSLIEPVTVECEKLSTEILFPNPNTCKLLTQLFNDGVSECRKSNKFTVMKNELKQILGLERLL--------------------DC--------VEQRSTDYD---CPIYFVRDDYLARKYAGFPIPADLDKLFPKMHKLSSEELLHEFLGKRKDWKKNVHIVLSDMFSLILRNM------------------------INHEKLPQFHLYACHDSSIMLLLFGLNAFDGWWPPFAADVIFELYTMPSS 336          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. TrEMBL
Match: A0A3Q0KN94 (Putative lysophosphatidic acid phosphatase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.484e-33
Identity = 107/389 (27.51%), Postives = 181/389 (46.53%), Query Frame = 1
Query:  181 ELINVTVLARHGARTPNYYLDS-----RFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTM-PIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELY 1329
            +L+ V V  RHGARTP +++ S         P+ S+ L +  L P +C   DI        +  D + + ++    NK   G+LT  GQ+ A   G  L++ Y   +  L   F  ++   R+T   RT  +L+ +++G+YG +   +   P+ +    +  + L+PNP  C  +    N G+ E  K     ++K  LK ILGV++L                      C        V+Q S D      PIY VRDD  +R+   F +PNE   L PE++++ S+E+L+E+LG  ++W++ + I++S   + I +N                        +   K   +  L +CHD++++ L+  L I++G WP F ++II ELY
Sbjct:    2 KLLQVQVFFRHGARTPLFHVKSPIFPEALWTPEISTDLPHT-LFP-YCL-IDIST-QKQVQLSPDYLDKLFILPGGNKV--GELTKGGQQDAFNLGIRLKKQYKENSNFLPYTFQPSQFYLRTTFIARTIKSLRCVMAGLYGDNI--SLTEPVNFECEKLNTEILFPNPHICELLLQLFNDGVTECCKSKTFQEIKQKLKEILGVEKLL--------------------DC--------VEQRSTDYD---CPIYFVRDDYLARKYAGFPIPNELEKLLPEMHKICSEELLHEFLGKREDWKKNVHIVLSDLFSLILNN------------------------MINYKKLPQFHLYACHDSSIMLLLFGLNIFDGIWPPFAADIIFELY 327          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Cavefish
Match: acp6 (acid phosphatase 6, lysophosphatidic [Source:ZFIN;Acc:ZDB-GENE-050208-290])

HSP 1 Score: 95.5153 bits (236), Expect = 1.105e-20
Identity = 98/418 (23.44%), Postives = 160/418 (38.28%), Query Frame = 1
Query:  193 VTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVID------------EDSIQEEYMEHNKNKCSY-GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKV-----VGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNV 1392
            V VL RHGARTP   L S   +PD          + +  +  D+ E+P HT ID               +++ Y     +  +Y GQLT VG +Q    G  LR+ Y+     L   F   E+  RST   RT  + K +++G+Y     D  +   I T     + LYPN   C  +        AE S   D+      ++  LGV                                           ++++    +RDD+ +R+ H    P    S                       W  R+       I  I D  N+V     VG  L T      ++   +A+ K +   K+ L S HDTTL+P ++ L +++ +WP + ++I +ELY+ + ++  + ++   G+ Q +
Sbjct:   54 VQVLFRHGARTP---LKS---IPD----------VLEAQWVPDLLEVPNHTNIDYVVTDLQGGPRPNALVEDNYRSKKLSGGTYPGQLTTVGMQQLYDLGVRLRKRYIQDVAFLTPSFSNKEVYIRSTNIIRTIESAKCLVAGLYQQKQTDVVS---ILTEEAEREILYPNYHGCKQLKLRSGYRWAESSTLPDIASDLQSIQSALGVQ-----------------------------------------PEQHLDFILIRDDMVARETHGLPCPAVLHS-----------------------WRARVEQRAVDMIYHIYDPANRVNLQLCVGPLLHTFLNNMEMNVQNNALIKDR---KLFLYSAHDTTLMPCLMALGVFDMRWPPYAADITLELYQHRKTNQHYVKVSYVGQDQKI 385          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Nematostella
Match: EDO41028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L1])

HSP 1 Score: 96.2857 bits (238), Expect = 2.733e-21
Identity = 108/445 (24.27%), Postives = 189/445 (42.47%), Query Frame = 1
Query:  178 FELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDI--KELPAHTVID------EDSIQEEYMEH-NKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFIN----SGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALF 1473
            +EL++  +  RHGARTP Y L            +G    + D  +  D+   +LP  T+I+      +   Q EY  +  K  C  G+LT VGQ+Q    GR L++ Y+   KLL+  F  +E+  RST  PRT  + K +++G+YG ++        I T     D + PN + C  +T ++     S I +++ E    K    ++  LG+              T+KN+                                 RD + +R+ H   V          I++ +++E++    G   +   R  I        IK ++ K + E ++  ++K  ++ ++ A        KM L S HDT++  L+  L +++ +WP F S +  ELYR +  + +F ++L   K Q++         N+ D   L P++   AL 
Sbjct:   43 YELVHAQIAFRHGARTPVYRLPEM---------VGRGKGIDDVTWDKDVIMGDLP-QTMIEFRVRNIDGGDQPEYSPNIKKGGCICGELTKVGQQQTFDLGRTLQKRYIDDIKLLSPVFTPHEVYIRSTNVPRTIKSAKCVVAGLYGKENIQRVLH--IITRDEREDTILPNMSFCPLLTRWLRKIQASSIQKINLEG-YAKDHSTIRNDLGI--------------TAKNF----------------------------FFVCFRDVMSAREAHGLFVDPILHDYWDMIDQHATEELVVVQCGNLGKRFARQDI--------IKASVGKFLDEIITRMNDK--INGISPA------QHKMCLYSVHDTSISCLLTALGVFDNKWPDFASEVAFELYRNQ-DNKYFVKVLYQEKAQHLP-------GNNTD---LCPFEKFKALL 405          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Nematostella
Match: EDO35543 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL52])

HSP 1 Score: 48.9062 bits (115), Expect = 2.507e-7
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 1
Query:  406 YGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIY 588
            +GQLT +G +Q    G+ LR  YM     LN  +  N++ CRST   RT  + +  L+G+Y
Sbjct:   26 FGQLTQLGMQQEYYLGKFLRNRYMESTNFLNSSYIRNQVYCRSTDKDRTIMSAQAQLNGLY 86          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Nematostella
Match: EDO47726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLP2])

HSP 1 Score: 52.373 bits (124), Expect = 3.413e-7
Identity = 91/398 (22.86%), Postives = 147/398 (36.93%), Query Frame = 1
Query:  178 FELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDIKELPA-----HTVIDEDSIQEEYM---EHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIY--GVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVR-------DDL----YSRQVHNFEVPNEFCSLSPEINRLSSQEVLYE----YLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWP 1296
            F+L    V+ RHG R     + + +  P W       D     C  T    LPA     H ++ +   +  Y+   E +   C+ G LTL G +Q    G+ LR++Y +    L   F   E+  RS    RT  + + ++ G+Y     + D      I TM    D++ PN   C  ++ + N G                    L  D  R+      KP      +  K    NK +          +   Y+PI   R       DDL    ++ Q H F +P     ++ ++ +    E+LY     YL  S    E+ A +    I F+  +I + V E L+  S +K +                 L S HD T+ P +    + + +WP
Sbjct:   42 FKLKQTHVIIRHGDR-----VRAAYHGPCWDGDKAIWD-----CTLTS-ASLPAIKHDSHYIVVDRIYRRGYLNGRESDAGDCAIGHLTLEGYKQQELNGQILRKVY-VDTGFLKSNFSSTEMYLRSDDESRTMQSAQALILGMYPPATIASDRAQVADINTMDKLFDSIEPNTMLCPKLSEY-NHG-------------------FLKTDMWRHHYNGITKPLL---LEVQKALGSNKTL-----GSGGCSHTLYLPIAVTRKLDIDGLDDLVDCIHTHQCHGFAIPP---GITDDLFKRMVDELLYRWNSMYLYPS---REKYATV---GIGFLIKDIWQEVMESLTGESLRKFL-----------------LYSGHDGTIQPFLSAFNVTDFKWP 373          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Medaka
Match: acp6 (acid phosphatase 6, lysophosphatidic [Source:NCBI gene;Acc:101172206])

HSP 1 Score: 90.5077 bits (223), Expect = 4.595e-19
Identity = 93/419 (22.20%), Postives = 159/419 (37.95%), Query Frame = 1
Query:  178 FELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDIKEL---PAHTVID------------EDSIQEEYMEHNKNKCSY-GQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQ 1386
            +EL  V V+ RHGARTP                   +  +PD   +  +  L   P HT ID               I++ Y ++     ++ GQLT +G +Q    G  LRR Y+     LN  F   E+  RST   RT  + + +++G++     +      I T P   + LYPN   C  +    +   AE S   D+      +   LG+     VD                                            +RDD+ +R+ H    P         + + +   +L+ +   +    E + + V P ++ + DN+     E L   S +                 K+ L S HDTTLIP ++ L I++ +WP + ++I +EL++ + ++  F ++   G+ Q
Sbjct:   42 YELRLVQVVFRHGARTP-------------------LKTIPDVMEARWVPALLDPPPHTHIDYVVTDLQGGPRPPAPIEDNYRKNILTGGTFPGQLTTLGMQQLYDLGSRLRRRYVEERSFLNSSFTPAEVYVRSTNIVRTIESARCLIAGLFQQKQKETVP---ILTTPAESEILYPNYHGCKLLKARCSHRWAESSTLPDIAADLQRIHSALGIAAHHRVD-----------------------------------------FILIRDDMVARETHGLPSPPALEPWRDTVEQRAVDMMLHVFQPSN---RENLQLSVGPLLHTLLDNME----ENLQGGSSEP--------------NRKLFLYSAHDTTLIPCLMALGIFDKKWPPYGADITVELHQSQQTNEPFVKVSYMGEDQ 376          
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Planmine SMEST
Match: SMESG000000025.1 (SMESG000000025.1)

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 517/517 (100.00%), Postives = 517/517 (100.00%), Query Frame = 1
Query:   22 MFYRRILPVATGVAVIAGGYFSLNFPGSNTQYKGARLNDHGLKNYSFVDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDKILKLFKDRKPITKDQYA 1572
            MFYRRILPVATGVAVIAGGYFSLNFPGSNTQYKGARLNDHGLKNYSFVDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDKILKLFKDRKPITKDQYA
Sbjct:    1 MFYRRILPVATGVAVIAGGYFSLNFPGSNTQYKGARLNDHGLKNYSFVDSRKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTDIKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRIYMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRPIIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRILGVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIPIYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEERIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKMQLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILNDGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDKILKLFKDRKPITKDQYA 517          
The following BLAST results are available for this feature:
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ACP61.249e-2023.36acid phosphatase 6, lysophosphatidic [Source:HGNC ... [more]
ACP63.335e-826.39acid phosphatase 6, lysophosphatidic [Source:HGNC ... [more]
ACP61.118e-629.32acid phosphatase 6, lysophosphatidic [Source:HGNC ... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pho-43.040e-632.69Intestinal acid PHOsphatase [Source:UniProtKB/TrE... [more]
pho-43.040e-632.69Intestinal acid PHOsphatase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
acp63.998e-2422.70acid phosphatase 6, lysophosphatidic [Source:ZFIN;... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
akr1b11.330e-1622.46aldo-keto reductase family 1, member B1 (aldose re... [more]
akr1b11.362e-1622.46aldo-keto reductase family 1, member B1 (aldose re... [more]
akr1b11.650e-1622.46aldo-keto reductase family 1, member B1 (aldose re... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Acp61.522e-2224.34acid phosphatase 6, lysophosphatidic [Source:MGI S... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6H757|PPA6_BOVIN2.138e-2424.67Lysophosphatidic acid phosphatase type 6 OS=Bos ta... [more]
sp|Q8BP40|PPA6_MOUSE1.064e-2124.34Lysophosphatidic acid phosphatase type 6 OS=Mus mu... [more]
sp|Q9NPH0|PPA6_HUMAN5.998e-2023.36Lysophosphatidic acid phosphatase type 6 OS=Homo s... [more]
sp|Q5R8C0|PPA6_PONAB2.598e-1922.91Lysophosphatidic acid phosphatase type 6 OS=Pongo ... [more]
sp|Q54PR9|CF60_DICDI4.797e-1028.65Counting factor 60 OS=Dictyostelium discoideum OX=... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7YKU41.631e-4028.87Putative acid phosphatase 6 (Fragment) OS=Clonorch... [more]
A0A4S2M3I61.439e-3626.73Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M8681.567e-3626.73Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2D2R51.446e-3326.28Lysophosphatidic acid phosphatase type 6 isoform 1... [more]
A0A3Q0KN941.484e-3327.51Putative lysophosphatidic acid phosphatase OS=Schi... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
acp61.105e-2023.44acid phosphatase 6, lysophosphatidic [Source:ZFIN;... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO410282.733e-2124.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355432.507e-737.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477263.413e-722.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
acp64.595e-1922.20acid phosphatase 6, lysophosphatidic [Source:NCBI ... [more]
back to top
BLAST of Lysophosphatidic acid phosphatase type 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000025.10.000e+0100.00SMESG000000025.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015365 ID=SMED30015365|Name=Lysophosphatidic acid phosphatase type 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1803bp
TGAAAATTTAAAATATATTATATGTTTTATCGCAGAATTTTACCGGTTGC
AACAGGTGTCGCAGTAATAGCTGGAGGATATTTTTCGTTAAATTTTCCTG
GTTCCAATACTCAATACAAAGGTGCTCGACTAAATGATCACGGATTAAAA
AATTATTCTTTCGTTGATAGTCGTAAATTCGAATTGATTAACGTAACAGT
TTTAGCTAGACATGGCGCGAGGACACCGAACTATTATTTAGATTCAAGAT
TTGATATGCCCGATTGGTCAAGTGGATTGGGATATGTTGATCTGTTGCCA
GATTTTTGCTATTCGACAGATATCAAAGAATTGCCAGCTCATACAGTAAT
TGACGAAGACTCGATTCAAGAGGAATATATGGAACACAATAAAAATAAAT
GCTCATATGGCCAACTGACATTAGTTGGCCAGGAACAAGCTATCGCCTTT
GGTAGGGAACTTCGGAGAATTTATATGATGGGAAATAAGCTATTAAATGA
CAAATTTGATGAAAATGAAATTTTATGTCGCTCGACGAAATTTCCACGGA
CATTTTATACTCTGAAAGGAATATTGAGTGGAATCTATGGGGTAGATTCG
TTTGATGCATGCAACAGACCGATAATATATACAATGCCGATTGCAATGGA
TAATTTATATCCCAATCCTGCGGCTTGTTCGGCTGTAACTCCATTTATAA
ACTCAGGAATCGCGGAAGTGTCTAAAGAGGCCGATGTAATGAAAATGAAA
TGCATATTGAAGCGAATTTTAGGAGTTGACCGATTGAGATATGTAGATCC
TAACAAACCTAAGCCTACAACATCAAAAAATTATGACAAAAGTAAAGAAA
GGTGTAAAAATAAAGAAATAGAAAAGGAAGTAAAACAGGAATCGGAAGAT
ACAAGTGACGAATATATTCCTATTTATGCAGTTCGTGATGATTTATATTC
TCGCCAAGTACACAATTTTGAAGTACCGAATGAATTTTGTAGCTTAAGCC
CAGAAATAAATAGACTTTCATCTCAAGAAGTTCTTTATGAATATTTAGGA
GGGTCTGATGAATGGGAGGAACGAATCGCTATTATCGTGTCACCGACAAT
TAACTTCATTAAAGACAACATAAACAAAGTAGTTGGCGAGTGCCTTTCGA
CTTCAAGCGAAAAGAAATGTGTTTCCAAATTGACGGATGCTATTACGAAA
AAAAAAGGCACAATGAAAATGCAGCTATTATCATGCCATGATACAACCCT
GATACCATTAATGGTTTGTCTTCGAATCTATGAAGGGCAGTGGCCGGCTT
TCATGTCAAATATTATAATAGAACTCTATCGAGAAAAATCATCGAGCAAC
TTTTTTGCTCGCATTTTAAACGATGGCAAAGTGCAAAATGTGAAACTATC
GGAAAAATCCTGCACTTCAAATGATTACGATAAACAGGGACTCATACCAT
ATGATGATTTAATGGCATTATTTGACAAATACTCATTCCCAGATCACAAA
TACGGAAATGCATGCGATAAAATTTTGAAACTGTTCAAAGATCGGAAACC
GATCACCAAAGATCAATATGCTTAAAGGTTCAAATGAGAGATTACTTTTT
TGCAAGATATCATTATTCTTCTTAGAAAATAATTATCAGCTTTTTTTCAA
TATTCATTTCTTTTTTAATTTTTATATTTCAGGTTATCGTTTTTAAAAAT
GCGTGCTTTAGTTTTGATTTCAATTTTAAAATAAAATATTATTTATTTAT
TCTGCTATTTTTTCCAAATTTACAGATTTTCATTTGTATTTCAACGATTT
TAG
back to top

protein sequence of SMED30015365-orf-1

>SMED30015365-orf-1 ID=SMED30015365-orf-1|Name=SMED30015365-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=518bp
MFYRRILPVATGVAVIAGGYFSLNFPGSNTQYKGARLNDHGLKNYSFVDS
RKFELINVTVLARHGARTPNYYLDSRFDMPDWSSGLGYVDLLPDFCYSTD
IKELPAHTVIDEDSIQEEYMEHNKNKCSYGQLTLVGQEQAIAFGRELRRI
YMMGNKLLNDKFDENEILCRSTKFPRTFYTLKGILSGIYGVDSFDACNRP
IIYTMPIAMDNLYPNPAACSAVTPFINSGIAEVSKEADVMKMKCILKRIL
GVDRLRYVDPNKPKPTTSKNYDKSKERCKNKEIEKEVKQESEDTSDEYIP
IYAVRDDLYSRQVHNFEVPNEFCSLSPEINRLSSQEVLYEYLGGSDEWEE
RIAIIVSPTINFIKDNINKVVGECLSTSSEKKCVSKLTDAITKKKGTMKM
QLLSCHDTTLIPLMVCLRIYEGQWPAFMSNIIIELYREKSSSNFFARILN
DGKVQNVKLSEKSCTSNDYDKQGLIPYDDLMALFDKYSFPDHKYGNACDK
ILKLFKDRKPITKDQYA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029033His_PPase_superfam
IPR000560His_Pase_clade-2
IPR033379Acid_Pase_AS
Vocabulary: molecular function
TermDefinition
GO:0003993acid phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 273..293
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 261..290
NoneNo IPR availablePANTHERPTHR11567:SF1252-PHOSPHOXYLOSE PHOSPHATASE 1coord: 46..498
NoneNo IPR availablePANTHERPTHR11567ACID PHOSPHATASE-RELATEDcoord: 46..498
IPR000560Histidine phosphatase superfamily, clade-2PFAMPF00328His_Phos_2coord: 54..449
e-value: 6.9E-16
score: 58.6
IPR029033Histidine phosphatase superfamilyGENE3DG3DSA:3.40.50.1240coord: 258..506
e-value: 4.1E-29
score: 104.0
coord: 41..257
e-value: 5.9E-31
score: 110.0
IPR029033Histidine phosphatase superfamilySUPERFAMILYSSF53254Phosphoglycerate mutase-likecoord: 54..498
IPR033379Histidine acid phosphatase active sitePROSITEPS00616HIS_ACID_PHOSPHAT_1coord: 55..69