Phospholipase A2

Overview
NamePhospholipase A2
Smed IDSMED30015364
Length (bp)870
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipase A2 (SMED30015364) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipase A2 (SMED30015364) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipase A2 (SMED30015364) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipase A2 (SMED30015364) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015364

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015364SMESG000048502.1 Contig3392GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30015364SMESG000048503.1 SMESG000048502.1 dd_Smed_v4_3851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015364SMESG000048503.1 SMESG000048502.1 dd_Smed_v4_3851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015364SMESG000048503.1 SMESG000048502.1 dd_Smed_v6_3851_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30015364SMESG000048503.1 SMESG000048502.1 dd_Smed_v6_3851_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipase A2 vs. Ensembl Human
Match: PLA2G3 (phospholipase A2 group III [Source:HGNC Symbol;Acc:HGNC:17934])

HSP 1 Score: 86.6557 bits (213), Expect = 1.698e-18
Identity = 39/105 (37.14%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  378 FPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWY 692
             PGT WCG G+ A N ++ G     D CC+ HDRCP +I      +  +N   +T+  C CD  F  CL+  +   SD +G  FFN + + CF  E    C++WY
Sbjct:  153 MPGTLWCGVGDSAGNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVLEIPCFVLEEQEACVAWY 257          
BLAST of Phospholipase A2 vs. Ensembl Fly
Match: CG3009 (gene:FBgn0029720 transcript:FBtr0332316)

HSP 1 Score: 108.612 bits (270), Expect = 5.400e-28
Identity = 55/171 (32.16%), Postives = 92/171 (53.80%), Query Frame = 3
Query:  159 NNKTTQILLEMSTGELKC-FKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIIS---KCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQ 659
            ++ T  +++E+S+    C   TD+G I+ +       L S  +R   V  ++++     C    ++    R  L  I+PGTKWCGPG  A + +D G     D+CC+ HD CP+ +  G+ +    N+ ++T   C CD  F  CL+ ANTE ++ +G +F+N V++ CFQ
Sbjct:   33 SDMTMSVMVELSSRHPFCKMHTDRGDIQRML------LQSDPRRIRQVPRESVMELEEVCRRQGSYGHEFRGGLGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTFTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQ 197          
BLAST of Phospholipase A2 vs. Ensembl Fly
Match: CG3009 (gene:FBgn0029720 transcript:FBtr0070688)

HSP 1 Score: 108.612 bits (270), Expect = 3.685e-27
Identity = 55/171 (32.16%), Postives = 92/171 (53.80%), Query Frame = 3
Query:  159 NNKTTQILLEMSTGELKC-FKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIIS---KCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQ 659
            ++ T  +++E+S+    C   TD+G I+ +       L S  +R   V  ++++     C    ++    R  L  I+PGTKWCGPG  A + +D G     D+CC+ HD CP+ +  G+ +    N+ ++T   C CD  F  CL+ ANTE ++ +G +F+N V++ CFQ
Sbjct:   33 SDMTMSVMVELSSRHPFCKMHTDRGDIQRML------LQSDPRRIRQVPRESVMELEEVCRRQGSYGHEFRGGLGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTFTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQ 197          
BLAST of Phospholipase A2 vs. Ensembl Fly
Match: CG3009 (gene:FBgn0029720 transcript:FBtr0300468)

HSP 1 Score: 108.612 bits (270), Expect = 3.685e-27
Identity = 55/171 (32.16%), Postives = 92/171 (53.80%), Query Frame = 3
Query:  159 NNKTTQILLEMSTGELKC-FKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIIS---KCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQ 659
            ++ T  +++E+S+    C   TD+G I+ +       L S  +R   V  ++++     C    ++    R  L  I+PGTKWCGPG  A + +D G     D+CC+ HD CP+ +  G+ +    N+ ++T   C CD  F  CL+ ANTE ++ +G +F+N V++ CFQ
Sbjct:   33 SDMTMSVMVELSSRHPFCKMHTDRGDIQRML------LQSDPRRIRQVPRESVMELEEVCRRQGSYGHEFRGGLGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECRRGLCNRGTFTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQ 197          
BLAST of Phospholipase A2 vs. Ensembl Fly
Match: CG42237 (gene:FBgn0250862 transcript:FBtr0340302)

HSP 1 Score: 107.457 bits (267), Expect = 5.091e-27
Identity = 50/118 (42.37%), Postives = 67/118 (56.78%), Query Frame = 3
Query:  303 NKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECF 656
            N  +  K   N  F R+  S+L  I PGTKWCG G+IA+  +D G E+  D+CC+ HD CP  IR+   K+   N   YT   C CDD  + CLK  NT AS  +G ++FN V++ C 
Sbjct:  177 NDGVALKLATN-IFPRSPFSLLSGIIPGTKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTKSHCICDDMLFSCLKMTNTSASQLMGSIYFNLVQVPCL 293          
BLAST of Phospholipase A2 vs. Ensembl Fly
Match: CG42237 (gene:FBgn0250862 transcript:FBtr0073722)

HSP 1 Score: 106.686 bits (265), Expect = 2.309e-26
Identity = 50/118 (42.37%), Postives = 67/118 (56.78%), Query Frame = 3
Query:  303 NKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECF 656
            N  +  K   N  F R+  S+L  I PGTKWCG G+IA+  +D G E+  D+CC+ HD CP  IR+   K+   N   YT   C CDD  + CLK  NT AS  +G ++FN V++ C 
Sbjct:  231 NDGVALKLATN-IFPRSPFSLLSGIIPGTKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTKSHCICDDMLFSCLKMTNTSASQLMGSIYFNLVQVPCL 347          
BLAST of Phospholipase A2 vs. Ensembl Zebrafish
Match: proca1 (protein interacting with cyclin A1 [Source:ZFIN;Acc:ZDB-GENE-110418-1])

HSP 1 Score: 90.5077 bits (223), Expect = 7.886e-20
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 3
Query:  348 RTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLS--WY 692
            RTKR      +PGT WCG GNIA +    GE  E D+CC+VHD CP  I +  + + + N   ++L  C CD+    CL+  N  +S  +G+ FFN + + CF+      C+   WY
Sbjct:  147 RTKRGF---TYPGTLWCGAGNIADHYEQLGEFEETDRCCRVHDHCPYVIHAFSSNYGYTNFKWHSLSHCDCDNALKECLRLVNDTSSRVVGQAFFNVIEVPCFEFSFEEQCVERHWY 260          
BLAST of Phospholipase A2 vs. Ensembl Zebrafish
Match: pla2g3 (phospholipase A2 group III [Source:ZFIN;Acc:ZDB-GENE-051113-96])

HSP 1 Score: 84.3445 bits (207), Expect = 8.061e-18
Identity = 45/121 (37.19%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  297 VENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQ 659
            VE    + + +  S+ K  +RS    + PGT WCG GN A    D G   E DKCC+ HD C ++I S        N   +TL  C CD+ F  CL   N   S+ +G  FFN ++M CF+
Sbjct:  133 VEPDGFVEQDSDVSSIKTLQRSKRAWMIPGTLWCGSGNKATGWTDLGVFEETDKCCREHDHCKHTIPSFSYDHGVFNTNLFTLSHCDCDNRFRRCLLGVNNSMSNLVGYGFFNVLKMSCFE 253          
BLAST of Phospholipase A2 vs. Ensembl Zebrafish
Match: CU459012.1 (group 3 secretory phospholipase A2-like [Source:NCBI gene;Acc:101885160])

HSP 1 Score: 75.8702 bits (185), Expect = 4.069e-15
Identity = 38/104 (36.54%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  348 RTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQ 659
            R+KR+    + PGT WCG G  A +    G    AD+CC+ HD C + IRS    +   N   +T+  C CD  F  CL   N   S+ +G  FFN +++ CF+
Sbjct:  148 RSKRAW---VLPGTLWCGRGTNANDYEQLGMFEHADRCCREHDHCEHIIRSFSVNFGVFNPTFFTVSHCDCDHRFKQCLLGGNDTISNMVGYSFFNVLKIRCFE 248          
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Match: uri1 (URI1 prefoldin-like chaperone [Source:Xenbase;Acc:XB-GENE-960711])

HSP 1 Score: 95.1301 bits (235), Expect = 1.788e-21
Identity = 44/124 (35.48%), Postives = 67/124 (54.03%), Query Frame = 3
Query:  342 FKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCR 713
             +R KR      +PGT WCG GN A+   D GE    D CC+ HD C + I     ++ ++N L +T+  C CD +F  CL+  N  AS  +G+ F+N +++ CF+    + C+  Y  G WC+
Sbjct:  119 LRRVKRGF---TYPGTLWCGAGNNAETFEDLGEHTATDACCRTHDHCAHVIHPFSYRYGYRNYLWHTISHCQCDTQFKDCLRRVNDTASRVVGQAFYNVIKVPCFEFMYKSQCVERYWYG-WCK 238          
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Match: ENSXETT00000036327.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:131649089:131653788:-1 gene:ENSXETG00000016424.1 transcript:ENSXETT00000036327.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 4.752e-17
Identity = 38/107 (35.51%), Postives = 54/107 (50.47%), Query Frame = 3
Query:  381 PGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPG 701
            PGT WCG G+ A N  + GE+I      Q HD C + I +   ++  +N   +T+  C CD  F LCL   N   S  +G +FFN + M CF  +    C+ W+  G
Sbjct:    2 PGTLWCGAGSSADNFTNLGEKIHP----QEHDHCSHQIEAFQFQYGMRNYRLHTVSHCDCDQRFRLCLNAFNDTISTLVGIMFFNILEMPCFSLKEEEQCVEWFWWG 104          
BLAST of Phospholipase A2 vs. Ensembl Mouse
Match: Pla2g3 (phospholipase A2, group III [Source:MGI Symbol;Acc:MGI:2444945])

HSP 1 Score: 82.8037 bits (203), Expect = 2.117e-17
Identity = 37/104 (35.58%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  378 FPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSW 689
             PGT WCG GN A+N ++ G     D CC+ HD+CP +I      +  +N   +T+  C CD  F  CL+      SD +G  FFN + + CF  +    C++W
Sbjct:  149 IPGTLWCGVGNSAENASELGVFHGPDLCCREHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARFQQCLRSQGDSISDIMGVAFFNVLEIPCFVLKEQEACVAW 252          
BLAST of Phospholipase A2 vs. Ensembl Mouse
Match: Pla2g3 (phospholipase A2, group III [Source:MGI Symbol;Acc:MGI:2444945])

HSP 1 Score: 82.8037 bits (203), Expect = 2.208e-17
Identity = 37/104 (35.58%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  378 FPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSW 689
             PGT WCG GN A+N ++ G     D CC+ HD+CP +I      +  +N   +T+  C CD  F  CL+      SD +G  FFN + + CF  +    C++W
Sbjct:  149 IPGTLWCGVGNSAENASELGVFHGPDLCCREHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARFQQCLRSQGDSISDIMGVAFFNVLEIPCFVLKEQEACVAW 252          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q9BMK4|PA2_APICC (Phospholipase A2 OS=Apis cerana cerana OX=94128 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.039e-22
Identity = 39/98 (39.80%), Postives = 60/98 (61.22%), Query Frame = 3
Query:  375 IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDK-IGKLFFNFVRMECFQTE 665
            I+PGT WCG GN++   N+ G     D CC+ HD CP+ + +G++K    N  S+T + C CDD FY CLK +  + S   +GK++FN +  +C++ E
Sbjct:    2 IYPGTLWCGHGNVSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDTFYDCLKNSGDKISSYFVGKMYFNLIDTKCYKLE 99          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|P00630|PA2_APIME (Phospholipase A2 OS=Apis mellifera OX=7460 PE=1 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 4.001e-22
Identity = 41/98 (41.84%), Postives = 62/98 (63.27%), Query Frame = 3
Query:  375 IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLK-EANTEASDKIGKLFFNFVRMECFQTE 665
            I+PGT WCG GN +   N+ G     D CC+ HD CP+ + +G++K    N  S+T + C CDD+FY CLK  A+T +S  +GK++FN +  +C++ E
Sbjct:   35 IYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLE 132          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q7M4I5|PA2_APIDO (Phospholipase A2 OS=Apis dorsata OX=7462 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.467e-21
Identity = 38/98 (38.78%), Postives = 64/98 (65.31%), Query Frame = 3
Query:  375 IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLK-EANTEASDKIGKLFFNFVRMECFQTE 665
            I+PGT WCG GN++ + ++ G     D CC+ HD CP+ + +G++K    N  S+T + C CDD+FY CLK  ++T +S  +G+++FN +  +C++ E
Sbjct:    2 IYPGTLWCGHGNVSSSPDELGRFKHTDSCCRSHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSSDTISSYFVGEMYFNILDTKCYKLE 99          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|I7GQA7|PA2_XYLAI (Phospholipase A(2) OS=Xylocopa appendiculata circumvolans OX=135722 GN=PLA2 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.314e-21
Identity = 41/103 (39.81%), Postives = 58/103 (56.31%), Query Frame = 3
Query:  375 IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCL 683
            IF GTKWCG GN+A+   D G   E D CC+ HD CP+ I +G +K    N  SYT + C CD++FY CLK ++   S  +   +F  +   C++ E    C+
Sbjct:   41 IFVGTKWCGNGNVAEGPEDLGSLKETDACCREHDMCPDLIEAGQSKHGLTNTASYTRLNCACDEKFYNCLKNSSETGSGAVRFTYFTLLGTMCYRNEHPLICV 143          
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Match: sp|P16354|PA23_HELSU (Phospholipase A2 isozymes PA3A/PA3B/PA5 OS=Heloderma suspectum OX=8554 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 1.478e-19
Identity = 38/105 (36.19%), Postives = 58/105 (55.24%), Query Frame = 3
Query:  375 IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSW 689
            I PGT WCG GN A + +  G E + D CC+ HD C N I + + K   +N    T+  C CD++F  CL +     +D +G+ +FN +++ CF+ E    C+ W
Sbjct:    4 IMPGTLWCGAGNAASDYSQLGTEKDTDMCCRDHDHCENWISALEYKHGMRNYYPSTISHCDCDNQFRSCLMKLKDGTADYVGQTYFNVLKIPCFELEEGEGCVDW 108          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A212FMH8 (Phospholipase A2D OS=Danaus plexippus plexippus OX=278856 GN=KGM_207005 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 3.136e-29
Identity = 62/153 (40.52%), Postives = 88/153 (57.52%), Query Frame = 3
Query:  282 KRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVK 740
            ++ FL E +A  S+   + T +   R     I+PGTKWCGPGNIA N +D G   EAD CC+ HD CP+SI +G+T++N  N   YT + C CD+ F  CL+ A T ++  IG ++FN +  +CF+ +          P   C+RKG  LG K
Sbjct:   31 EKNFLEEMEA--SEEDYDLTPEELARLRFSLIYPGTKWCGPGNIADNYDDLGTSKEADICCRNHDNCPDSIPAGETRFNLTNDAYYTRLSCECDESFRQCLRNATTRSARAIGLMYFNVIGTQCFRDDY---------PVTGCKRKGGWLGTK 172          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A0C9S3A5 (TSA: Tityus bahiensis Tbah00274 mRNA sequence (Fragment) OS=Tityus bahiensis OX=50343 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 3.624e-28
Identity = 65/168 (38.69%), Postives = 94/168 (55.95%), Query Frame = 3
Query:  231 LIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTK------RSILQR--IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEV-INTCL-SWYIPGV 704
            ++  + +  + ++   E  K + +  A++ +     TFK  K      R I +   IFPGTKWCG G++A + +D G  IE D CC+ HD C NSI    TK++ KNK  YT   C CD+EF+ CLK+  T  SD +G LFFN ++ +CF+ +  I  CL  W IP V
Sbjct:    1 MLDIVPQSLVKNVPKEEMSKLVNKCNALLYRKVREGTFKIIKTPYDFARKIFKSVLIFPGTKWCGAGDVADDYDDLGPAIETDMCCRTHDHCNNSIEGFKTKYDLKNKDFYTKSHCDCDNEFHQCLKDGETLISDAVGHLFFNILQTQCFKKDYPIVKCLKKWGIPIV 168          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A4Y2KMI8 (Phospholipase A2 OS=Araneus ventricosus OX=182803 GN=PA2_1 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.787e-28
Identity = 50/102 (49.02%), Postives = 70/102 (68.63%), Query Frame = 3
Query:  375 IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTC 680
            I+PGTKWCG GN+A +++D G E E DKCC+ HD+C + I  G+TK+N  NK SY  + C CD++FY CL+ ANT +S+ +G L+FNF   +CF  +    C
Sbjct:  108 IYPGTKWCGVGNVAASDDDLGPEEETDKCCRTHDKCRDFISGGETKYNLTNKSSYVSLSCECDNKFYECLRRANTISSNSVGFLYFNFFARKCFSLDYPKKC 209          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A5E4QIA7 (PA2c domain-containing protein (Fragment) OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS9055 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 4.921e-27
Identity = 51/130 (39.23%), Postives = 82/130 (63.08%), Query Frame = 3
Query:  297 VENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEV-INTCL 683
            V N+ +++    +      K   +  I+PGTKWCG G+ A   +D G+E+EADKCC+ HD CP+ I +G+TK+N  N   Y+ + C CD++F  CL+ ANT++S+ IG ++FN +  +C++ +  I  CL
Sbjct:   24 VFNEGMVTNAKNDKKMTHLKDLKISFIYPGTKWCGTGDTASGYDDLGKEVEADKCCRDHDFCPDVITAGETKYNLTNTAYYSRLACSCDEKFLKCLEAANTKSSNSIGNVYFNVLGTKCYKKDYPITGCL 153          
BLAST of Phospholipase A2 vs. TrEMBL
Match: A0A2W1BZG9 (PA2c domain-containing protein OS=Helicoverpa armigera OX=29058 GN=HaOG201956 PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 6.386e-27
Identity = 52/125 (41.60%), Postives = 78/125 (62.40%), Query Frame = 3
Query:  366 LQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVK 740
            +  I+PGTKWCG GNIA N +D G E EAD CC+ HD+CP++I  G TK+N  N++ YT + C CD++F  CL+ A T+ +  IG ++FN ++ +CF+ +          P   C+++G  L  K
Sbjct:   56 INLIYPGTKWCGAGNIADNYDDLGTEREADMCCRDHDKCPDTIPGGQTKYNLTNEVFYTRLSCKCDNKFLKCLRSAKTKTAKYIGMIYFNALQTKCFRNDY---------PVTECKKRGGWLNSK 171          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: proca1 (uncharacterized LOC103023370 [Source:NCBI gene;Acc:103023370])

HSP 1 Score: 95.5153 bits (236), Expect = 1.046e-21
Identity = 48/127 (37.80%), Postives = 71/127 (55.91%), Query Frame = 3
Query:  342 FKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLS--WYIPGVWCRR 716
             +R+KR      +PGT WCG GNIA+N +  GE  E DKCC+ HD CP+ I +  + + + N   ++L  C CD+    CL+  N  +S  +G+ FFN + + CF+      C+   WY  GV C+R
Sbjct:  157 LRRSKRGF---TYPGTLWCGAGNIAENYDQLGEFAETDKCCRTHDHCPHVIHAFSSNYGYTNFKWHSLSHCDCDNALKKCLRVVNDTSSRVVGQAFFNVIEVPCFEFAFEEQCVERHWY--GV-CKR 277          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: proca1 (uncharacterized LOC103023370 [Source:NCBI gene;Acc:103023370])

HSP 1 Score: 92.0485 bits (227), Expect = 4.018e-21
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  342 FKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRR 716
             +R+KR      +PGT WCG GNIA+N +  GE  E DKCC+ HD CP+ I +  + + + N   ++L  C CD+    CL+  N  +S  +G+ FFN + + CF+      C+  +  GV C+R
Sbjct:  147 LRRSKRGF---TYPGTLWCGAGNIAENYDQLGEFAETDKCCRTHDHCPHVIHAFSSNYGYTNFKWHSLSHCDCDN----CLRVVNDTSSRVVGQAFFNVIEVPCFEFAFEEQCVERHWYGV-CKR 263          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: ENSAMXT00000053537.1 (uncharacterized LOC103036138 [Source:NCBI gene;Acc:103036138])

HSP 1 Score: 73.1738 bits (178), Expect = 3.305e-14
Identity = 37/108 (34.26%), Postives = 52/108 (48.15%), Query Frame = 3
Query:  375 IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTC--LSWY 692
            I PGT WCG G+ A      G    AD+CC+ HD C + IR     +   N   +T+  C CD  F  CL   N   S+ +G  FF+ +++ CF       C  L+W+
Sbjct:  143 ILPGTLWCGRGSSAGEYEQLGMFELADRCCREHDHCSHIIRPFTVNYGVFNPSFFTISHCDCDYRFKQCLLNVNDSVSNMVGYTFFHILKLRCFDLIKKRRCTQLNWF 250          
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Match: ENSAMXT00000057577.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:581752:584954:1 gene:ENSAMXG00000036121.1 transcript:ENSAMXT00000057577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 1.403e-9
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 3
Query:  459 CCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQ----TEVINT 677
            CC+ HD C +SI S    +   N   +TL  C CD +F  CL +AN   ++ +G  +FN ++M CF+     E +NT
Sbjct:    2 CCREHDHCKDSITSFGFNYGVLNTNIFTLSHCDCDKKFQQCLHKANDSMANVVGYGYFNVLKMRCFEFAERMECVNT 78          
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005482.1 (pep scaffold:Pmarinus_7.0:GL479025:28110:33430:-1 gene:ENSPMAG00000004987.1 transcript:ENSPMAT00000005482.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 4.971e-22
Identity = 42/115 (36.52%), Postives = 64/115 (55.65%), Query Frame = 3
Query:  378 FPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWY----IPGVWC 710
            +PGT WCGPG  A + ++ G   + D CC+ HD CP++I   + K+ + N   +T+  C CD +F  C+KE+N  A+  IG+ +F+ V + CF       C+ W     I G WC
Sbjct:    1 YPGTLWCGPGTNANSFDELGSYKKTDICCREHDHCPHAIGGFEHKYGYNNIGWHTISHCDCDTKFRKCMKESNDTAAWDIGRTYFSIVGVPCFTLREDEACVDWSWWAGIDGEWC 115          
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008222.1 (pep scaffold:Pmarinus_7.0:GL489691:3482:6078:1 gene:ENSPMAG00000007437.1 transcript:ENSPMAT00000008222.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 6.164e-10
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 3
Query:  378 FPGTKWCGPGNIAQNENDYG----EEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCD 563
            +PGT WCG GN A N +  G    E  E D+CC+ HD C + I +   K+  +N   +T+  C CD
Sbjct:    4 YPGTLWCGAGNSADNFDQLGAPTGEFEETDRCCRDHDHCEHVIDAFRYKYGHRNLRWHTISHCACD 69          
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Match: EDO41374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S7])

HSP 1 Score: 94.3597 bits (233), Expect = 1.345e-24
Identity = 41/94 (43.62%), Postives = 56/94 (59.57%), Query Frame = 3
Query:  381 PGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIR--SGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECF 656
            PGTKWCG GNIA + +D G     D CC+ HDRCP+SI        +N+ N   Y++  C CD  FY CL    + A+  +GK+FFN +++ CF
Sbjct:    1 PGTKWCGAGNIADSHSDLGHHRMTDACCRTHDRCPHSIPPLQVSKTYNYFNFRPYSISHCKCDQAFYACLASVGSNAAKDVGKVFFNILKVPCF 94          
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Match: EDO47530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM30])

HSP 1 Score: 80.8777 bits (198), Expect = 1.283e-19
Identity = 38/90 (42.22%), Postives = 59/90 (65.56%), Query Frame = 3
Query:  375 IFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTE-ASDKIGKLFFNFV 641
            IFPGT WCG GN A+N +D GE  + D+CC+ HD CPN I   + K++F N   +TL++C C+   + CL   + E A+  +G+++FN++
Sbjct:    1 IFPGTNWCGSGNDAKNFDDLGEFNKTDQCCREHDYCPNWIPPFERKFDFFNFSPFTLLDCKCETRLFNCLWGVDDEQAAIFVGRMYFNYI 90          
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Match: EDO40621 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6V0])

HSP 1 Score: 48.9062 bits (115), Expect = 1.377e-6
Identity = 25/81 (30.86%), Postives = 40/81 (49.38%), Query Frame = 3
Query:  438 EEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTC 680
            EEIE  KCC  HD+CP               +  T ++C C++ FY CLK++    ++ +G  +FN     C+Q   ++ C
Sbjct:  524 EEIE--KCCIAHDQCP-----------LIKIMGVTALDCQCENAFYACLKQSGAAIANTVGLQYFNASPRNCYQYTQVSVC 591          
BLAST of Phospholipase A2 vs. Ensembl Medaka
Match: pla2g3 (group 3 secretory phospholipase A2-like [Source:NCBI gene;Acc:105355175])

HSP 1 Score: 93.9745 bits (232), Expect = 3.824e-21
Identity = 46/107 (42.99%), Postives = 61/107 (57.01%), Query Frame = 3
Query:  336 STFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECF 656
            S   R KR     I PGT WCG GN A +  D G   + D CC+ HD+C ++I S  +++   N   +T+  C CDD F+ CLKEAN   SD +G  FFN ++M CF
Sbjct:  172 SAHLRVKRGF---IVPGTLWCGSGNKAPSFEDLGVFSDTDSCCREHDQCQHTILSFQSEFGVFNSNIFTMSHCDCDDRFHGCLKEANDSISDVVGYTFFNLLKMHCF 275          
BLAST of Phospholipase A2 vs. Ensembl Medaka
Match: pla2g3 (group 3 secretory phospholipase A2-like [Source:NCBI gene;Acc:105355175])

HSP 1 Score: 93.2041 bits (230), Expect = 5.377e-21
Identity = 46/107 (42.99%), Postives = 61/107 (57.01%), Query Frame = 3
Query:  336 STFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECF 656
            S   R KR     I PGT WCG GN A +  D G   + D CC+ HD+C ++I S  +++   N   +T+  C CDD F+ CLKEAN   SD +G  FFN ++M CF
Sbjct:  143 SAHLRVKRGF---IVPGTLWCGSGNKAPSFEDLGVFSDTDSCCREHDQCQHTILSFQSEFGVFNSNIFTMSHCDCDDRFHGCLKEANDSISDVVGYTFFNLLKMHCF 246          
BLAST of Phospholipase A2 vs. Ensembl Medaka
Match: proca1 (protein interacting with cyclin A1 [Source:NCBI gene;Acc:101162698])

HSP 1 Score: 84.3445 bits (207), Expect = 6.173e-18
Identity = 40/122 (32.79%), Postives = 64/122 (52.46%), Query Frame = 3
Query:  333 NSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLS--WY 692
            N + K ++RS     +PGT WCG GN+A + N  GE  + D CC+ HD C + I    + + + N    ++  C CD+    CL++ N  +S  +G+ FFN + + CF+      C+   WY
Sbjct:  131 NQSAKASRRSKRGFTYPGTLWCGAGNMADHYNQLGEFAQTDSCCRTHDHCQHVIHPFSSNFGYTNFKWLSISHCDCDETLKECLRKVNDTSSRVVGQAFFNVLTVPCFEFAYEEQCVERHWY 252          
BLAST of Phospholipase A2 vs. Ensembl Medaka
Match: ENSORLT00000015007.2 (group 3 secretory phospholipase A2 [Source:NCBI gene;Acc:101173712])

HSP 1 Score: 81.6481 bits (200), Expect = 3.732e-17
Identity = 42/106 (39.62%), Postives = 56/106 (52.83%), Query Frame = 3
Query:  348 RTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTE 665
            R KRS L   FPGT WCG G+ A+  +  G    AD CC+ HD C +SI +    +   N   +T+  C CD  F  CLK  N   S  IG  FF+ +++ CF +E
Sbjct:  135 RRKRSWL---FPGTLWCGTGSRARGYDQLGMFERADVCCREHDHCQHSIPALSVSYGVFNHHFFTVSHCNCDQRFRQCLKRMNDSVSSMIGYTFFSVLQVPCFDSE 237          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000048502.1 (SMESG000048502.1)

HSP 1 Score: 489.96 bits (1260), Expect = 1.326e-177
Identity = 247/247 (100.00%), Postives = 247/247 (100.00%), Query Frame = 3
Query:   24 MSTRMSNFXXXXXXXXXXXCATHSDPMTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN 764
            MSTRMSNFITIVTIIYTIICATHSDPMTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN
Sbjct:    1 MSTRMSNFITIVTIIYTIICATHSDPMTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN 247          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000048502.1 (SMESG000048502.1)

HSP 1 Score: 481.1 bits (1237), Expect = 3.076e-174
Identity = 243/243 (100.00%), Postives = 243/243 (100.00%), Query Frame = 3
Query:   36 MSNFXXXXXXXXXXXCATHSDPMTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN 764
            MSNFITIVTIIYTIICATHSDPMTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN
Sbjct:    1 MSNFITIVTIIYTIICATHSDPMTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN 243          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000048502.1 (SMESG000048502.1)

HSP 1 Score: 461.07 bits (1185), Expect = 1.366e-166
Identity = 221/221 (100.00%), Postives = 221/221 (100.00%), Query Frame = 3
Query:  102 MTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN 764
            MTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN
Sbjct:    1 MTVHRYVHEKTNELFYAISNNKTTQILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISKCTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN 221          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000048503.1 (SMESG000048503.1)

HSP 1 Score: 219.164 bits (557), Expect = 3.352e-71
Identity = 95/146 (65.07%), Postives = 118/146 (80.82%), Query Frame = 3
Query:  327 TINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN 764
            TI  T KR KRSILQ+I+PGTKWCGPGNIA+NE+D+GEEIE DKCC  HD+C   I +G+ KW FKNK S+TLM CGCDDEFYLCLKE +   SDK+G LFFN ++++CFQ EVI TC+SWY+ G+WCR+  R+LG+KLY++  WN
Sbjct:   75 TIYETSKRKKRSILQKIYPGTKWCGPGNIAENESDFGEEIETDKCCHEHDKCKMFIGAGEIKWTFKNKFSHTLMSCGCDDEFYLCLKEVDNRVSDKVGNLFFNVLQVKCFQREVIKTCVSWYVIGIWCRKYQRQLGIKLYNSQNWN 220          
BLAST of Phospholipase A2 vs. Planmine SMEST
Match: SMESG000048503.1 (SMESG000048503.1)

HSP 1 Score: 219.164 bits (557), Expect = 5.619e-71
Identity = 95/146 (65.07%), Postives = 118/146 (80.82%), Query Frame = 3
Query:  327 TINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVHDRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGKLFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN 764
            TI  T KR KRSILQ+I+PGTKWCGPGNIA+NE+D+GEEIE DKCC  HD+C   I +G+ KW FKNK S+TLM CGCDDEFYLCLKE +   SDK+G LFFN ++++CFQ EVI TC+SWY+ G+WCR+  R+LG+KLY++  WN
Sbjct:   85 TIYETSKRKKRSILQKIYPGTKWCGPGNIAENESDFGEEIETDKCCHEHDKCKMFIGAGEIKWTFKNKFSHTLMSCGCDDEFYLCLKEVDNRVSDKVGNLFFNVLQVKCFQREVIKTCVSWYVIGIWCRKYQRQLGIKLYNSQNWN 230          
The following BLAST results are available for this feature:
BLAST of Phospholipase A2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PLA2G31.698e-1837.14phospholipase A2 group III [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipase A2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG30095.400e-2832.16gene:FBgn0029720 transcript:FBtr0332316[more]
CG30093.685e-2732.16gene:FBgn0029720 transcript:FBtr0070688[more]
CG30093.685e-2732.16gene:FBgn0029720 transcript:FBtr0300468[more]
CG422375.091e-2742.37gene:FBgn0250862 transcript:FBtr0340302[more]
CG422372.309e-2642.37gene:FBgn0250862 transcript:FBtr0073722[more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
proca17.886e-2037.61protein interacting with cyclin A1 [Source:ZFIN;Ac... [more]
pla2g38.061e-1837.19phospholipase A2 group III [Source:ZFIN;Acc:ZDB-GE... [more]
CU459012.14.069e-1536.54group 3 secretory phospholipase A2-like [Source:NC... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
uri11.788e-2135.48URI1 prefoldin-like chaperone [Source:Xenbase;Acc:... [more]
ENSXETT00000036327.14.752e-1735.51pep primary_assembly:Xenopus_tropicalis_v9.1:1:131... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pla2g32.117e-1735.58phospholipase A2, group III [Source:MGI Symbol;Acc... [more]
Pla2g32.208e-1735.58phospholipase A2, group III [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Phospholipase A2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BMK4|PA2_APICC2.039e-2239.80Phospholipase A2 OS=Apis cerana cerana OX=94128 PE... [more]
sp|P00630|PA2_APIME4.001e-2241.84Phospholipase A2 OS=Apis mellifera OX=7460 PE=1 SV... [more]
sp|Q7M4I5|PA2_APIDO2.467e-2138.78Phospholipase A2 OS=Apis dorsata OX=7462 PE=1 SV=1[more]
sp|I7GQA7|PA2_XYLAI4.314e-2139.81Phospholipase A(2) OS=Xylocopa appendiculata circu... [more]
sp|P16354|PA23_HELSU1.478e-1936.19Phospholipase A2 isozymes PA3A/PA3B/PA5 OS=Heloder... [more]
back to top
BLAST of Phospholipase A2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A212FMH83.136e-2940.52Phospholipase A2D OS=Danaus plexippus plexippus OX... [more]
A0A0C9S3A53.624e-2838.69TSA: Tityus bahiensis Tbah00274 mRNA sequence (Fra... [more]
A0A4Y2KMI84.787e-2849.02Phospholipase A2 OS=Araneus ventricosus OX=182803 ... [more]
A0A5E4QIA74.921e-2739.23PA2c domain-containing protein (Fragment) OS=Lepti... [more]
A0A2W1BZG96.386e-2741.60PA2c domain-containing protein OS=Helicoverpa armi... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
proca11.046e-2137.80uncharacterized LOC103023370 [Source:NCBI gene;Acc... [more]
proca14.018e-2136.80uncharacterized LOC103023370 [Source:NCBI gene;Acc... [more]
ENSAMXT00000053537.13.305e-1434.26uncharacterized LOC103036138 [Source:NCBI gene;Acc... [more]
ENSAMXT00000057577.11.403e-936.36pep primary_assembly:Astyanax_mexicanus-2.0:20:581... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005482.14.971e-2236.52pep scaffold:Pmarinus_7.0:GL479025:28110:33430:-1 ... [more]
ENSPMAT00000008222.16.164e-1039.39pep scaffold:Pmarinus_7.0:GL489691:3482:6078:1 gen... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipase A2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO413741.345e-2443.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475301.283e-1942.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406211.377e-630.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipase A2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pla2g33.824e-2142.99group 3 secretory phospholipase A2-like [Source:NC... [more]
pla2g35.377e-2142.99group 3 secretory phospholipase A2-like [Source:NC... [more]
proca16.173e-1832.79protein interacting with cyclin A1 [Source:NCBI ge... [more]
ENSORLT00000015007.23.732e-1739.62group 3 secretory phospholipase A2 [Source:NCBI ge... [more]
back to top
BLAST of Phospholipase A2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048502.11.326e-177100.00SMESG000048502.1[more]
SMESG000048502.13.076e-174100.00SMESG000048502.1[more]
SMESG000048502.11.366e-166100.00SMESG000048502.1[more]
SMESG000048503.13.352e-7165.07SMESG000048503.1[more]
SMESG000048503.15.619e-7165.07SMESG000048503.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015364 ID=SMED30015364|Name=Phospholipase A2|organism=Schmidtea mediterranea sexual|type=transcript|length=870bp
AATGATGAAACGCATCAACATTTATGTCTACTAGAATGTCGAATTTTATA
ACAATTGTAACTATAATATATACAATAATCTGTGCTACTCATTCAGATCC
CATGACAGTTCACAGGTATGTCCATGAGAAAACAAATGAGTTGTTTTATG
CCATTTCAAATAACAAAACGACTCAGATTCTATTGGAAATGTCTACCGGA
GAATTAAAATGTTTCAAAACCGACAAGGGCTTGATTCGTCATATTAAGGA
AAAGGCGATTTATTCGCTCAGTTCATTGGAAAAAAGAAAATTTCTCGTAG
AAAACAAAGCAATAATTAGTAAATGTACAATTAACTCAACTTTTAAAAGA
ACAAAAAGAAGCATCCTACAAAGAATTTTCCCGGGAACAAAATGGTGTGG
TCCAGGAAATATTGCTCAAAATGAAAATGATTATGGGGAAGAAATAGAAG
CGGATAAATGCTGTCAGGTCCATGACAGATGCCCAAATTCTATTCGATCA
GGTGATACAAAATGGAACTTCAAAAATAAACTTTCCTACACCCTTATGGA
GTGTGGTTGCGATGATGAATTCTACCTTTGTCTGAAGGAGGCAAATACTG
AAGCATCTGACAAAATTGGGAAACTATTTTTTAACTTCGTTCGCATGGAA
TGCTTTCAAACCGAAGTAATTAACACTTGCTTATCTTGGTATATTCCTGG
TGTTTGGTGCCGGAGAAAAGGTCGTCGTTTAGGCGTCAAATTATATCATG
CAAATCCTTGGAATTGAATTGAGAAAATATGAGAAAACAGAAAACAGAAA
ACTCATTTTTAACTGCCATCAGATTTCATTTGTATATATTTTGCACGTCT
AATAAATATTTTCGTCTTGC
back to top

protein sequence of SMED30015364-orf-1

>SMED30015364-orf-1 ID=SMED30015364-orf-1|Name=SMED30015364-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MSTRMSNFITIVTIIYTIICATHSDPMTVHRYVHEKTNELFYAISNNKTT
QILLEMSTGELKCFKTDKGLIRHIKEKAIYSLSSLEKRKFLVENKAIISK
CTINSTFKRTKRSILQRIFPGTKWCGPGNIAQNENDYGEEIEADKCCQVH
DRCPNSIRSGDTKWNFKNKLSYTLMECGCDDEFYLCLKEANTEASDKIGK
LFFNFVRMECFQTEVINTCLSWYIPGVWCRRKGRRLGVKLYHANPWN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036444PLipase_A2_dom_sf
IPR016090PLipase_A2_dom
IPR033113PLipase_A2_His_AS
Vocabulary: molecular function
TermDefinition
GO:0004623phospholipase A2 activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0006644phospholipid metabolic process
GO:0050482arachidonic acid secretion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016090Phospholipase A2 domainPFAMPF05826Phospholip_A2_2coord: 118..213
e-value: 1.5E-34
score: 118.1
IPR036444Phospholipase A2 domain superfamilyGENE3DG3DSA:1.20.90.10coord: 117..235
e-value: 1.1E-36
score: 127.6
IPR036444Phospholipase A2 domain superfamilySUPERFAMILYSSF48619Phospholipase A2, PLA2coord: 118..226
NoneNo IPR availablePANTHERPTHR12253FAMILY NOT NAMEDcoord: 20..242
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.643
IPR033113Phospholipase A2, histidine active sitePROSITEPS00118PA2_HIScoord: 146..153