Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30015359
Length (bp)1367
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30015359) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30015359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30015359) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30015359) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015359

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30015359SMESG000040010.1 dd_Smed_v4_4869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP47 (ubiquitin specific peptidase 47 [Source:HGNC Symbol;Acc:HGNC:20076])

HSP 1 Score: 65.855 bits (159), Expect = 1.146e-10
Identity = 92/379 (24.27%), Postives = 152/379 (40.11%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILN---YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSG-EHLK----QKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL     +          ++E  L      +I+     Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL + +        ID E  KS    S           +DS     G   S Q S     D+ ++       NSG E +     +K +++Y L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  102 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKL------KDYVRCLECGYEGWRIDTYLDIPL----VIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTF-------IDVEDEKSPQTESC----------TDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHY--YACIKSFSDEQWYSFNDQHVSRITQEDIKKT 447          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP47 (ubiquitin specific peptidase 47 [Source:HGNC Symbol;Acc:HGNC:20076])

HSP 1 Score: 65.4698 bits (158), Expect = 1.310e-10
Identity = 92/380 (24.21%), Postives = 152/380 (40.00%), Query Frame = 3
Query:  207 SLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILN---YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSG-EHLK----QKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
             L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL     +          ++E  L      +I+     Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL + +        ID E  KS    S           +DS     G   S Q S     D+ ++       NSG E +     +K +++Y L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  169 GLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKL------KDYVRCLECGYEGWRIDTYLDIPL----VIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTF-------IDVEDEKSPQTESC----------TDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHY--YACIKSFSDEQWYSFNDQHVSRITQEDIKKT 515          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP47 (ubiquitin specific peptidase 47 [Source:HGNC Symbol;Acc:HGNC:20076])

HSP 1 Score: 65.4698 bits (158), Expect = 1.361e-10
Identity = 92/380 (24.21%), Postives = 152/380 (40.00%), Query Frame = 3
Query:  207 SLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILN---YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSG-EHLK----QKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
             L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL     +          ++E  L      +I+     Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL + +        ID E  KS    S           +DS     G   S Q S     D+ ++       NSG E +     +K +++Y L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  189 GLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKL------KDYVRCLECGYEGWRIDTYLDIPL----VIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTF-------IDVEDEKSPQTESC----------TDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHY--YACIKSFSDEQWYSFNDQHVSRITQEDIKKT 535          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP30 (ubiquitin specific peptidase 30 [Source:HGNC Symbol;Acc:HGNC:20065])

HSP 1 Score: 60.8474 bits (146), Expect = 2.704e-9
Identity = 57/259 (22.01%), Postives = 102/259 (39.38%), Query Frame = 3
Query:  615 LALHISVPRNGNE-TLERCLDQHFTDDIILNYICDTKSCAGLNA----------------LKMTKLLRPLPQTLCIHLQKSYWNGYQMK-KINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITF---------SKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYK----------CIDNQWYLADDNQISKVRKEIVFKSDPYILIYE 1280
            L+L I     G+  TL+ CL    + + + + +CD  +C  + A                +K  KL + LPQ LCIHLQ+  W+ +    K +  + F+  L++     H +    S+    ++ N   T          +  L++    +  +   G       P++   +   L +    S          L+ L +V+VH G++  GH++ Y+             NQW    D+ + K   + V  S  Y+L YE
Sbjct:  251 LSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCD--NCTKIEAKGTLNGEKVEHQRTTFVKQLKLGK-LPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSS------STYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYE 500          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP30 (ubiquitin specific peptidase 30 [Source:HGNC Symbol;Acc:HGNC:20065])

HSP 1 Score: 60.8474 bits (146), Expect = 2.809e-9
Identity = 57/259 (22.01%), Postives = 102/259 (39.38%), Query Frame = 3
Query:  615 LALHISVPRNGNE-TLERCLDQHFTDDIILNYICDTKSCAGLNA----------------LKMTKLLRPLPQTLCIHLQKSYWNGYQMK-KINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITF---------SKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYK----------CIDNQWYLADDNQISKVRKEIVFKSDPYILIYE 1280
            L+L I     G+  TL+ CL    + + + + +CD  +C  + A                +K  KL + LPQ LCIHLQ+  W+ +    K +  + F+  L++     H +    S+    ++ N   T          +  L++    +  +   G       P++   +   L +    S          L+ L +V+VH G++  GH++ Y+             NQW    D+ + K   + V  S  Y+L YE
Sbjct:  220 LSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCD--NCTKIEAKGTLNGEKVEHQRTTFVKQLKLGK-LPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSS------STYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYE 469          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: C04E6.5 (pep chromosome:WBcel235:V:5902133:5904831:1 gene:WBGene00015422.1 transcript:C04E6.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C04E6.5)

HSP 1 Score: 57.7658 bits (138), Expect = 9.975e-9
Identity = 100/405 (24.69%), Postives = 156/405 (38.52%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLH---------------------SKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNI--FRH--------WNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISG-------WLRIRLPMKLLIQ--YSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQM--KKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVK-GGHYMCYKCID--NQW-YLADDNQISKVRKEIVF--KSDPYILIYE 1280
            L N G +C+LNS +Q++SSC  F    ++L+                      KY+ L         +   +N SK   EI   N+  FR         +    QQD+ E L      ++  I + +E K D  G        L      K  ++  Y  K      + + + +DLA+H+      N +++  L   F+    +   C   SC   +A+   ++ R  P+ L I+L++    G Q   KKIN  +  S EL I S       EI+                  L +S   + S  G+ +   KS   IK     N+          + ++K+  Y+L + I H G     GHY+ Y   D  N W Y +DD      R EI    ++  YIL YE
Sbjct:  147 LVNTGNSCFLNSTMQALSSCHSFALRCEQLYCLVRKNIDYFDNEASHSEVLCRKYRVLIDFLKIMAALTKRSNSSKTQPEIIEANLQTFRELIGMIRNDFANKNQQDAHEFLL----MLFEAIDDVAEYKADNEGDDVKEAKQLNPIEAFKFNVETCYVCKGCSKEEVRVDVRNDLAVHM----RDNLSVQELLSSSFSTWTPIEKKCS--SCNHQHAILSERITR-FPECLVINLERYQLEGPQFSTKKINCSLEPSFELDISS--LQKFPEIE---------------KNGLEQSEKQQDSQYGQLLDRMKSCEIIKCCETKNI----------IMEEKHDKYSLVAAICHLGETPTNGHYIAYTREDTENSWLYCSDDLIRPATRSEISLSIRTSGYILFYE 513          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-3 (Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;Acc:Q9GRV2])

HSP 1 Score: 51.9878 bits (123), Expect = 6.783e-7
Identity = 55/235 (23.40%), Postives = 99/235 (42.13%), Query Frame = 3
Query:  201 PPSLANIGANCYLNSALQSISSCEKFKEDIKRLHS--KYKDLDK----------LTLFHNLMIVLNNGSKNAIEISRNNIFR--------HWNKSGQQDSFELLAYVINQVYNEIRNHSEVKN-------DISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNET-LERCLDQHFTDDII-LNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNG 818
            P  + N+G  C++N+ LQ+++S  +F+E I  L S   Y   +K          LT  +  +++ +  +++  E +  N FR         +    Q DS E + Y ++ ++ E+R   ++          IS +    L   ++ Q    CS      I    DL+L I   RN ++  L  CL   F  +++      +   C           +R LPQ LC+H+++   NG
Sbjct:  228 PRGMRNVGNTCFMNAVLQALASISEFREYIMSLSSLEDYIHDEKEPKNGGNYCYLTDEYRKLLI-SQSARSFREPTAPNEFREAFISVCPRFRGFRQHDSHEFMRYFMDSLHTEMRKCRKLPGMPDDKHTPISKYFEGTLQSSVICQTCRNCS----NKIDEFMDLSLDIPAQRNASKVRLSDCLSTFFKLEMLEKGEKPECAKCKTKQTCSKQMFIRKLPQVLCLHMKRFRDNG 457          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-33 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q93875])

HSP 1 Score: 51.6026 bits (122), Expect = 8.814e-7
Identity = 31/89 (34.83%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 1026 FPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKG-NVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
            F S K   +    L S + G      +  LY+L   +VH+G +++ GHY+  C    DNQWY  DD  +++     V KS PYIL+Y +
Sbjct:  459 FGSCKVGKVVEFPLRSQDFGRWTTSGEPALYDLVGFVVHEGRSLEFGHYVSYCRHEQDNQWYKFDDMVVTRCDATQVAKSQPYILMYRK 547          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-14 (Ubiquitin carboxyl-terminal hydrolase 14 [Source:UniProtKB/Swiss-Prot;Acc:Q17361])

HSP 1 Score: 50.0618 bits (118), Expect = 2.546e-6
Identity = 98/407 (24.08%), Postives = 169/407 (41.52%), Query Frame = 3
Query:  201 PPSLANIGANCYLNSALQSISSCE----KFKEDIK-RLHSKYKDLDKLTLFHNLMIVLNN--------GSKN------AIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICD--TKSCAGLNA----LKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELL-KSISNNSSITFSKALSKSSDSEKSLIGK---------GISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKG-NVKGGHYMCY--KCIDNQWYLADDNQISKVRKEIVFKS-------DPYILIYEEK 1286
            P  LAN+G  CY NS +Q +        K  E+++ R H+     D+L   HNL  + N+         SK       A  ++ ++ F  + K  QQD+ E L  +++ V    R +      +SGW  I    ++  + ++KC         L SD      V RN   T     D  F    I     +  T++   LN      K T++ R LP+ L +++ + ++   +  K N +I  S +  ++     T D    EL  K ++  + I   +      +  K ++ K         G++L  +F   +D+  +N      NSG          Y+L  +I HKG + + GHY+ +     D +W L DD  ++ V +E + K+         Y+L+YE +
Sbjct:  101 PCGLANLGNTCYFNSCVQMLKEVNELVLKPAEEMRIREHN-----DRLC--HNLATLFNSLRDKDRALRSKGEPIKPFAAILTLSDSFPQFEKFKQQDANECLVSIMSNV---TRIYG-----LSGW-NIESLFRIQTETTMKC---------LESDEVSEKKVERNNQLTCYVNQDVRFLQTGIKAGFEEEMTRNSEELNRDAKWQKNTQISR-LPKYLTVNINRFFYK--ESTKTNAKILKSVQFPMQ---LDTYDLCSQELKDKLVARRADIKLEEDAKLERELRKKVLDKEQGDKIFDDGVALPTAF---EDDAGSN------NSG---------FYDLKGIITHKGRSSQDGHYVAWMRSSEDGKWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLYEAR 458          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp20-33 (gene:FBgn0033916 transcript:FBtr0087535)

HSP 1 Score: 56.225 bits (134), Expect = 5.475e-8
Identity = 27/69 (39.13%), Postives = 38/69 (55.07%), Query Frame = 3
Query: 1113 LYNLCSVIVHKGNVKGGHYMCY--KCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK*IYFVLHNP 1313
            +YNL SVI H G V GGHY C+    ++ +WY  DD  +++V  E+V     Y+L Y +       HNP
Sbjct:  482 IYNLSSVICHHGTVGGGHYTCFARNTLNGKWYEFDDQFVTEVSSELVQSCQAYVLFYHK-------HNP 543          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0306259)

HSP 1 Score: 54.299 bits (129), Expect = 2.253e-7
Identity = 83/364 (22.80%), Postives = 154/364 (42.31%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFH--NLMIVLNNGSKNAIEISRNNIFRHWNKS---GQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLP--MKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDT--KSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTID--EIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCY-KCID-NQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + R      +  K   +    L + L    K A+E +       W+ +    Q D  EL   + + + ++ +N  +  N IS     ++   +K L   + K    T + IPL        S   +  E L R   Q  T D    Y+C+   K C     L      +  P  L +HL++  ++   M +I  N+R+ F   L + +    + +  E +S+L  ++ + S+     A+   + S   +     S  ++  + +D  I+   ++S  S    +     LY L ++++H G+  GGHY  Y K  D N+W+  +D  ++ + +E + +S
Sbjct:  380 LVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQA-NLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEAL-RAFVQPETLDGNNQYLCEKCKKKCDAHKGLH----FKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNSGEQNSQLNGTVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLNDEDEGID---MSSSTSKSAKQGSGPYLYELFAIMIHSGSASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRS 734          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0077096)

HSP 1 Score: 54.299 bits (129), Expect = 2.316e-7
Identity = 83/364 (22.80%), Postives = 154/364 (42.31%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFH--NLMIVLNNGSKNAIEISRNNIFRHWNKS---GQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLP--MKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDT--KSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTID--EIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCY-KCID-NQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + R      +  K   +    L + L    K A+E +       W+ +    Q D  EL   + + + ++ +N  +  N IS     ++   +K L   + K    T + IPL        S   +  E L R   Q  T D    Y+C+   K C     L      +  P  L +HL++  ++   M +I  N+R+ F   L + +    + +  E +S+L  ++ + S+     A+   + S   +     S  ++  + +D  I+   ++S  S    +     LY L ++++H G+  GGHY  Y K  D N+W+  +D  ++ + +E + +S
Sbjct:  398 LVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQA-NLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEAL-RAFVQPETLDGNNQYLCEKCKKKCDAHKGLH----FKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNSGEQNSQLNGTVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLNDEDEGID---MSSSTSKSAKQGSGPYLYELFAIMIHSGSASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRS 752          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0077095)

HSP 1 Score: 54.299 bits (129), Expect = 2.316e-7
Identity = 83/364 (22.80%), Postives = 154/364 (42.31%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFH--NLMIVLNNGSKNAIEISRNNIFRHWNKS---GQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLP--MKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDT--KSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTID--EIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCY-KCID-NQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + R      +  K   +    L + L    K A+E +       W+ +    Q D  EL   + + + ++ +N  +  N IS     ++   +K L   + K    T + IPL        S   +  E L R   Q  T D    Y+C+   K C     L      +  P  L +HL++  ++   M +I  N+R+ F   L + +    + +  E +S+L  ++ + S+     A+   + S   +     S  ++  + +D  I+   ++S  S    +     LY L ++++H G+  GGHY  Y K  D N+W+  +D  ++ + +E + +S
Sbjct:  398 LVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQA-NLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEAL-RAFVQPETLDGNNQYLCEKCKKKCDAHKGLH----FKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNSGEQNSQLNGTVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLNDEDEGID---MSSSTSKSAKQGSGPYLYELFAIMIHSGSASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRS 752          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp47 (ubiquitin specific peptidase 47 [Source:ZFIN;Acc:ZDB-GENE-070719-7])

HSP 1 Score: 68.1662 bits (165), Expect = 1.123e-11
Identity = 95/379 (25.07%), Postives = 156/379 (41.16%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDIILN----YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEH-LKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  +     +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL       +  P   ++   ++E  L Q F     L+    Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL + S +      ID E  KS    S          S  S++        +   F S  D V   + L + +S E  LK K ++ + L SV+VH G+  GGHY  Y CI    D+QWY  +D  +SK+ ++ + K+
Sbjct:  174 LVNQAMTCYLNSLLQTLFMTPEFRNALYNWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVRCLECGYESWRIDTYLDIPL-------VIRPFGASQAFGSVEEAL-QAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDM-SPF------IDVEDEKSPQTESCTDSGAENEGSCHSDQ--------MSNDF-STDDGVDEGICLDNASSAERVLKPKSSLTFELFSVMVHSGSAAGGHY--YACIKSFSDSQWYSFNDQHVSKITQDDIRKT 516          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp31 (ubiquitin specific peptidase 31 [Source:ZFIN;Acc:ZDB-GENE-100210-4])

HSP 1 Score: 55.8398 bits (133), Expect = 1.004e-7
Identity = 26/66 (39.39%), Postives = 37/66 (56.06%), Query Frame = 3
Query: 1095 KQKKNILYNLCSVIVHKGNVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            +   + LY+L +V  H GN+ GGHY   C   ID QWY  DD+++  V  E V +   YIL Y+ +
Sbjct:  666 RNPDDYLYDLYAVCNHHGNMHGGHYTAYCKNSIDGQWYCFDDSEVQPVADEDVCQQTAYILFYQRR 731          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp31 (ubiquitin specific peptidase 31 [Source:ZFIN;Acc:ZDB-GENE-100210-4])

HSP 1 Score: 55.8398 bits (133), Expect = 1.006e-7
Identity = 26/66 (39.39%), Postives = 37/66 (56.06%), Query Frame = 3
Query: 1095 KQKKNILYNLCSVIVHKGNVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            +   + LY+L +V  H GN+ GGHY   C   ID QWY  DD+++  V  E V +   YIL Y+ +
Sbjct:  666 RNPDDYLYDLYAVCNHHGNMHGGHYTAYCKNSIDGQWYCFDDSEVQPVADEDVCQQTAYILFYQRR 731          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp31 (ubiquitin specific peptidase 31 [Source:ZFIN;Acc:ZDB-GENE-100210-4])

HSP 1 Score: 55.4546 bits (132), Expect = 1.236e-7
Identity = 26/66 (39.39%), Postives = 37/66 (56.06%), Query Frame = 3
Query: 1095 KQKKNILYNLCSVIVHKGNVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            +   + LY+L +V  H GN+ GGHY   C   ID QWY  DD+++  V  E V +   YIL Y+ +
Sbjct:  515 RNPDDYLYDLYAVCNHHGNMHGGHYTAYCKNSIDGQWYCFDDSEVQPVADEDVCQQTAYILFYQRR 580          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp3 (ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5142])

HSP 1 Score: 51.9878 bits (123), Expect = 9.431e-7
Identity = 24/61 (39.34%), Postives = 37/61 (60.66%), Query Frame = 3
Query: 1104 KNILYNLCSVIVHKGN-VKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
            +  LY+L +V+VH G+ +  GHY  Y   + QWY  +D+ ++ V +E V K+  YIL Y E
Sbjct:  454 ERCLYDLAAVVVHHGSGIGSGHYTAYGRHEGQWYHFNDSTVTLVSEEAVLKAKAYILFYTE 514          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D [Source:Xenbase;Acc:XB-GENE-988375])

HSP 1 Score: 78.1814 bits (191), Expect = 5.970e-15
Identity = 103/454 (22.69%), Postives = 180/454 (39.65%), Query Frame = 3
Query:  204 PSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLD--------KLTLFHNLMIVLNN-GSKNAI-------EISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKN--DISGWLRIRLPMKLLIQYSIKCSCGTIISIP--------LHS-----------------------DLALHISVPRNGNE-TLERCLDQHFTDDIILNYICDTKSCAGLNA----------------LKMTKLLRPLPQTLCIHLQKSYWN--GYQMKKINNRINFSAELII-KSEY----CHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCY---------KCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK*IYFVLHNP 1313
            P L N+G  C++NS LQ ++SC  F   +    SKY+  +         +TL H L  + N  G+++ +       E+ R +    W  S   +QD+ EL   + + + +E      V +  D+     +  P++   Q   +     I  IP         H                         L+L I V   G+  TL++CL    + + + + +C+  +C  ++A                +K  KL + LPQ LCIHLQ+  W+  G  +K+ N  + FS  L + + +Y    C T  +  +  L ++   +S++ +K    + +     +    S     P     +  N   TS           + L+ L +V+VH G++  GH++ Y         K    QW    D+ + +   + V  S  Y+L YE   I   LH+P
Sbjct:   45 PGLLNLGNTCFMNSLLQGLASCPSFIRWLADFTSKYRQENNTTEHQHLSVTLLHLLKALCNQEGTEDEVLDASPLLEVLRAH---RWQISSFEEQDAHELFHVLTSSLEDERDRRPHVTHLFDLDS---LEFPLEPQRQIHCRTQGMPIYPIPSQWKSQHPFHGRLTSNMVCKHCQHQSPMRYDTFDSLSLSIPVATWGHPITLDQCLQHFISTESVKDVVCE--NCTKIHAAQIPNSQSVENRKTTFVKQLKLGK-LPQCLCIHLQRLSWSNQGSPLKR-NEHVQFSEFLAMDRFKYRISGCSTSKQ-PANHLSALFVATSLSSTKLSGGAQNPTMPFLNGACSTSYISPPFTSPLPTNPEWTS----------SSYLFRLMAVVVHHGDMHSGHFVTYRRSPAAKNQKLTSQQWLWISDDTVRRTNFQEVLSSSAYLLFYER--IQSNLHHP 475          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D [Source:Xenbase;Acc:XB-GENE-988375])

HSP 1 Score: 75.8702 bits (185), Expect = 3.698e-14
Identity = 105/458 (22.93%), Postives = 174/458 (37.99%), Query Frame = 3
Query:  204 PSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLD--------KLTLFHNLMIVLNN-GSKNAI-------EISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKN--DISGWLRIRLPMKLLIQYSIKCSCGTII---------SIPLHS-----------------------DLALHISVPRNGNE-TLERCLDQHFTDDIILNYICDTKSCAGLNA----------------LKMTKLLRPLPQTLCIHLQKSYWN--GYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKS--------LIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCY---------KCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK*IYFVLHNP 1313
            P L N+G  C++NS LQ ++SC  F   +    SKY+  +         +TL H L  + N  G+++ +       E+ R +    W  S   +QD+ EL   + + + +E      V +  D+       L   L  Q  I C     I           P H                         L+L I V   G+  TL++CL    + + + + +C+  +C  ++A                +K  KL + LPQ LCIHLQ+  W+  G  +K+ N  + FS E +    + + I         S S   +   S A  +++D ++          +    S     P     +  N   TS           + L+ L +V+VH G++  GH++ Y         K    QW    D+ + +   + V  S  Y+L YE   I   LH+P
Sbjct:   85 PGLLNLGNTCFMNSLLQGLASCPSFIRWLADFTSKYRQENNTTEHQHLSVTLLHLLKALCNQEGTEDEVLDASPLLEVLRAH---RWQISSFEEQDAHELFHVLTSSLEDERDRRPHVTHLFDLDS-----LEFPLEPQRQIHCRTQVPIYPIPSQWKSQHPFHGRLTSNMVCKHCQHQSPMRYDTFDSLSLSIPVATWGHPITLDQCLQHFISTESVKDVVCE--NCTKIHAAQIPNSQSVENRKTTFVKQLKLGK-LPQCLCIHLQRLSWSNQGSPLKR-NEHVQFS-EFLAMDRFKYRISGC------STSKQPANHLSAAEQETTDGKEGGAQNPTMPFLNGACSTSYISPPFTSPLPTNPEWTS----------SSYLFRLMAVVVHHGDMHSGHFVTYRRSPAAKNQKLTSQQWLWISDDTVRRTNFQEVLSSSAYLLFYER--IQSNLHHP 511          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:100036690])

HSP 1 Score: 69.707 bits (169), Expect = 5.804e-12
Identity = 96/378 (25.40%), Postives = 150/378 (39.68%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDIILN----YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D ++        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  +KC  CG       T + IPL       +  P   N    ++E  L Q F     L+    Y C+   + C     LK        P  L + L++  ++   M +I  N+R+ F  EL +          ID E  KS   +S           +DS     G   S Q S     D+ ++       NS      K N LY L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  163 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVSSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVKCLECGYESWRIDTFLDIPL-------VIRPFGSNTAFGSMEEAL-QAFIQPETLDGPNQYFCERCKRKCDARKGLKFLHF----PYLLTLQLKRFDFDYTSMHRIKLNDRMTFPDELDMSPF-------IDVEDEKSPQTDSC----------TDSGAENEGSCHSDQMSNDFSTDDAVDEGICLETNSNIEKLNKSNSLYELFSVMVHSGSAAGGHY--YACIKSFADGQWYSFNDQHVSRITQEDIKKT 503          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:100036690])

HSP 1 Score: 68.5514 bits (166), Expect = 1.519e-11
Identity = 93/381 (24.41%), Postives = 155/381 (40.68%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDIILN----YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSEL---LKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D ++        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  +KC  CG       T + IPL       +  P   N    ++E  L Q F     L+    Y C+   + C     LK        P  L + L++  ++   M +I  N+R+ F  EL + S +    DE   +      S + N     S  +S    ++ + + +GI L+            N  +  +N       +KN LY L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  174 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVSSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVKCLECGYESWRIDTFLDIPL-------VIRPFGSNTAFGSMEEAL-QAFIQPETLDGPNQYFCERCKRKCDARKGLKFLHF----PYLLTLQLKRFDFDYTSMHRIKLNDRMTFPDELDM-SPFIDVEDEKSPQTDSCTDSGAENEGSCHSDQMSNDFSTDDA-VDEGICLE-----------TNSNIEKLNKS---VSEKNSLYELFSVMVHSGSAAGGHY--YACIKSFADGQWYSFNDQHVSRITQEDIKKT 518          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:100036690])

HSP 1 Score: 68.1662 bits (165), Expect = 1.558e-11
Identity = 93/381 (24.41%), Postives = 154/381 (40.42%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDIILN----YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQ---KKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D ++        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  +KC  CG       T + IPL       +  P   N    ++E  L Q F     L+    Y C+   + C     LK        P  L + L++  ++   M +I  N+R+ F              DE+D      + +  S          +++E S     +S    F S  D V   + L + ++ E L +   +KN LY L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  205 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVSSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVKCLECGYESWRIDTFLDIPL-------VIRPFGSNTAFGSMEEAL-QAFIQPETLDGPNQYFCERCKRKCDARKGLKFLHF----PYLLTLQLKRFDFDYTSMHRIKLNDRMTFP-------------DELDMSPFIDVEDEKSPQTDSCTDSGAENEGSCHSDQMS--NDF-STDDAVDEGICLETNSNIEKLNKSVSEKNSLYELFSVMVHSGSAAGGHY--YACIKSFADGQWYSFNDQHVSRITQEDIKKT 549          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp47 (ubiquitin specific peptidase 47 [Source:MGI Symbol;Acc:MGI:1922246])

HSP 1 Score: 68.9366 bits (167), Expect = 6.811e-12
Identity = 99/403 (24.57%), Postives = 169/403 (41.94%), Query Frame = 3
Query:  135 NTNVGEPLNSSSVL-KSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILN---YICDT--KSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSEL---LKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            N  V +  + SS+L KS T  V    L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL     +          ++E  L      +I+     Y C+   K C     L+        P  L + L++  ++   M +I  N+R++F  EL + S +    DE   +      S + N     S  +S    ++ + + +GI L+ S  S K   I+   L          +K +++Y L SV+VH G+  GGHY  Y CI    D+QWY  +D  +S++ +E + K+
Sbjct:  147 NDYVSQNYSYSSILNKSETGYVG---LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKL------KDYVRCLECGYEGWRIDTYLDIPL----VIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDM-STFIDIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDA-VDEGICLESSSGSEK---ISKPGL----------EKNSLMYELFSVMVHSGSAAGGHY--YACIKSFSDDQWYSFNDQHVSRITQEDIKKT 515          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp47 (ubiquitin specific peptidase 47 [Source:MGI Symbol;Acc:MGI:1922246])

HSP 1 Score: 65.0846 bits (157), Expect = 1.112e-10
Identity = 101/419 (24.11%), Postives = 175/419 (41.77%), Query Frame = 3
Query:  126 SEQNTNVGEPLNSSSVL-KSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDII---LNYICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSEL---LKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGE----------HLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            +  N  V +  + SS+L KS T  V    L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL       +  P   ++   ++E  L      +I+     Y C+   K C     L+        P  L + L++  ++   M +I  N+R++F  EL + S +    DE   +      S + N     S  +S    ++ + + +GI L+ S  S K   I+   L  +   E           L +  +++Y L SV+VH G+  GGHY  Y CI    D+QWY  +D  +S++ +E + K+
Sbjct:  144 ASTNDYVSQNYSYSSILNKSETGYVG---LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKL------KDYVRCLECGYEGWRIDTYLDIPL-------VIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDM-STFIDIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDA-VDEGICLESSSGSEK---ISKPGLEKVEMAETDQRKDPIQFQLGEPNSLMYELFSVMVHSGSAAGGHY--YACIKSFSDDQWYSFNDQHVSRITQEDIKKT 535          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp47 (ubiquitin specific peptidase 47 [Source:MGI Symbol;Acc:MGI:1922246])

HSP 1 Score: 64.6994 bits (156), Expect = 1.688e-10
Identity = 100/410 (24.39%), Postives = 169/410 (41.22%), Query Frame = 3
Query:  126 SEQNTNVGEPLNSSSVL-KSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDII---LNYICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLK----QKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            +  N  V +  + SS+L KS T  V    L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL       +  P   ++   ++E  L      +I+     Y C+   K C     L+        P  L + L++  ++   M +I  N+R++F  EL + +        ID E  KS    S          S  S++        +   F S  D V   + L S +  E +     +K +++Y L SV+VH G+  GGHY  Y CI    D+QWY  +D  +S++ +E + K+
Sbjct:  164 ASTNDYVSQNYSYSSILNKSETGYVG---LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKL------KDYVRCLECGYEGWRIDTYLDIPL-------VIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTF-------IDIEDEKSPQTESCTDSGAENEGSCHSDQ--------MSNDF-STDDAVDEGICLESSSGSEKISKPGLEKNSLMYELFSVMVHSGSAAGGHY--YACIKSFSDDQWYSFNDQHVSRITQEDIKKT 535          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp43 (ubiquitin specific peptidase 43 [Source:MGI Symbol;Acc:MGI:2444541])

HSP 1 Score: 52.7582 bits (125), Expect = 7.775e-7
Identity = 23/62 (37.10%), Postives = 38/62 (61.29%), Query Frame = 3
Query: 1107 NILYNLCSVIVHKGNVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            + LY+L +V  H G+++GGHY   C   +D QWY  DD+ +  +R++ V     YIL Y+++
Sbjct:  649 DFLYDLYAVCNHHGSLQGGHYTAYCRNSLDGQWYSYDDSTVEALREDEVNTRGAYILFYQKR 710          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp50 (ubiquitin specific peptidase 50 [Source:MGI Symbol;Acc:MGI:1922333])

HSP 1 Score: 51.9878 bits (123), Expect = 8.763e-7
Identity = 22/61 (36.07%), Postives = 36/61 (59.02%), Query Frame = 3
Query: 1101 KKNILYNLCSVIVHKGNVKGGHY--MCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIY 1277
            +K+ +YNLC+V+ H G++ GGHY   C   +   WY  DD ++S++    V  +  Y+L Y
Sbjct:  239 RKHPMYNLCAVVNHFGDLDGGHYTAFCKNSVTQAWYSFDDTRVSEIPDTSVQTATAYLLFY 299          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|A4QNN3|UBP30_XENTR (Ubiquitin carboxyl-terminal hydrolase 30 OS=Xenopus tropicalis OX=8364 GN=usp30 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.959e-13
Identity = 105/458 (22.93%), Postives = 174/458 (37.99%), Query Frame = 3
Query:  204 PSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLD--------KLTLFHNLMIVLNN-GSKNAI-------EISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKN--DISGWLRIRLPMKLLIQYSIKCSCGTII---------SIPLHS-----------------------DLALHISVPRNGNE-TLERCLDQHFTDDIILNYICDTKSCAGLNA----------------LKMTKLLRPLPQTLCIHLQKSYWN--GYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKS--------LIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCY---------KCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK*IYFVLHNP 1313
            P L N+G  C++NS LQ ++SC  F   +    SKY+  +         +TL H L  + N  G+++ +       E+ R +    W  S   +QD+ EL   + + + +E      V +  D+       L   L  Q  I C     I           P H                         L+L I V   G+  TL++CL    + + + + +C+  +C  ++A                +K  KL + LPQ LCIHLQ+  W+  G  +K+ N  + FS E +    + + I         S S   +   S A  +++D ++          +    S     P     +  N   TS           + L+ L +V+VH G++  GH++ Y         K    QW    D+ + +   + V  S  Y+L YE   I   LH+P
Sbjct:   85 PGLLNLGNTCFMNSLLQGLASCPSFIRWLADFTSKYRQENNTTEHQHLSVTLLHLLKALCNQEGTEDEVLDASPLLEVLRAH---RWQISSFEEQDAHELFHVLTSSLEDERDRRPHVTHLFDLDS-----LEFPLEPQRQIHCRTQVPIYPIPSQWKSQHPFHGRLTSNMVCKHCQHQSPMRYDTFDSLSLSIPVATWGHPITLDQCLQHFISTESVKDVVCE--NCTKIHAAQIPNSQSVENRKTTFVKQLKLGK-LPQCLCIHLQRLSWSNQGSPLKR-NEHVQFS-EFLAMDRFKYRISGC------STSKQPANHLSAAEQETTDGKEGGAQNPTMPFLNGACSTSYISPPFTSPLPTNPEWTS----------SSYLFRLMAVVVHHGDMHSGHFVTYRRSPAAKNQKLTSQQWLWISDDTVRRTNFQEVLSSSAYLLFYER--IQSNLHHP 511          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|E1C1R4|UBP47_CHICK (Ubiquitin carboxyl-terminal hydrolase 47 OS=Gallus gallus OX=9031 GN=USP47 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.964e-12
Identity = 91/381 (23.88%), Postives = 155/381 (40.68%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDIILN---YICDT--KSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLK----QKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL       +  P   N+   ++E  L      +I+     Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL             D  +   + +  S          +++E S     +S    F S  D V   + L S ++ E +     +K ++LY L SV+VH G+  GGHY  Y CI    D+QWY  +D  +SK+ +E + K+
Sbjct:  189 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVRCLECGYEGWRIDTYLDIPL-------VIRPYGSNQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEEL-------------DMSIFIDVEDEKSPQTESCTDSGAENEGSCHSDQMS--NDF-SNDDGVDEGICLESNSAAERIAKVGSEKNSLLYELFSVMVHSGSAAGGHY--YACIKSFSDDQWYSFNDQHVSKITQEDIKKT 534          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|A1A5G2|UBP47_XENTR (Ubiquitin carboxyl-terminal hydrolase 47 OS=Xenopus tropicalis OX=8364 GN=usp47 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.631e-11
Identity = 93/381 (24.41%), Postives = 155/381 (40.68%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDIILN----YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSEL---LKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D ++        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  +KC  CG       T + IPL       +  P   N    ++E  L Q F     L+    Y C+   + C     LK        P  L + L++  ++   M +I  N+R+ F  EL + S +    DE   +      S + N     S  +S    ++ + + +GI L+            N  +  +N       +KN LY L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  176 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVSSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVKCLECGYESWRIDTFLDIPL-------VIRPFGSNTAFGSMEEAL-QAFIQPETLDGPNQYFCERCKRKCDARKGLKFLHF----PYLLTLQLKRFDFDYTSMHRIKLNDRMTFPDELDM-SPFIDVEDEKSPQTDSCTDSGAENEGSCHSDQMSNDFSTDDA-VDEGICLE-----------TNSNIEKLNKS---VSEKNSLYELFSVMVHSGSAAGGHY--YACIKSFADGQWYSFNDQHVSRITQEDIKKT 520          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q5U252|UBP47_XENLA (Ubiquitin carboxyl-terminal hydrolase 47 OS=Xenopus laevis OX=8355 GN=usp47 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.091e-10
Identity = 93/380 (24.47%), Postives = 154/380 (40.53%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLD---QHFTDDIILNYICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSEL---LKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D ++        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  +KC  CG       T + IPL       +  P   N    ++E  L    Q  T D    Y C+   + C     LK        P  L + L++  ++   M +I  N+R+ F  EL + S +    DE   +      S + N     S  +S    ++ + + +GI L+            N  +  +N       +KN LY L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  175 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVSSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVKCLECGYESWRIDTFLDIPL-------VIRPYGSNTAFGSMEEALHAFIQPETLDGPNQYFCERCKRKCDARKGLKFLHF----PYLLTLQLKRFDFDYTSMHRIKLNDRMTFPDELDM-SPFIDMEDEKSPQTDSCTDSGAENEGSCHSDQMSNDFSTDDA-VDEGICLE-----------TNSNIEKLNKS---VAEKNSLYELFSVMVHSGSAAGGHY--YACIKSFADGQWYSFNDQHVSRITQEDIKKT 519          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q96K76|UBP47_HUMAN (Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3)

HSP 1 Score: 65.4698 bits (158), Expect = 6.534e-10
Identity = 92/380 (24.21%), Postives = 152/380 (40.00%), Query Frame = 3
Query:  207 SLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILN---YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSG-EHLK----QKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
             L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL     +          ++E  L      +I+     Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL + +        ID E  KS    S           +DS     G   S Q S     D+ ++       NSG E +     +K +++Y L SV+VH G+  GGHY  Y CI    D QWY  +D  +S++ +E + K+
Sbjct:  189 GLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKL------KDYVRCLECGYEGWRIDTYLDIPL----VIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTF-------IDVEDEKSPQTESC----------TDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHY--YACIKSFSDEQWYSFNDQHVSRITQEDIKKT 535          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: T1JNX2 (Ubiquitin carboxyl-terminal hydrolase OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.365e-18
Identity = 98/413 (23.73%), Postives = 182/413 (44.07%), Query Frame = 3
Query:  204 PSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKD----LDK---------LTLFHNLMIVLNNGSKNAIEISRNNIF-----RHWNKSGQQDSFELLAYVINQVYNEIRNHSEVK---NDISGW-LRIRL----------------PMKLLIQYSIKC-SCGTIISIPLHSDLALHISVPRN--GNETLERCLDQHFTDDIILNYICDTKSCAGLNA-------LKMTKLLRPLPQTLCIHLQKSYW--NGYQMKKINNRINFSAELIIKS-EYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYK--CIDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
            P L N+G  C+LN+ LQ+++SC  F   +  L++K ++    +D+           L   L ++ N    +++  + N++        W  S ++     L +V++   +E  + +E     ND S     ++L                P K L+   + C +CG    +   +  +L + +P +  G  TL  CL      +++ N  C+   C  + A       LK   + R LP  LCIH+Q++ W  NG  MK+ ++ + +   LI+    Y     +++S + K++   S+    +A + ++             Q SF  +     N+  +  I  G  +K  +N LY L +VIVH G+V  GH++ Y+    +N WY+  D ++ +V    V  +  Y+L YE+
Sbjct:   43 PGLVNLGNTCFLNAVLQALASCPSFVLWLATLNTKIQNNKNFIDETEDTASYLCTALLKTLQVLSNKKRCDSVNYTPNDVINSLKANFWVISAEEQDAHELYFVLSSTLDEEISKAETTPSLNDASKMSCEVKLEKDCMTPSVLDQIPQSPFKGLLANQLMCRNCGYKCPVKCDTFDSLSLPIPASNLGQMTLYNCLQHFVISEVVSNVECE--KCQKITAKSKPSTFLKQLTIAR-LPINLCIHIQRTVWLQNGMPMKRFDH-VTYPEYLIMDDFMYKQQNPQMNSGIFKTLVGGSTNKPQEAPTATT-------------QLSFTPLNS---NSFLMQKITEGSAIKSVRN-LYQLQAVIVHLGDVFSGHFVTYRRGPSNNSWYMTSDTEVKEVPFSEVAAAPAYVLFYEK 434          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A2C9LX64 (Ubiquitin carboxyl-terminal hydrolase OS=Biomphalaria glabrata OX=6526 GN=106064668 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.286e-15
Identity = 106/446 (23.77%), Postives = 191/446 (42.83%), Query Frame = 3
Query:  207 SLANIGANCYLNSALQSISSCEKFK----EDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIF------RHWN-KSGQQDSFELLAYVINQVYNEIRNHSEV----------------------KNDISGWLRIRLPMKL-------LIQYSIKC-SCGTIISIPLHSDL--ALHISVPRN--GNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKL-------LRPLPQTLCIHLQKSYW--NGYQMKKINNRINFSAELIIKSE-YCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSF--------------PSIKDNVINNLRLTSINSGEHLKQK--KNILYNLCSVIVHKGNVKGGHYMCYKC----------------IDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
             L NIG +C+LNS LQS ++C  F       +    + ++ L   T+F N++ VLNN  K+A +    +        + W   S +QD+ EL   +   +  E  ++  V                      +    G L + LPMK+       L+   ++C SCG+    P+  D+  +L ++ P+N  G  +LE  L Q  + +I+ +  C  K CA +   ++ K        +  LPQ LCIHL ++ W  NG  +K+ ++ ++F   L +    YC+   E   E+ + +S     T  K LS++     +     ++L ++               P     +   L   + N+   + +    +  Y L +V+ H G+V+ GHY+ Y+                 + N+W+L  D+ +++V  + V  S+ Y+L YE 
Sbjct:   39 GLVNIGNSCFLNSLLQSWAACPSFYNWLYTSVTSSKAAHEKLLSSTIF-NILRVLNNEVKDATDPYNPSSVLGALRAKSWVITSEEQDAHELFHVLTETLDEETSSYPSVLSLFDICHLQDPKNVYQSEKHARTRSQGLLPV-LPMKVVEQPARGLLASQLQCLSCGS--RSPVKYDIFDSLTLTFPKNYWGALSLESLLHQFVSPEIVQSVDC--KGCAKIAKCQVVKSNFRKRVSIGKLPQVLCIHLPRTQWLDNGALLKRYDH-VSFPETLHMDQYLYCNQRKEKGDEI-RGLSGGVDATL-KMLSQAVKPVAAPTSAPVNLLRTLNYDQQFTRTGLFVHPDRSPQIPRELSDVNHNAPPEIAKSGSTDFSYKLAAVVCHLGDVQLGHYVAYRRGIHSGENGNQAIGAGDMGNKWWLTSDSTVTRVSLQQVLSSEAYMLFYER 475          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A3S3QS23 (Ubiquitin carboxyl-terminal hydrolase OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_00395 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.183e-14
Identity = 112/444 (25.23%), Postives = 179/444 (40.32%), Query Frame = 3
Query:  177 KSGTKKVSPPSLANIGANCYLNSALQSISSCEK------------------FKEDIKRLHSKY-------KDLDKLT--LFHNLMIVLNNGSKNA-----IEISRNNIFRHWN-KSGQQDSFELLAYVINQVYNEIRN-----------------HSEVKNDISGWLRIR-------------LPMKLLIQYSIKCS-CGTIISIPLHSDLALHISVPR---NGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKL-LRPLPQTLCIHLQKSYW--NGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSL-IGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYK----CIDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
            KS   K S   L N G  C++N+ LQS+++C+                   F        S Y       +  +KLT  L   L + LNN   N      IE+    +  +W   + +QD+ EL   +   +  E+ +                  S V    S  +  R             LP + L+   ++C  C     + L +  A+ + +P     G   L+ CL +  ++++I    CD  S +G  A  + KL    LPQ LC H+Q+  W  NG  +K+  + +NF  E +   EY +T  +          NNS+  +S        +  +L + K IS Q+S  +I  N  N        S + +  +    Y LCSVIVH G+   GH++ Y+      +N+WY A D  IS+V    V  +  Y++ YE 
Sbjct:   34 KSRNSKGSISGLVNYGNQCFVNAVLQSLAACKSIITWLQYAENNTNANKNCFSSSSSSKQSNYCSTPRNGEPRNKLTTCLLKTLRL-LNNAENNVEESSPIEVLDALLSHNWRIPNEEQDAHELFNVLTTTLERELYSSLPLYSLRDALLIEDLLQSPVSKSSSQGITTRGSQTVSANRNPKSLPTRGLLASQLQCKVCNYKYPVRLDTFDAVSLVIPNKVLGGPILLQECLQKFVSNEVIHEVTCDECSGSGRKASFVKKLTFGKLPQLLCFHIQRLVWLRNGVPLKRTEH-VNF-PEYLTMDEYVYTSCKAK--------NNSTDQYSTVTGLLGGTSSTLTLPKDISFQQS-ATINTNAYNE-------SNDFVTARYR--YRLCSVIVHLGDALSGHFITYRRGGTSDENKWYYASDMNISQVTLREVLSNPAYMIFYER 456          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A2G9IAR8 (Ubiquitin carboxyl-terminal hydrolase OS=Handroanthus impetiginosus OX=429701 GN=CDL12_00381 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.290e-13
Identity = 111/473 (23.47%), Postives = 190/473 (40.17%), Query Frame = 3
Query:  204 PSLANIGANCYLNSALQSI--SSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNH------------------------SEVKNDISGWLRIRL-PMKLLIQYSIKC-SCGTIISIPLHSDLALHISVPRNGNET------LERCLDQHFTDDIILNYIC-------------------------------DTKSCAGLNAL-------KMTKLLRPL-----PQTLCIHLQKSYWNGY-QMKKINNRINFSAELIIKSEYCH--TIDEIDSELL-----KSISNNSSITFSKALSKSSDSE----KSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNI--------LYNLCSVIVHKGNVKGGHYMCYKCID----------------NQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
            P L N+G +C+LN  LQ    SS E+  E I  + S    +++L    +   VL   S     ++ ++   ++N + QQD+ E  +++++ +  EI  H                        SE ++++  W RI L P   ++   + C SC   IS+      +LH+S P  G+ T      L  CL Q F  + I NY C                               D+  C  L++L       + ++  + L     P+ LCIHLQ++ +N + Q  K+   ++F + L + S   +   I ++D+ L      +S    SS  F K      D      K+   + +SL+      ++   N +R     +G  LK   N+        +Y L SV+VH G    GHYM Y+ +                  QW+   D+ +  V ++ VF ++  +L YE+
Sbjct:   72 PGLHNLGNSCFLNVILQEYGSSSVEEADEKIPLVSSLTSLVEELCTIRHTRTVL---SPRKFMLAMDHYIPNFNLTRQQDAEEAFSHLLSSLREEISEHCIHNKSCLADLPALPNYRILTTKISEEESELQRWKRIFLKPFDGILGSILICRSCSFQISLDFQLFHSLHLSPPTYGDNTIMAGCILADCLKQFFVAECIENYHCSKCWHNAATEYLSAFSEDKTDIEKLQRCNKNDSCECKALSSLEVFPWSNRFSRTYKQLSIARSPKILCIHLQRASYNMFGQPVKLLGHVSFPSILDLSSFMNNGVGIKDMDANLRFGLLSRSSGEVSSFPFPKYHKMPRDPRMGSCKAGTVESVSLETEAAGEQER--NGIR---AENGPCLKADGNLQGARFQHQMYRLVSVVVHYGTSGNGHYMVYRKVTAKLDDEDPVALLESAIEQWFCISDSDVHSVSEKEVFDANASMLFYEK 536          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: T1K054 (Ubiquitin carboxyl-terminal hydrolase OS=Tetranychus urticae OX=32264 GN=107372021 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.300e-12
Identity = 98/423 (23.17%), Postives = 167/423 (39.48%), Query Frame = 3
Query:  207 SLANIGANCYLNSALQSISSCEKF-----------KEDIKRLHS-----KYKDLDKLT--LFHNLMIVLNNGSKNAIEISRNNIFRH--WN-KSGQQDSFELL----------------------AYVINQ-VYNEIRNHSEVKNDISG----------WLRIRLPMKLLIQYSIKCS-CGTIISIPLHSDLALHISVPRN---GNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKL-LRPLPQTLCIHLQKSYW--NGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYK---CIDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
             L N G+ C++N+ LQS++ C+              + + RLH+      Y   +KLT  L   +  +    S+NA  I   N  R+  W   + +QD+ EL                       A ++ + V N   N S  +    G          ++   LP K L+   ++C+ CG    + L    ++ +++P +   G  +L+ CL++  +++II N  C+  S  G N   + +L    LPQ LCIH  +  W  NG  +KK ++ + F  E +   +Y +         LKS   N+      A           +G  ++    +P     +  N+ L                Y L + IVH G+ + GH++ Y+     + QWYL  D  +       V     Y+L YE 
Sbjct:    9 GLINFGSQCFVNAVLQSLAGCKSIVNWLQYSSKLNDQWLTRLHAIHSTNGYTKENKLTSSLLSTIQSINQQNSQNASPIDVLNALRYHRWRIPNEEQDAHELFNALTTTLESELYSSMPVYSLRDAIIVEELVTNGFTNKSTPRITTRGSQDAFTLNNRFIPRPLPTKGLLASQLQCTQCGYKYPVHLEGFYSVSLAMPNSLMTGISSLKECLNKFVSNEIIQNVRCEECSKIGENPNFVKRLTFAKLPQILCIHFHRLMWHPNGITIKK-SDHVTF-PEYLTMDDYVY-----QRRTLKSPKKNNLDHIGGAF----------LGSYVT---PYPQTSSPLCQNILLGQNAKRPLGSNHSKYRYRLVATIVHIGDSQSGHFVTYRRSTGREGQWYLTSDTVVRPAHLTEVLSKPAYMLFYER 411          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 69.707 bits (169), Expect = 3.522e-12
Identity = 95/379 (25.07%), Postives = 156/379 (41.16%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLDQHFTDDIILN----YICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEH-LKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL       +  P   ++   ++E  L Q F     L+    Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL + S +      ID E  KS    S          S  S++        +   F S  D V   + L S ++ E  LK K ++ + L SV+VH G+  GGHY  Y CI    D QWY  +D  +SK+ ++ + K+
Sbjct:  174 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVRCLECGYESWRIDTYLDIPL-------VIRPFGASQAFGSVEEAL-QAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDM-SPF------IDLEDEKSPQTESCTDSGAENEGSCHSDQ--------MSNDF-STDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSGSAAGGHY--YACIKSFSDGQWYSFNDQHVSKITQDDIRKT 516          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 63.929 bits (154), Expect = 2.455e-10
Identity = 99/395 (25.06%), Postives = 161/395 (40.76%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLD---QHFTDDIILNYICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEH-LKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRK----EIVF---KSDPYILIYEEK 1286
            L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL       +  P   ++   ++E  L    Q  T D    Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL +          ID E  KS    S          S  S++        +   F S  D V   + L S ++ E  LK K ++ + L SV+VH G+  GGHY  Y CI    D QWY  +D  +SKV +    ++++    ++ Y+LIY  K
Sbjct:  188 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVRCLECGYESWRIDTYLDIPL-------VIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPF-------IDLEDEKSPQTESCTDSGAENEGSCHSDQ--------MSNDF-STDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSGSAAGGHY--YACIKSFSDGQWYSFNDQHVSKVSQIETNDLLYFNSSTNAYMLIYRLK 547          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp30 (ubiquitin specific peptidase 30 [Source:NCBI gene;Acc:103037211])

HSP 1 Score: 62.7734 bits (151), Expect = 2.839e-10
Identity = 99/457 (21.66%), Postives = 173/457 (37.86%), Query Frame = 3
Query:  189 KKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSK------YKDLD---KLTLFHNLMI----------VLNNGSK-NAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKN---------------------------DISGWLRIRLPMKLLIQYSIKCS-CGTIISIPLHSDLALHISVPR---NGNETLERCLDQHFTDDIILNYICD--TKSCAG-------------LNALKMTKLLRPLPQTLCIHLQKSYWN--GYQMKKINNRINFSAELII-KSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQK----------SFPSI---KDNVINNLRLT-SINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYK----------CIDNQWYLADDNQISKVRKEIVFKSDPYILIYE 1280
            +K + P L N+G  C++NS LQ +++C  F   ++   S+        + D    +TL   L            VL+ G    A+ + R +I    +   +QD+ EL   + + +  E     +V +                            I    R + P    +   + C  C     +   S  +L +S+P        TL++CL    + + I    C+  TK+  G             +  LK+ KL    PQ LCIHLQ+  W+  G  +K+    + FS  L + + ++C     +      S +N  S T + A     D+    +  G+  +           +FPS+     ++   L LT   +S E+L       + L +V+VH G++  GH++ Y+              QW    D+ + K   +    S  Y+L YE
Sbjct:   33 RKGTVPGLLNLGNTCFMNSLLQGLAACPSFVRWLEDFESQSSISLARPETDTRLSITLLQLLKALSSHEPVEDDVLDAGCLLEALRLHRWHI----SSFEEQDAHELFHVLTSSLEEERDQQPKVTHLFDMETLEKSAESSEKAISCRSRGPLHPIPSLWRTQHPFHGRLTSYMACKRCERQSPVRYDSFDSLSLSIPAVQWGRPVTLDQCLQHFISSETIKEVECENCTKTQTGELVNGQESQRTTFIKQLKLGKL----PQCLCIHLQRLTWSTEGTPIKR-QEHVQFSEYLSMDRYKHCSAAQRLQK---PSRANKPSSTGATA-----DAHDQTVANGLDPEHHNNNKPLSNGAFPSVFIHSPSLSPQLNLTCDYSSSEYL-------FRLTAVLVHHGDMHSGHFITYRRGPPSPRSTAPFSPQWLWVSDDSVRKASLQEALSSSAYLLFYE 465          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 63.1586 bits (152), Expect = 4.145e-10
Identity = 94/378 (24.87%), Postives = 153/378 (40.48%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNE---TLERCLD---QHFTDDIILNYICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEH-LKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  + +   +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL       +  P   ++   ++E  L    Q  T D    Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL +          ID E  KS    S          S  S++        +   F S  D V   + L S ++ E  LK K ++ + L SV+VH G+  GGHY  Y CI    D QWY  +D  +SK+ ++ + K+
Sbjct:  194 LVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVRCLECGYESWRIDTYLDIPL-------VIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPF-------IDLEDEKSPQTESCTDSGAENEGSCHSDQ--------MSNDF-STDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSGSAAGGHY--YACIKSFSDGQWYSFNDQHVSKITQDDIRKT 536          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp31 (ubiquitin specific peptidase 31 [Source:NCBI gene;Acc:103022108])

HSP 1 Score: 56.225 bits (134), Expect = 6.574e-8
Identity = 26/66 (39.39%), Postives = 38/66 (57.58%), Query Frame = 3
Query: 1095 KQKKNILYNLCSVIVHKGNVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            +  ++ LY+L +V  H GN+ GGHY   C   ID QWY  DD+++  V  E V +   YIL Y+ +
Sbjct:  666 RNPEDYLYDLYAVCNHHGNMHGGHYTAYCKNSIDGQWYCFDDSEVQPVADEDVCQQTAYILFYQRR 731          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp3 (ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5142])

HSP 1 Score: 46.595 bits (109), Expect = 4.578e-6
Identity = 19/59 (32.20%), Postives = 36/59 (61.02%), Query Frame = 3
Query: 1113 LYNLCSVIVHKGN-VKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            LY+L +V+VH G+ V  GHY  Y   +  W+  +D+ +++  ++ V ++  YIL Y ++
Sbjct:  204 LYDLAAVVVHHGSGVGSGHYTAYAAHNGLWFHFNDSTVTRSEEDTVARAKAYILFYTKR 262          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP8 (Ubiquitin-specific protease component of the SAGA acetylation complex; required for SAGA (Spt-Ada-Gcn5-Acetyltransferase)-mediated deubiquitination of histone H2B [Source:SGD;Acc:S000004836])

HSP 1 Score: 47.7506 bits (112), Expect = 2.551e-6
Identity = 21/58 (36.21%), Postives = 34/58 (58.62%), Query Frame = 3
Query: 1107 NILYNLCSVIVHKGNVKGGHYMCY-KCIDNQWYLADDNQISKVRKEIVFKSDPYILIY 1277
            +I+Y L  ++ HKG V  GHY+ + K    QW+  +D+ +S + +E V K   Y+L Y
Sbjct:  408 DIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFY 465          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO44586 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVJ3])

HSP 1 Score: 65.0846 bits (157), Expect = 2.232e-11
Identity = 91/433 (21.02%), Postives = 168/433 (38.80%), Query Frame = 3
Query:  207 SLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDK---------LTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG------QQDSFELLAYVINQVYNEIRNHSEV------------KNDISGWLRIRL--------------PMKLLIQYSIKC-SCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYIC-------DTKSCAGLNALKMTK-------LLRPLPQTLCIHLQKSYWNGYQMK-KINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGK----GISLQ------KSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCI--------DNQWYLADDNQISKVRKEIVFKSDPYILIYE 1280
             L N+G  C++NS LQ ++S   F         + + L++         + L   L I  N    +A+ +S   I +     G      QQD+FE    + + +  E+   S +            K  + G +R R+              P + L+   + C  C     +      ++ +S+P     TL+  L     +D++  ++C       + K C  L +    K        +  LPQ LCIH++++YW+   M  KIN  + F   L +     +  D +     +S S+ +     K L++  +  +S   +     +++Q       +FPS    +++ +  +  NS    + +   +Y L +V  H G+V  GHY+ Y+           + W    D  +     + VF S  Y+L YE
Sbjct:   11 GLYNLGNTCFMNSVLQGLASIASFVSWTDEFTWRKEQLNQDGNLLGEAIVELMKELNIEWNE--DDAV-LSAGPIIQALQHHGWVIPSNQQDAFEFFQVLSSTLEEELGELSAILDFSSITSVEKSKGGLDGSVRHRISRVSYGRRCVKKHVPFRGLLASQLVCKECRFKCPVKFDGFDSISLSLPM----TLQVGLS---LEDLLQKFVCSESVDSVECKGCGNLGSENTNKSSFIKRLTVGKLPQCLCIHVKRTYWHNNGMPYKINTFVRFGEYLNLGP---YMYDPVSRSPKRSRSDLNLPMTIKLLAEGGEGRRSPTKRVRTSSVNMQMLSELGSAFPS---GLLSPISFSRQNS----ESRSRTVYQLTAVTSHMGDVDDGHYVTYRRFVPSHPDERGSLWLYTSDELVEVATHDQVFSSSAYMLYYE 423          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO37466 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SFT1])

HSP 1 Score: 54.299 bits (129), Expect = 5.610e-8
Identity = 24/69 (34.78%), Postives = 40/69 (57.97%), Query Frame = 3
Query: 1083 GEHLKQKKNILYNLCSVIVHKGN-VKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            G+   + K +LY+L +V+VH G+ V  GHY  +   D  WY  +D+ +S++ +E+V K   YI  Y  +
Sbjct:  372 GQEKGETKPVLYDLAAVVVHHGSGVSAGHYTTFAFHDGAWYNFNDSSVSRIDEEMVAKCKGYIFFYTRR 440          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO34754 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SNI6])

HSP 1 Score: 50.0618 bits (118), Expect = 1.355e-6
Identity = 24/60 (40.00%), Postives = 32/60 (53.33%), Query Frame = 3
Query: 1113 LYNLCSVIVHKGNVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            LY+L +V  H GN+ GGHY   C    D QWYL DD ++ +V    V     Y+L Y  +
Sbjct:  552 LYDLYAVCNHLGNMSGGHYTAHCRNPTDGQWYLYDDTRVEQVPVNQVTTQAAYLLFYARR 611          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:101157355])

HSP 1 Score: 65.855 bits (159), Expect = 6.332e-11
Identity = 94/372 (25.27%), Postives = 149/372 (40.05%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICD--TKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNIL-YNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  +     +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL        S      E   +   Q  T D    Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL + S +      ID E  KS    S          S  S++        +   F S  D V   + L S +S E   + K++L + L SV+VH G+  GGHY  Y CI    D QWY  +D  +SK+ ++ + K+
Sbjct:  175 LVNQAMTCYLNSLLQTLYMTPEFRNALYNWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVRCLECGYESWRIDTYLDIPLVI-RPFGASQAYGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDM-SPF------IDVEDEKSPQTESCTDSGAENEGSCHSDQ--------MSNDF-STDDCVDEGICLDSTSSTERAFKPKSLLTFELFSVMVHSGSAAGGHY--YACIKSFSDGQWYSFNDQHVSKITQDDIRKT 517          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:101157355])

HSP 1 Score: 65.4698 bits (158), Expect = 6.584e-11
Identity = 93/372 (25.00%), Postives = 147/372 (39.52%), Query Frame = 3
Query:  210 LANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLT----LFHNLMIVLNNGSKNAIEISRNNIFRHWNKSG--QQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCG-------TIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDT--KSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKI--NNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNIL-YNLCSVIVHKGNVKGGHYMCYKCI----DNQWYLADDNQISKVRKEIVFKS 1256
            L N    CYLNS LQ++    +F+  +     +  + D +T        L ++L    K AIE +       W+ S   QQ   + L  V+     +    +E  + I+   + +L      +  ++C  CG       T + IPL        S      E   +   Q  T D    Y C+   K C     L+        P  L + L++  ++   M +I  N+R+ F  EL +          ID E  KS    S          S  S++        +   F S  D V   + L S +S E   + K++L + L SV+VH G+  GGHY  Y CI    D QWY  +D  +SK+ ++ + K+
Sbjct:   96 LVNQAMTCYLNSLLQTLYMTPEFRNALYNWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKL------KDYVRCLECGYESWRIDTYLDIPLVI-RPFGASQAYGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHF----PYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPF-------IDVEDEKSPQTESCTDSGAENEGSCHSDQ--------MSNDF-STDDCVDEGICLDSTSSTERAFKPKSLLTFELFSVMVHSGSAAGGHY--YACIKSFSDGQWYSFNDQHVSKITQDDIRKT 438          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp31 (ubiquitin specific peptidase 31 [Source:NCBI gene;Acc:101156822])

HSP 1 Score: 57.3806 bits (137), Expect = 2.617e-8
Identity = 26/66 (39.39%), Postives = 38/66 (57.58%), Query Frame = 3
Query: 1095 KQKKNILYNLCSVIVHKGNVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            +   + LY+L +V  H GN+ GGHY   C   ID QWY  DD+++S +  E V +   YIL Y+ +
Sbjct:  640 RNPDDYLYDLYAVCNHHGNMHGGHYTAYCKNSIDGQWYCFDDSEVSPIADEEVCQQSAYILFYQRR 705          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp31 (ubiquitin specific peptidase 31 [Source:NCBI gene;Acc:101156822])

HSP 1 Score: 57.3806 bits (137), Expect = 2.793e-8
Identity = 26/66 (39.39%), Postives = 38/66 (57.58%), Query Frame = 3
Query: 1095 KQKKNILYNLCSVIVHKGNVKGGHYM--CYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            +   + LY+L +V  H GN+ GGHY   C   ID QWY  DD+++S +  E V +   YIL Y+ +
Sbjct:  669 RNPDDYLYDLYAVCNHHGNMHGGHYTAYCKNSIDGQWYCFDDSEVSPIADEEVCQQSAYILFYQRR 734          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: ENSORLT00000008874.2 (ubiquitin carboxyl-terminal hydrolase 31 [Source:NCBI gene;Acc:101161097])

HSP 1 Score: 53.5286 bits (127), Expect = 4.261e-7
Identity = 24/66 (36.36%), Postives = 38/66 (57.58%), Query Frame = 3
Query: 1095 KQKKNILYNLCSVIVHKGNVKGGHY--MCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            +  ++ LY+L +V  H G ++GGHY   C   ID QWY  DD+ +  + ++ V K   YIL Y+ +
Sbjct:  670 RDPEDYLYDLYAVCNHHGTMQGGHYTAFCKNSIDGQWYCFDDSDVHPLSEDEVCKQTAYILFYQRR 735          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000040010.1 (SMESG000040010.1)

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 415/417 (99.52%), Postives = 416/417 (99.76%), Query Frame = 3
Query:   36 MSILRRLSKSWSDLTTIFTRNEVEIDINNSSEQNTNVGEPLNSSSVLKSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            MSIL+RLSKSWSDLTTIFTRNEVEIDINNSSEQNTNVGEPLNS SVLKSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK
Sbjct:    1 MSILKRLSKSWSDLTTIFTRNEVEIDINNSSEQNTNVGEPLNSCSVLKSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 417          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000040010.1 (SMESG000040010.1)

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 409/417 (98.08%), Postives = 411/417 (98.56%), Query Frame = 3
Query:   36 MSILRRLSKSWSDLTTIFTRNEVEIDINNSSEQNTNVGEPLNSSSVLKSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 1286
            MSIL+RLSKSWSDLTTIFTRNEVEIDINNSSEQNTNV     + SVLKSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK
Sbjct:    1 MSILKRLSKSWSDLTTIFTRNEVEIDINNSSEQNTNVD--FITGSVLKSGTKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEEK 415          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039981.1 (SMESG000039981.1)

HSP 1 Score: 256.144 bits (653), Expect = 1.425e-81
Identity = 139/369 (37.67%), Postives = 205/369 (55.56%), Query Frame = 3
Query:  201 PPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISG-----WLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLE--RCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAEL-IIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
            P  L NIG NCYLNS LQ+ISS   F + I +LH  Y  L+KL  F +L+  +++G++N  +IS++ IF++WNKSGQQD FELL+YV+NQVY+EIR + E  N+I       WL   LPM++++ Y+I+C CG ++ +PLHS+LALH+ +  +  + +E    +DQ   D+ I NY C +  C    AL+ TKL++PLP T+C+HLQ+++WNG  MKKI+     +  L +    Y  TI E     +K+I N+  +                                   +  RLTS                    IVH+G+VKGGHY+CYK + N+W+L +DNQ+  V    +     Y+L YE+
Sbjct:   31 PSPLRNIGTNCYLNSVLQAISSSSAFVDGIVQLHENYGSLEKLEFFTDLIQNIHSGNQNLKDISKHQIFKNWNKSGQQDCFELLSYVLNQVYSEIRKYKETMNEIETKNLLEWLNQSLPMRIIVSYTIRCECGNLVDVPLHSELALHVPIISDKKQPIELQSLVDQFLGDNEITNYECYSNKCIKTKALRETKLVKPLPNTICLHLQRTFWNGKTMKKIDKIFAETENLDLFVRNYVETIIETS---VKAIQNDCEVYG---------------------------------DEYRLTSF-------------------IVHRGSVKGGHYVCYKSMRNRWFLTNDNQVKPVELHKILNCQAYLLFYEK 344          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039999.1 (SMESG000039999.1)

HSP 1 Score: 258.07 bits (658), Expect = 6.168e-80
Identity = 131/285 (45.96%), Postives = 186/285 (65.26%), Query Frame = 3
Query:  195 VSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKD-LDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSE-----VKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNET---------------LERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSE 986
            V PPSL NIGANCYLNSA Q ISSC KF  D+  L  KY   ++KL +F+ L+ +LN     ++EISRN IF++WNK GQQDSFELLA+V+NQVYN+IR + E      K +I  WL+  LPM+++IQY I C C +II +PL SDLALH+++P  G+                 L+  ++  F  D I +Y C+T+ C G +A + T+L+ PLP+TLCIHLQK++WNGY+M+KI  +I FS EL I+S++  + D + + + K+  +   +  SK   +SS+S+
Sbjct:   16 VKPPSLLNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGEKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSRNYNCDFSYIFIILGSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKANEDKLKLESSKENKESSESK 300          

HSP 2 Score: 67.781 bits (164), Expect = 6.551e-12
Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = 3
Query: 1116 YNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYEE 1283
            Y L SVIVH G V GGHY+CY+  + QWY+ +D+ +  VR+E V  S+ YIL YE+
Sbjct:  497 YLLTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSSVYPVREEDVLNSEAYILFYEK 552          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000040007.1 (SMESG000040007.1)

HSP 1 Score: 267.314 bits (682), Expect = 1.125e-78
Identity = 133/286 (46.50%), Postives = 188/286 (65.73%), Query Frame = 3
Query:  189 KKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKY-KDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSE-----VKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNET---------------LERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDS 983
            K V PPSL+NIGANCYLNSA Q ISSC KF  D+  L  KY   ++KL +F+ L+ +LN G   ++EISRN IF++WNK GQQDSFELLA+V+NQVYN+IR + E      K +I  WL+  LPM+++IQY I C C +II +PL SDLALH+++P  G+                 L+  ++  F  D I +Y C+T+ C G +A + T+L+ PLP+TLCIHLQK++WNGY+M+KI  +I FS EL I+S++  + D + + + K+  +   +  SK   +SS+S
Sbjct:  230 KVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSRNYNCDFSYIFIILGSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKANEDKLKLESSKENKESSES 515          

HSP 2 Score: 65.4698 bits (158), Expect = 5.076e-11
Identity = 28/55 (50.91%), Postives = 37/55 (67.27%), Query Frame = 3
Query: 1116 YNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYE 1280
            Y L SVIVH G V GGHY+CY+  + QWY+ +D+ I  V ++ V  S+ YIL YE
Sbjct: 1802 YLLTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSSIYPVHEQDVLNSEAYILFYE 1856          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP471.146e-1024.27ubiquitin specific peptidase 47 [Source:HGNC Symbo... [more]
USP471.310e-1024.21ubiquitin specific peptidase 47 [Source:HGNC Symbo... [more]
USP471.361e-1024.21ubiquitin specific peptidase 47 [Source:HGNC Symbo... [more]
USP302.704e-922.01ubiquitin specific peptidase 30 [Source:HGNC Symbo... [more]
USP302.809e-922.01ubiquitin specific peptidase 30 [Source:HGNC Symbo... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
C04E6.59.975e-924.69pep chromosome:WBcel235:V:5902133:5904831:1 gene:W... [more]
usp-36.783e-723.40Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;... [more]
usp-338.814e-734.83Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
usp-142.546e-624.08Ubiquitin carboxyl-terminal hydrolase 14 [Source:... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Usp20-335.475e-839.13gene:FBgn0033916 transcript:FBtr0087535[more]
Usp472.253e-722.80gene:FBgn0016756 transcript:FBtr0306259[more]
Usp472.316e-722.80gene:FBgn0016756 transcript:FBtr0077096[more]
Usp472.316e-722.80gene:FBgn0016756 transcript:FBtr0077095[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp471.123e-1125.07ubiquitin specific peptidase 47 [Source:ZFIN;Acc:Z... [more]
usp311.004e-739.39ubiquitin specific peptidase 31 [Source:ZFIN;Acc:Z... [more]
usp311.006e-739.39ubiquitin specific peptidase 31 [Source:ZFIN;Acc:Z... [more]
usp311.236e-739.39ubiquitin specific peptidase 31 [Source:ZFIN;Acc:Z... [more]
usp39.431e-739.34ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpd5.970e-1522.69heterogeneous nuclear ribonucleoprotein D [Source:... [more]
hnrnpd3.698e-1422.93heterogeneous nuclear ribonucleoprotein D [Source:... [more]
usp475.804e-1225.40ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp471.519e-1124.41ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp471.558e-1124.41ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp476.811e-1224.57ubiquitin specific peptidase 47 [Source:MGI Symbol... [more]
Usp471.112e-1024.11ubiquitin specific peptidase 47 [Source:MGI Symbol... [more]
Usp471.688e-1024.39ubiquitin specific peptidase 47 [Source:MGI Symbol... [more]
Usp437.775e-737.10ubiquitin specific peptidase 43 [Source:MGI Symbol... [more]
Usp508.763e-736.07ubiquitin specific peptidase 50 [Source:MGI Symbol... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4QNN3|UBP30_XENTR1.959e-1322.93Ubiquitin carboxyl-terminal hydrolase 30 OS=Xenopu... [more]
sp|E1C1R4|UBP47_CHICK4.964e-1223.88Ubiquitin carboxyl-terminal hydrolase 47 OS=Gallus... [more]
sp|A1A5G2|UBP47_XENTR7.631e-1124.41Ubiquitin carboxyl-terminal hydrolase 47 OS=Xenopu... [more]
sp|Q5U252|UBP47_XENLA1.091e-1024.47Ubiquitin carboxyl-terminal hydrolase 47 OS=Xenopu... [more]
sp|Q96K76|UBP47_HUMAN6.534e-1024.21Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo s... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1JNX22.365e-1823.73Ubiquitin carboxyl-terminal hydrolase OS=Strigamia... [more]
A0A2C9LX645.286e-1523.77Ubiquitin carboxyl-terminal hydrolase OS=Biomphala... [more]
A0A3S3QS231.183e-1425.23Ubiquitin carboxyl-terminal hydrolase OS=Dinothrom... [more]
A0A2G9IAR81.290e-1323.47Ubiquitin carboxyl-terminal hydrolase OS=Handroant... [more]
T1K0542.300e-1223.17Ubiquitin carboxyl-terminal hydrolase OS=Tetranych... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp473.522e-1225.07ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp472.455e-1025.06ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp302.839e-1021.66ubiquitin specific peptidase 30 [Source:NCBI gene;... [more]
usp474.145e-1024.87ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp316.574e-839.39ubiquitin specific peptidase 31 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp34.578e-632.20ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
UBP82.551e-636.21Ubiquitin-specific protease component of the SAGA ... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO445862.232e-1121.02Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO374665.610e-834.78Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO347541.355e-640.00Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp476.332e-1125.27ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp476.584e-1125.00ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp312.617e-839.39ubiquitin specific peptidase 31 [Source:NCBI gene;... [more]
usp312.793e-839.39ubiquitin specific peptidase 31 [Source:NCBI gene;... [more]
ENSORLT00000008874.24.261e-736.36ubiquitin carboxyl-terminal hydrolase 31 [Source:N... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040010.10.000e+099.52SMESG000040010.1[more]
SMESG000040010.10.000e+098.08SMESG000040010.1[more]
SMESG000039981.11.425e-8137.67SMESG000039981.1[more]
SMESG000039999.16.168e-8045.96SMESG000039999.1[more]
SMESG000040007.11.125e-7846.50SMESG000040007.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015359 ID=SMED30015359|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1367bp
CTGTTTTTTGAATTAAGTCATTAGTACAATTTGTTATGTCCATACTGAGA
AGGCTATCCAAAAGTTGGAGTGATCTAACAACAATATTTACTCGAAATGA
AGTAGAAATAGATATTAATAATTCAAGCGAACAAAATACAAACGTCGGTG
AGCCTTTGAATTCGTCTTCAGTTCTAAAAAGTGGAACCAAAAAAGTGTCA
CCTCCATCTTTGGCTAATATCGGTGCAAACTGTTATCTGAATTCCGCTTT
GCAAAGCATATCATCATGCGAAAAGTTCAAAGAAGACATCAAACGCCTTC
ATAGCAAATATAAAGATCTGGACAAGTTAACACTCTTTCACAATCTGATG
ATTGTCCTAAATAATGGATCTAAAAACGCGATTGAAATATCAAGGAATAA
CATATTTAGGCATTGGAATAAGTCTGGACAGCAGGACAGTTTTGAATTAT
TGGCCTATGTGATTAATCAAGTATATAATGAAATCAGAAATCACTCAGAA
GTGAAAAATGATATTTCTGGGTGGCTTCGTATTCGTCTGCCAATGAAACT
TTTGATTCAATACAGTATAAAATGCAGTTGCGGAACTATCATTTCAATTC
CACTTCATTCGGATTTGGCTCTTCATATTTCCGTTCCTAGAAACGGAAAC
GAAACATTAGAAAGGTGTCTTGATCAGCATTTCACTGATGATATTATTTT
GAACTACATATGTGATACCAAGAGCTGTGCTGGATTAAATGCTTTGAAAA
TGACGAAATTATTACGGCCTTTGCCACAGACGTTATGCATTCATTTACAG
AAATCGTATTGGAATGGATATCAAATGAAGAAAATTAATAATAGAATCAA
CTTTTCCGCAGAATTAATAATAAAATCCGAATATTGCCATACAATAGACG
AGATAGACTCGGAATTATTGAAGTCAATCAGTAACAATTCAAGTATCACC
TTTTCAAAAGCTTTAAGTAAGTCAAGTGATTCGGAAAAATCGCTGATAGG
TAAAGGAATTTCGCTTCAAAAAAGTTTCCCCTCTATTAAAGATAACGTAA
TTAACAATCTTCGGTTAACTTCCATCAACTCTGGCGAACATTTAAAACAG
AAAAAAAACATACTGTACAATTTATGTTCAGTTATCGTGCACAAAGGAAA
CGTCAAAGGGGGTCACTATATGTGCTACAAGTGTATTGACAATCAGTGGT
ACTTAGCGGATGACAACCAAATTAGCAAAGTTCGGAAAGAAATCGTTTTC
AAGAGTGATCCTTACATTTTGATTTACGAAGAAAAATGAATTTATTTTGT
TTTACATAACCCGATTATTTTATATGATTTTTAATTAATAAAAATTCAAT
TTAAATTTTAAAAAAAA
back to top

protein sequence of SMED30015359-orf-1

>SMED30015359-orf-1 ID=SMED30015359-orf-1|Name=SMED30015359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MSILRRLSKSWSDLTTIFTRNEVEIDINNSSEQNTNVGEPLNSSSVLKSG
TKKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTL
FHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEI
RNHSEVKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISV
PRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTL
CIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISN
NSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSG
EHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVR
KEIVFKSDPYILIYEEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016578histone deubiquitination
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 84..104
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 54..423
e-value: 2.1E-49
score: 170.4
NoneNo IPR availablePANTHERPTHR24006FAMILY NOT NAMEDcoord: 48..421
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 65..421
e-value: 7.90282E-29
score: 111.421
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 65..420
e-value: 2.2E-30
score: 106.0
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00973USP_2coord: 367..384
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 63..423
score: 29.288
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 65..422