Tubby-like protein

Overview
NameTubby-like protein
Smed IDSMED30015354
Length (bp)1672
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubby-like protein (SMED30015354) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubby-like protein (SMED30015354) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubby-like protein (SMED30015354) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubby-like protein (SMED30015354) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015354

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30015354h1SMcG0005327 Contig1351newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30015354h1SMcG0005327 Contig1351uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30015354h1SMcG0005327 Contig1351newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30015354h1SMcG0005327 Contig1351uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30015354h1SMcG0005327 Contig1351newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015354h1SMcG0005327 Contig1351uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30015354h1SMcG0005327 Contig1351newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30015354h1SMcG0005327 Contig1351uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30015354h1SMcG0010700 Contig1351newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30015354h1SMcG0010700 Contig1351uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30015354h1SMcG0010700 Contig1351newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30015354h1SMcG0010700 Contig1351uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30015354h1SMcG0010700 Contig1351newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015354h1SMcG0010700 Contig1351uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30015354h1SMcG0010700 Contig1351newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30015354h1SMcG0010700 Contig1351uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30015354h1SMcG0005327 dd_Smed_v4_9224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015354h1SMcG0005327 dd_Smed_v4_9224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015354h1SMcG0005327 dd_Smed_v4_9224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015354h1SMcG0005327 dd_Smed_v4_9224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015354h1SMcG0005327 dd_Smed_v4_9224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015354h1SMcG0005327 dd_Smed_v4_9224_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015354h1SMcG0005327 dd_Smed_v4_9224_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubby-like protein vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 114.775 bits (286), Expect = 1.693e-26
Identity = 82/281 (29.18%), Postives = 136/281 (48.40%), Query Frame = 2
Query:  689 KDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF---NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            +DL  F L P P+ + +KC++ +    +D+ +  T FL    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   V              N +  S+  L+      ++  + Y+ +      PR ++  +P  +     ++  +  P+   E L     N + + II L+N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YPLC  QAFAIALS    K+A
Sbjct:  255 QDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLH---LDREDGKKV----FLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGV--------------NPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMN---MVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLA 510          
BLAST of Tubby-like protein vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 114.39 bits (285), Expect = 1.980e-26
Identity = 82/281 (29.18%), Postives = 136/281 (48.40%), Query Frame = 2
Query:  689 KDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF---NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            +DL  F L P P+ + +KC++ +    +D+ +  T FL    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   V              N +  S+  L+      ++  + Y+ +      PR ++  +P  +     ++  +  P+   E L     N + + II L+N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YPLC  QAFAIALS    K+A
Sbjct:  249 QDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLH---LDREDGKKV----FLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGV--------------NPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMN---MVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLA 504          
BLAST of Tubby-like protein vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 114.005 bits (284), Expect = 3.617e-26
Identity = 82/283 (28.98%), Postives = 137/283 (48.41%), Query Frame = 2
Query:  689 KDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF---NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            +DL  F L P P+ + +KC++ +    +D+ +  T FL    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   V              N +  S+  L+      ++  + Y+ +      PR ++  +P  +     ++  +  P+   E L     N + + II L+N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YPLC  QAFAIALS    K+A +
Sbjct:  304 QDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFL---HLDREDGKKV----FLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGV--------------NPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNM---VHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 561          
BLAST of Tubby-like protein vs. Ensembl Human
Match: TULP3 (TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12425])

HSP 1 Score: 99.7525 bits (247), Expect = 7.963e-22
Identity = 72/276 (26.09%), Postives = 126/276 (45.65%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNW--DDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F+ +P P+ V V+C++++    +D+ L  T +++ L+  E   +       L+     +KSK  +  +S DP D      S +G +++N +GT+F  + + +             +  E+              I Y+ +      PR ++  IP    +  +  Y   N      +   N   + ++ L N+ P ++ D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YPLC  QAF I LS    K+A +
Sbjct:  187 DLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMY-LEKEENQKI------FLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQEL------------AAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQI-VHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE 442          
BLAST of Tubby-like protein vs. Ensembl Human
Match: TULP3 (TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12425])

HSP 1 Score: 96.6709 bits (239), Expect = 1.198e-20
Identity = 70/267 (26.22%), Postives = 122/267 (45.69%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNW--DDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALS 1480
            DL  F+ +P P+ V V+C++++    +D+ L  T +++ L+  E   +       L+     +KSK  +  +S DP D      S +G +++N +GT+F  + + +             +  E+              I Y+ +      PR ++  IP    +  +  Y   N      +   N   + ++ L N+ P ++ D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YPLC  QAF I LS
Sbjct:  187 DLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMY-LEKEENQKI------FLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQEL------------AAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQI-VHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLS 433          
BLAST of Tubby-like protein vs. Ensembl Celegans
Match: tub-1 (Tubby protein homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09306])

HSP 1 Score: 83.1889 bits (204), Expect = 9.191e-17
Identity = 74/301 (24.58%), Postives = 130/301 (43.19%), Query Frame = 2
Query:  671 NINDLKKDLHRFLLTPPPKNVVVKCQVMKT-NNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF-------NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNL-------------DKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGK-CKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            + N +K +L +F+  P  ++ + KC + +  + +DK +  T FL  L+  +TD         L+     +KS   +  +STDP++           +++N LGT+F  +                      +S QN K          ++  + Y+ +      PR +T  +P      G    +   P  R  V  +             D D +  L N+ P+++++ + YVLNF GRVT+ SVKNF + ++ +     V Q G+     + +DF YPL   QAF IA++    K+A +
Sbjct:  159 DYNFIKNNLAKFVEDPAVEHCLYKCSITRQKSGVDKGMFPTYFLH-LEEFDTDKRQK---IFLLAARKRKKSTTANYLLSTDPTNLSREGEGYCAKVRSNALGTQFTVY----------------------DSGQNPKKTTNHAAIRQELAAVIYETNVLGFKGPRKMTIVMP------GIEPPTENRPAVRCPVRPIQDKHTLLERYRLNDLDSLKILSNKSPQWNDETQSYVLNFHGRVTQASVKNFQI-IHQSSPEYIVMQFGRISDDEFTMDFRYPLSAVQAFGIAMTSFHGKLACE 426          
BLAST of Tubby-like protein vs. Ensembl Celegans
Match: tub-2 (TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53])

HSP 1 Score: 53.5286 bits (127), Expect = 1.707e-7
Identity = 26/65 (40.00%), Postives = 41/65 (63.08%), Query Frame = 2
Query: 1253 IICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCK-THYIVDFTYP 1444
            I  + N+ P ++E  ++Y L+FGGRVT+ S KNF + ++    SK+V Q G+ +   Y +DF YP
Sbjct:  250 IETMTNKTPFWNEQNQVYQLDFGGRVTQESAKNFQIELD----SKQVLQFGRIEGGSYTLDFRYP 310          
BLAST of Tubby-like protein vs. Ensembl Celegans
Match: tub-2 (TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53])

HSP 1 Score: 52.373 bits (124), Expect = 7.430e-7
Identity = 26/66 (39.39%), Postives = 42/66 (63.64%), Query Frame = 2
Query: 1250 EIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCK-THYIVDFTYP 1444
            +I  + N+ P ++E  ++Y L+FGGRVT+ S KNF + ++    SK+V Q G+ +   Y +DF YP
Sbjct:  789 KIETMTNKTPFWNEQNQVYQLDFGGRVTQESAKNFQIELD----SKQVLQFGRIEGGSYTLDFRYP 850          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: ktub (gene:FBgn0015721 transcript:FBtr0089600)

HSP 1 Score: 110.923 bits (276), Expect = 9.908e-26
Identity = 82/280 (29.29%), Postives = 131/280 (46.79%), Query Frame = 2
Query:  677 NDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDK----DEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
             D+  ++ +F++ P P+ V+ KC++ +        LF  +   L+      +       L+ G   +KSK  +  VS DP+D   N+    G +++N  GT F  F               +  N E   +  L     + VI Y  +      PR +T  +P   +       S+  PK++  +L+L K    D I+ L N+ P ++++ + YVLNF GRVT+ SVKNF L ++ +     V Q G+     + +D+ YPLC  QAFAIALS    KIA
Sbjct:  206 GDVIGNIDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKI------FLLGGRKRKKSKTSNYIVSCDPTDLSRNADGFCGKLRSNVFGTSFTVF---------------DNGNKESTESPRLD----LAVIIYDTNILGFKGPRNMTVILPGMTEDDQRVKISSADPKQQG-ILDLWKMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQL-VHDSDPEYIVMQFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIA 458          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: ktub (gene:FBgn0015721 transcript:FBtr0342842)

HSP 1 Score: 110.538 bits (275), Expect = 1.273e-25
Identity = 82/280 (29.29%), Postives = 131/280 (46.79%), Query Frame = 2
Query:  677 NDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDK----DEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
             D+  ++ +F++ P P+ V+ KC++ +        LF  +   L+      +       L+ G   +KSK  +  VS DP+D   N+    G +++N  GT F  F               +  N E   +  L     + VI Y  +      PR +T  +P   +       S+  PK++  +L+L K    D I+ L N+ P ++++ + YVLNF GRVT+ SVKNF L ++ +     V Q G+     + +D+ YPLC  QAFAIALS    KIA
Sbjct:  215 GDVIGNIDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKI------FLLGGRKRKKSKTSNYIVSCDPTDLSRNADGFCGKLRSNVFGTSFTVF---------------DNGNKESTESPRLD----LAVIIYDTNILGFKGPRNMTVILPGMTEDDQRVKISSADPKQQG-ILDLWKMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQL-VHDSDPEYIVMQFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIA 467          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0335246)

HSP 1 Score: 62.003 bits (149), Expect = 1.205e-9
Identity = 31/80 (38.75%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 1262 LENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKI 1498
            + N+ P ++E  ++Y L+FGGRVT+ S KNF     I  + K+V Q G+   + Y +DF YP    QAFA+AL+   +++
Sbjct: 1354 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNF----QIEFRGKQVMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1429          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0302589)

HSP 1 Score: 62.003 bits (149), Expect = 1.206e-9
Identity = 31/80 (38.75%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 1262 LENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKI 1498
            + N+ P ++E  ++Y L+FGGRVT+ S KNF     I  + K+V Q G+   + Y +DF YP    QAFA+AL+   +++
Sbjct: 1356 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNF----QIEFRGKQVMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1431          
BLAST of Tubby-like protein vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0302590)

HSP 1 Score: 62.003 bits (149), Expect = 1.206e-9
Identity = 31/80 (38.75%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 1262 LENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKI 1498
            + N+ P ++E  ++Y L+FGGRVT+ S KNF     I  + K+V Q G+   + Y +DF YP    QAFA+AL+   +++
Sbjct: 1356 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNF----QIEFRGKQVMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1431          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 115.161 bits (287), Expect = 1.144e-27
Identity = 82/279 (29.39%), Postives = 132/279 (47.31%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFN---QIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +               +   + + +  +L+  N   ++  I Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAIALS    K+A +
Sbjct:  103 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVY---------------DSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 358          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 115.161 bits (287), Expect = 1.582e-27
Identity = 82/279 (29.39%), Postives = 132/279 (47.31%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFN---QIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +               +   + + +  +L+  N   ++  I Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAIALS    K+A +
Sbjct:  128 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVY---------------DSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 383          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 115.546 bits (288), Expect = 2.672e-27
Identity = 82/279 (29.39%), Postives = 132/279 (47.31%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFN---QIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +               +   + + +  +L+  N   ++  I Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAIALS    K+A +
Sbjct:  177 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVY---------------DSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 432          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 115.546 bits (288), Expect = 4.092e-27
Identity = 82/279 (29.39%), Postives = 132/279 (47.31%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFN---QIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +               +   + + +  +L+  N   ++  I Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAIALS    K+A +
Sbjct:  222 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVY---------------DSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 477          
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 115.546 bits (288), Expect = 4.616e-27
Identity = 82/277 (29.60%), Postives = 131/277 (47.29%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFN---QIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            DL  F L P P+ V VKC++ +    +D+ +  T +L    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +               +   + + +  +L+  N   ++  I Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAIALS    K+A
Sbjct:  248 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYL---HLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVY---------------DSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLA 501          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tars1 (threonyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-GENE-975289])

HSP 1 Score: 108.227 bits (269), Expect = 1.868e-25
Identity = 87/300 (29.00%), Postives = 138/300 (46.00%), Query Frame = 2
Query:  620 EEELLFSEIIMNPNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            E ++L S +   P S   I     DL  F L P P N++ +C++ +    +DK +  T   + L L   D   +     LM G   +K K  +  +S DP+D   +  S IG +++N LGT+F  F   V+  +       E    E+ S            I Y+ +      PR +T  IP  N +  +      NE     +     + + II L+N+ P ++E+ + +VLNF GRVT+ SVKNF + ++       + Q G+     + +DF YPLC  QAF+I LS    K+A +
Sbjct:   29 ESDILSSVVYTRPVSTSTIE--IDDLEGFALRPAPNNMIFQCRITRDKKGVDKGIYPT---YYLHLERDDGKRL----FLMAGRKRKKCKTSNYLISVDPTDLSRDGDSFIGKVRSNMLGTKFTVFDNGVNPDTKPFVQERESLRQELVS------------ICYETNVLGFRGPRKMTVIIPSMNMEGERVSIRPRNEHETLLSRFQTGNMENIIALQNKAPSWNEETQSFVLNFHGRVTQASVKNFQI-ISPEDPEYIIMQFGRVAEDVFTMDFQYPLCALQAFSICLSSFDSKLACE 306          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tars1 (threonyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-GENE-975289])

HSP 1 Score: 108.227 bits (269), Expect = 1.968e-25
Identity = 85/292 (29.11%), Postives = 137/292 (46.92%), Query Frame = 2
Query:  644 IIMNPNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            I +  NS + I+DL+     F L P P N++ +C++ +    +DK +  T   + L L   D   +     LM G   +K K  +  +S DP+D   +  S IG +++N LGT+F  F   V+  +       E    E+ S            I Y+ +      PR +T  IP  N +  +      NE     +     + + II L+N+ P ++E+ + +VLNF GRVT+ SVKNF + ++       + Q G+     + +DF YPLC  QAF+I LS    K+A +
Sbjct:   45 ISIKTNSAIEIDDLEG----FALRPAPNNMIFQCRITRDKKGVDKGIYPT---YYLHLERDDGKRL----FLMAGRKRKKCKTSNYLISVDPTDLSRDGDSFIGKVRSNMLGTKFTVFDNGVNPDTKPFVQERESLRQELVS------------ICYETNVLGFRGPRKMTVIIPSMNMEGERVSIRPRNEHETLLSRFQTGNMENIIALQNKAPSWNEETQSFVLNFHGRVTQASVKNFQI-ISPEDPEYIIMQFGRVAEDVFTMDFQYPLCALQAFSICLSSFDSKLACE 312          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tars1 (threonyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-GENE-975289])

HSP 1 Score: 107.457 bits (267), Expect = 2.528e-25
Identity = 81/276 (29.35%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P N++ +C++ +    +DK +  T   + L L   D   +     LM G   +K K  +  +S DP+D   +  S IG +++N LGT+F  F   V+  +       E    E+ S            I Y+ +      PR +T  IP  N +  +      NE     +     + + II L+N+ P ++E+ + +VLNF GRVT+ SVKNF + ++       + Q G+     + +DF YPLC  QAF+I LS    K+A +
Sbjct:   38 DLEGFALRPAPNNMIFQCRITRDKKGVDKGIYPT---YYLHLERDDGKRL----FLMAGRKRKKCKTSNYLISVDPTDLSRDGDSFIGKVRSNMLGTKFTVFDNGVNPDTKPFVQERESLRQELVS------------ICYETNVLGFRGPRKMTVIIPSMNMEGERVSIRPRNEHETLLSRFQTGNMENIIALQNKAPSWNEETQSFVLNFHGRVTQASVKNFQI-ISPEDPEYIIMQFGRVAEDVFTMDFQYPLCALQAFSICLSSFDSKLACE 293          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tars1 (threonyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-GENE-975289])

HSP 1 Score: 107.071 bits (266), Expect = 6.806e-25
Identity = 81/276 (29.35%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P N++ +C++ +    +DK +  T   + L L   D   +     LM G   +K K  +  +S DP+D   +  S IG +++N LGT+F  F   V+  +       E    E+ S            I Y+ +      PR +T  IP  N +  +      NE     +     + + II L+N+ P ++E+ + +VLNF GRVT+ SVKNF + ++       + Q G+     + +DF YPLC  QAF+I LS    K+A +
Sbjct:   83 DLEGFALRPAPNNMIFQCRITRDKKGVDKGIYPT---YYLHLERDDGKRL----FLMAGRKRKKCKTSNYLISVDPTDLSRDGDSFIGKVRSNMLGTKFTVFDNGVNPDTKPFVQERESLRQELVS------------ICYETNVLGFRGPRKMTVIIPSMNMEGERVSIRPRNEHETLLSRFQTGNMENIIALQNKAPSWNEETQSFVLNFHGRVTQASVKNFQI-ISPEDPEYIIMQFGRVAEDVFTMDFQYPLCALQAFSICLSSFDSKLACE 338          
BLAST of Tubby-like protein vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 107.457 bits (267), Expect = 1.727e-24
Identity = 82/291 (28.18%), Postives = 140/291 (48.11%), Query Frame = 2
Query:  656 PNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGK-CKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            P+   +I ++  DL  F L P P+ VV+K ++ +    +D+ L  T ++     +E D+   N    L+ G   ++SK  +  +S DP+D      + IG +++N +GT+F  +    S +      S   +  E+              + Y+ +      PR +T  IP  +       F    P+  +E L     N  ++ II L N+ P +++D + YVLNF GRVT  SVKNF + ++ N     V Q G+  +  + +D++YPLC  QAF++ALS    K+A +
Sbjct:  157 PDPSGDIGEIG-DLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMH----LERDN---NRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEM------------AAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQ---PQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQI-VHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 423          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tulp2 (tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:1861600])

HSP 1 Score: 120.168 bits (300), Expect = 1.018e-28
Identity = 78/288 (27.08%), Postives = 140/288 (48.61%), Query Frame = 2
Query:  656 PNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPF-EVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDF--SNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            P  ++    L +D+  ++L P P++ +V+C++++  +     +F ++   L+  +  +V  +P    L+ G   ++SK  +  +S DP D   N S+ +G +++N LGT+F  F   V+   +     +    +E            +GV+ Y+ +      PR +T  +P  D  K        N+     + V       ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++ +     V Q G+   + + +DF YPLCP QAFAI LS    K+A +
Sbjct:  183 PQPRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGMFPSYYLYLEAEDGVAVRSSPLGHFLLAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGTKFTIFDNGVNPERSYWVPDSARIREE------------LGVVCYETNVLGFRGPRKMTVILPGMDSRKQRMKVQPQNDQDSILSRVQKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPDEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLACE 457          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tulp2 (tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:1861600])

HSP 1 Score: 120.168 bits (300), Expect = 1.119e-28
Identity = 78/286 (27.27%), Postives = 139/286 (48.60%), Query Frame = 2
Query:  656 PNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPF-EVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDF--SNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            P  ++    L +D+  ++L P P++ +V+C++++  +     +F ++   L+  +  +V  +P    L+ G   ++SK  +  +S DP D   N S+ +G +++N LGT+F  F   V+   +     +    +E            +GV+ Y+ +      PR +T  +P  D  K        N+     + V       ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++ +     V Q G+   + + +DF YPLCP QAFAI LS    K+A
Sbjct:  183 PQPRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGMFPSYYLYLEAEDGVAVRSSPLGHFLLAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGTKFTIFDNGVNPERSYWVPDSARIREE------------LGVVCYETNVLGFRGPRKMTVILPGMDSRKQRMKVQPQNDQDSILSRVQKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPDEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLA 455          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tulp2 (tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:1861600])

HSP 1 Score: 118.627 bits (296), Expect = 3.002e-28
Identity = 80/288 (27.78%), Postives = 141/288 (48.96%), Query Frame = 2
Query:  656 PNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKT-NNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDF--SNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            P  ++    L +D+  ++L P P++ +V+C++++  + +DK +  + +L+   L   D V+      L+ G   ++SK  +  +S DP D   N S+ +G +++N LGT+F  F   V+   +     +    +E            +GV+ Y+ +      PR +T  +P  D  K        N+     + V       ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++ +     V Q G+   + + +DF YPLCP QAFAI LS    K+A +
Sbjct:  171 PQPRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGMFPSYYLY---LEAEDGVA----HFLLAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGTKFTIFDNGVNPERSYWVPDSARIREE------------LGVVCYETNVLGFRGPRKMTVILPGMDSRKQRMKVQPQNDQDSILSRVQKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPDEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLACE 438          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tulp2 (tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:1861600])

HSP 1 Score: 118.242 bits (295), Expect = 3.733e-28
Identity = 80/288 (27.78%), Postives = 141/288 (48.96%), Query Frame = 2
Query:  656 PNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKT-NNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDF--SNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            P  ++    L +D+  ++L P P++ +V+C++++  + +DK +  + +L+   L   D V+      L+ G   ++SK  +  +S DP D   N S+ +G +++N LGT+F  F   V+   +     +    +E            +GV+ Y+ +      PR +T  +P  D  K        N+     + V       ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++ +     V Q G+   + + +DF YPLCP QAFAI LS    K+A +
Sbjct:  183 PQPRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGMFPSYYLY---LEAEDGVA----HFLLAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGTKFTIFDNGVNPERSYWVPDSARIREE------------LGVVCYETNVLGFRGPRKMTVILPGMDSRKQRMKVQPQNDQDSILSRVQKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPDEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLACE 450          
BLAST of Tubby-like protein vs. Ensembl Mouse
Match: Tulp2 (tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:1861600])

HSP 1 Score: 118.242 bits (295), Expect = 3.860e-28
Identity = 80/286 (27.97%), Postives = 140/286 (48.95%), Query Frame = 2
Query:  656 PNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKT-NNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDF--SNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            P  ++    L +D+  ++L P P++ +V+C++++  + +DK +  + +L+   L   D V+      L+ G   ++SK  +  +S DP D   N S+ +G +++N LGT+F  F   V+   +     +    +E            +GV+ Y+ +      PR +T  +P  D  K        N+     + V       ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++ +     V Q G+   + + +DF YPLCP QAFAI LS    K+A
Sbjct:  183 PQPRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGMFPSYYLY---LEAEDGVA----HFLLAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGTKFTIFDNGVNPERSYWVPDSARIREE------------LGVVCYETNVLGFRGPRKMTVILPGMDSRKQRMKVQPQNDQDSILSRVQKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPDEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLA 448          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|P46686|TULP2_MOUSE (Tubby-related protein 2 OS=Mus musculus OX=10090 GN=Tulp2 PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 5.984e-27
Identity = 79/286 (27.62%), Postives = 141/286 (49.30%), Query Frame = 2
Query:  656 PNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKT-NNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKER--TEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            P  ++    L +D+  ++L P P++ +V+C++++  + +DK +  + +L+   L   D V+      L+ G   ++SK  +  +S DP D   N S+ +G +++N LGT+F  F   V+   +     +    +E            +GV+ Y+ +      PR +T  +P  D  K       +  ++   + V       ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++ +     V Q G+   + + +DF YPLCP QAFAI LS    K+A
Sbjct:  295 PQPRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGMFPSYYLY---LEAEDGVA----HFLLAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGTKFTIFDNGVNPERSYWVPDSARIREE------------LGVVCYETNVLGFRGPRKMTVILPGMDSRKQRMKVQPQNDQDSILSRVQKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPDEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLA 560          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|P50607|TUB_HUMAN (Tubby protein homolog OS=Homo sapiens OX=9606 GN=TUB PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 9.510e-26
Identity = 82/281 (29.18%), Postives = 136/281 (48.40%), Query Frame = 2
Query:  689 KDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF---NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            +DL  F L P P+ + +KC++ +    +D+ +  T FL    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   V              N +  S+  L+      ++  + Y+ +      PR ++  +P  +     ++  +  P+   E L     N + + II L+N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YPLC  QAFAIALS    K+A
Sbjct:  249 QDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLH---LDREDGKKV----FLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGV--------------NPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMN---MVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLA 504          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|B4KNA9|TULP_DROMO (Protein king tubby OS=Drosophila mojavensis OX=7230 GN=king-tubby PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.147e-25
Identity = 83/280 (29.64%), Postives = 131/280 (46.79%), Query Frame = 2
Query:  677 NDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDK----DEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
             D+  ++ +F++ P P+ V+ KC++ +        LF  +   L+      +       L+ G   +KSK  +  VS DP+D   N+    G +++N  GT F  F               +  N E   N  L     + VI Y  +      PR +T  +P   +       S+  PK++  +L+L K    D I+ L N+ P ++++ + YVLNF GRVT+ SVKNF L ++ +     V Q G+     + +D+ YPLC  QAFAIALS    KIA
Sbjct:  199 GDVIGNIDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKI------FLLGGRKRKKSKTSNYIVSCDPTDLSRNADGFCGKLRSNVFGTSFTVF---------------DSGNKESTENPRLD----LAVIIYDTNILGFKGPRNMTVILPGMTEDDQRVKISSADPKQQG-ILDLWKMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQL-VHDSDPEYIVMQFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIA 451          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|P50586|TUB_MOUSE (Tubby protein OS=Mus musculus OX=10090 GN=Tub PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.833e-25
Identity = 82/283 (28.98%), Postives = 136/283 (48.06%), Query Frame = 2
Query:  689 KDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF---NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            +DL  F L P P+ + +KC++ +    +D+ +  T FL    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   V              N +  S+  L+      ++  + Y+ +      PR ++  +P  +     ++     P+   E L     N + + II L+N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YPLC  QAFAIALS    K+A +
Sbjct:  248 QDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFL---HLDREDGKKV----FLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGV--------------NPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMN---MVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 505          
BLAST of Tubby-like protein vs. UniProt/SwissProt
Match: sp|O88808|TUB_RAT (Tubby protein homolog OS=Rattus norvegicus OX=10116 GN=Tub PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.601e-25
Identity = 82/283 (28.98%), Postives = 136/283 (48.06%), Query Frame = 2
Query:  689 KDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF---NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            +DL  F L P P+ + +KC++ +    +D+ +  T FL    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   V              N +  S+  L+      ++  + Y+ +      PR ++  +P  +     ++     P+   E L     N + + II L+N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YPLC  QAFAIALS    K+A +
Sbjct:  248 QDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFL---HLDREDGKKV----FLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGV--------------NPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMN---MVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 505          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A3Q0DAM8 (Tubby-like protein OS=Mesocricetus auratus OX=10036 GN=Tulp2 PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.785e-28
Identity = 82/280 (29.29%), Postives = 147/280 (52.50%), Query Frame = 2
Query:  683 LKKDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPF-EVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDF--SNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            L +D+  ++L P P++ +V+C++++    +DK +  T +L+ L+  ++ +VS +P    L+ G   ++SK  +  +S DP D   N ++ +G +++N LGT+F  F   V+             N  I  N  +++  ++GV+ Y+ +      PR +T  +P  D GK        N+     + +    ++ ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++       V Q G+   + + +DF YPLCP QAFAI LS    K+A +
Sbjct:  182 LGEDMEAYVLLPAPRDHMVQCRIIRDKRGMDKGMFPTYYLY-LEAEDSVAVSSSPLVHFLLAGRKRKRSKTSNYLISLDPKDMSRNGNNFVGKVRSNILGTKFTIFDNGVNPE----------RNYWIPDNARIRE--ELGVVCYETNVLGFRGPRKMTVVLPGIDSGKQRIRVQPQNDQDSILSRLQKGARNGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPEEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLACE 447          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A3B3ZLS4 (Si:dkey-220f10.4 OS=Periophthalmus magnuspinnatus OX=409849 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 8.849e-28
Identity = 88/295 (29.83%), Postives = 140/295 (47.46%), Query Frame = 2
Query:  629 LLFSEIIMNPNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNW-DDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            +L    I    S +++ DL+K    F L P PK V ++C+V +     +  +F  +   L+  +   V       LM G   +K K  +  +STDP++   N++S IG +++N LGT+F  +    +         +E    E+              I Y+ +      PR +T  IP   DD +      NEL    T   N + D++I L N+ P ++E    YVLNF GRVT+ SVKNF + ++ + +   V Q G+     + +D++YPLC  QAFAI LS    K+A +
Sbjct:   44 ILIKTFIFQTTSPMSVEDLEK----FALRPAPKEVTIQCRVTRDRRGMEKGMFPTYYLHLEKDDGKRV------FLMAGRKRKKCKTANYLISTDPTNLSRNTNSYIGKLRSNVLGTKFTVYDGGENPEKKPFIKESESVRQEL------------AAICYETNVLGFKGPRKMTVIIPGMIDDERVSIAPKNELETLLTRHANHNTDQLITLINKCPSWNEQTHSYVLNFHGRVTQASVKNFQI-IHPDNEDYIVMQFGRVAEDVFSMDYSYPLCALQAFAITLSAFDSKLACE 315          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A3B3ZMI0 (Si:dkey-220f10.4 OS=Periophthalmus magnuspinnatus OX=409849 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.240e-27
Identity = 88/295 (29.83%), Postives = 140/295 (47.46%), Query Frame = 2
Query:  629 LLFSEIIMNPNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNW-DDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            +L    I    S +++ DL+K    F L P PK V ++C+V +     +  +F  +   L+  +   V       LM G   +K K  +  +STDP++   N++S IG +++N LGT+F  +    +         +E    E+              I Y+ +      PR +T  IP   DD +      NEL    T   N + D++I L N+ P ++E    YVLNF GRVT+ SVKNF + ++ + +   V Q G+     + +D++YPLC  QAFAI LS    K+A +
Sbjct:   85 ILIKTFIFQTTSPMSVEDLEK----FALRPAPKEVTIQCRVTRDRRGMEKGMFPTYYLHLEKDDGKRV------FLMAGRKRKKCKTANYLISTDPTNLSRNTNSYIGKLRSNVLGTKFTVYDGGENPEKKPFIKESESVRQEL------------AAICYETNVLGFKGPRKMTVIIPGMIDDERVSIAPKNELETLLTRHANHNTDQLITLINKCPSWNEQTHSYVLNFHGRVTQASVKNFQI-IHPDNEDYIVMQFGRVAEDVFSMDYSYPLCALQAFAITLSAFDSKLACE 356          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A1U8CW21 (Tubby-like protein OS=Mesocricetus auratus OX=10036 GN=Tulp2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.692e-27
Identity = 82/279 (29.39%), Postives = 143/279 (51.25%), Query Frame = 2
Query:  683 LKKDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDF--SNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            L +D+  ++L P P++ +V+C++++    +DK +  T +L+   L   DSV+      L+ G   ++SK  +  +S DP D   N ++ +G +++N LGT+F  F   V+             N  I  N  +++  ++GV+ Y+ +      PR +T  +P  D GK        N+     + +    ++ ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++       V Q G+   + + +DF YPLCP QAFAI LS    K+A +
Sbjct:  170 LGEDMEAYVLLPAPRDHMVQCRIIRDKRGMDKGMFPTYYLY---LEAEDSVA----HFLLAGRKRKRSKTSNYLISLDPKDMSRNGNNFVGKVRSNILGTKFTIFDNGVNPE----------RNYWIPDNARIRE--ELGVVCYETNVLGFRGPRKMTVVLPGIDSGKQRIRVQPQNDQDSILSRLQKGARNGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPEEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLACE 428          
BLAST of Tubby-like protein vs. TrEMBL
Match: A0A1U7R338 (Tubby-like protein OS=Mesocricetus auratus OX=10036 GN=Tulp2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.380e-26
Identity = 82/279 (29.39%), Postives = 143/279 (51.25%), Query Frame = 2
Query:  683 LKKDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDF--SNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            L +D+  ++L P P++ +V+C++++    +DK +  T +L+   L   DSV+      L+ G   ++SK  +  +S DP D   N ++ +G +++N LGT+F  F   V+             N  I  N  +++  ++GV+ Y+ +      PR +T  +P  D GK        N+     + +    ++ ++ L+N+ P + ++   YVLNF GRVT  SVKNF + ++       V Q G+   + + +DF YPLCP QAFAI LS    K+A +
Sbjct:  294 LGEDMEAYVLLPAPRDHMVQCRIIRDKRGMDKGMFPTYYLY---LEAEDSVA----HFLLAGRKRKRSKTSNYLISLDPKDMSRNGNNFVGKVRSNILGTKFTIFDNGVNPE----------RNYWIPDNARIRE--ELGVVCYETNVLGFRGPRKMTVVLPGIDSGKQRIRVQPQNDQDSILSRLQKGARNGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQI-VHPEEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLACE 552          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 114.775 bits (286), Expect = 5.157e-27
Identity = 82/276 (29.71%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   +            +         NL+   ++  + Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +DF YP+C  QAFAIALS    K+A +
Sbjct:  200 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGM----------NPVKTTSTLEASNLR--QELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 455          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 114.775 bits (286), Expect = 7.779e-27
Identity = 82/276 (29.71%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+ V VKC++ +    +D+ +  T +L    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   +            +         NL+   ++  + Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +DF YP+C  QAFAIALS    K+A +
Sbjct:  245 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYL---HLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGM----------NPVKTTSTLEASNLR--QELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 500          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 114.39 bits (285), Expect = 8.099e-27
Identity = 82/276 (29.71%), Postives = 129/276 (46.74%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   +            +         NL+   ++  + Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +DF YP+C  QAFAIALS    K+A +
Sbjct:  219 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGM----------NPVKTTSTLEASNLR--QELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 474          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 114.775 bits (286), Expect = 8.551e-27
Identity = 82/274 (29.93%), Postives = 128/274 (46.72%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            DL  F L P P+ V VKC++ +    +D+ +  T +L    L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   +            +         NL+   ++  + Y+ +      PR ++  IP  N D  +      NE         N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +DF YP+C  QAFAIALS    K+A
Sbjct:  251 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYL---HLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGM----------NPVKTTSTLEASNLR--QELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLA 504          
BLAST of Tubby-like protein vs. Ensembl Cavefish
Match: tulp1a (TUB like protein 1a [Source:ZFIN;Acc:ZDB-GENE-110411-122])

HSP 1 Score: 108.612 bits (270), Expect = 1.439e-25
Identity = 83/298 (27.85%), Postives = 140/298 (46.98%), Query Frame = 2
Query:  656 PNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFN----QIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELP-KERTE-------VLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            P+ +V  +DL++    F+L P P+ + VKC+V +    +D+    T FL    L     V       L+ G   +KS   +  +S D +D      + IG +++N +GT+F  F                  ++ +N ++ L+D +    ++  I Y+ +      PR +T  IP  D+       S  +P + ++E         N   D +I L N+ P +++D   YVLNF GRVT+ S+KNF + ++       + Q G+     + +D+ YPLC  QAFAIALS    K+A +
Sbjct:   84 PSPEVEFDDLEE----FVLRPAPEGMTVKCKVTRDKRGMDRGFYPTYFL---HLDNEKKV------FLLAGRKRKKSATSNYLISIDATDLSRGGDNFIGKLRSNLMGTKFTVF------------------DNGLNPDRALRDLSNARQELAAIIYETNVLGFKGPRKMTVIIPGMDED------SERVPIRAQSENDGLLMRYQNRQMDNLIELHNKTPVWNDDTASYVLNFSGRVTQASIKNFQI-VHSKDSDYILMQFGRVSDDIFTLDYKYPLCAVQAFAIALSSFDGKLACE 343          
BLAST of Tubby-like protein vs. Ensembl Sea Lamprey
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 99.7525 bits (247), Expect = 3.288e-24
Identity = 78/275 (28.36%), Postives = 121/275 (44.00%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFAL-NMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+   VKC++ +    +D+ +  T FL    +   D   V     L+ G   +KSK  +  +STDP++      S IG +++N +GTRF  +   +          T I  D  N  Q L        + Y++   VS            W                     N + +  + L N+ P +++D + YVLNF GRVT+ SVKNF + + N       + Q G+     + +D++YPLC  QAF+IALS    K+A +
Sbjct:    3 DLEAFALRPAPQGGPVKCRITRDKKGMDRGMFPTYFL---HMDRDDGKKV----FLLAGRKRKKSKTSNYLLSTDPTNLSREGESYIGKLRSNVMGTRFTVYDNGIKPDR------TGILGDGSNLRQEL------AAVCYEHETLVS-----------RWH--------------------NKNTEHTVELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHYNDRAAEYIIMQFGRVAEDIFTMDYSYPLCALQAFSIALSSFDGKLACE 227          
BLAST of Tubby-like protein vs. Ensembl Nematostella
Match: EDO38412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD12])

HSP 1 Score: 95.9005 bits (237), Expect = 2.214e-22
Identity = 72/268 (26.87%), Postives = 124/268 (46.27%), Query Frame = 2
Query:  716 PPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERT--EVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            P P+ + VKC++ +    +D+ +  T FL    +   D   V     L+ G   +KS   +  +STD +D      S +G ++ N +GT+F  F   V+                ++   N+++  ++G I Y  +      PR +T  +P     +        L  E       N   + ++ L N+ P +++D + YVLNF GRVT+ SVKNF + ++ +     + Q G+     + +D+ YP+C  QAFAIALS    K+A +
Sbjct:    2 PAPQGIPVKCRITRDKKGMDRGMYPTYFL---HMERDDGKKV----FLLAGRKRKKSTTSNYLISTDATDLSRGGESFVGKLRANLVGTKFSIFDNGVNPR----------KGGVMSDGSNIRE--ELGGIIYDTNVLGFKGPRKMTVVLPGMGLDQQRVPVRPRLESETILERHRNRQLENLVELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-VHDSDVDYIIMQFGRVAEDVFTMDYNYPMCAVQAFAIALSSFDGKLACE 249          
BLAST of Tubby-like protein vs. Ensembl Nematostella
Match: EDO28462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD12])

HSP 1 Score: 95.9005 bits (237), Expect = 2.214e-22
Identity = 72/268 (26.87%), Postives = 124/268 (46.27%), Query Frame = 2
Query:  716 PPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERT--EVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            P P+ + VKC++ +    +D+ +  T FL    +   D   V     L+ G   +KS   +  +STD +D      S +G ++ N +GT+F  F   V+                ++   N+++  ++G I Y  +      PR +T  +P     +        L  E       N   + ++ L N+ P +++D + YVLNF GRVT+ SVKNF + ++ +     + Q G+     + +D+ YP+C  QAFAIALS    K+A +
Sbjct:    2 PAPQGIPVKCRITRDKKGMDRGMYPTYFL---HMERDDGKKV----FLLAGRKRKKSTTSNYLISTDATDLSRGGESFVGKLRANLVGTKFSIFDNGVNPR----------KGGVMSDGSNIRE--ELGGIIYDTNVLGFKGPRKMTVVLPGMGLDQQRVPVRPRLESETILERHRNRQLENLVELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-VHDSDVDYIIMQFGRVAEDVFTMDYNYPMCAVQAFAIALSSFDGKLACE 249          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 112.079 bits (279), Expect = 6.168e-26
Identity = 82/277 (29.60%), Postives = 132/277 (47.65%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFN---QIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   +               + + S  +L+  N   ++  I Y+ +      PR ++  IP  N D  +      N+         N + + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAIALS    K+A
Sbjct:  241 DLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGL---------------NPMKSTTSLEASNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLA 494          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 112.079 bits (279), Expect = 6.582e-26
Identity = 82/277 (29.60%), Postives = 132/277 (47.65%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFN---QIGVIFYKNSKFVSSKPRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   +               + + S  +L+  N   ++  I Y+ +      PR ++  IP  N D  +      N+         N + + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAIALS    K+A
Sbjct:  247 DLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGL---------------NPMKSTTSLEASNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLA 500          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: zmp:0000000711 (TUB like protein 3 [Source:NCBI gene;Acc:101160279])

HSP 1 Score: 104.76 bits (260), Expect = 1.354e-23
Identity = 78/282 (27.66%), Postives = 132/282 (46.81%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF---NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            +L  F+L+P P+ V +KC++ +    +D+ L  T F+    + + D   V     L+ G   +KSK  +  +S D +D      S IG +++N +GT+F  +                 SN        ++D     ++  + Y+ +      PR +T  IP  +     ++     P+   E L     N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAI LS    K+A +
Sbjct:  230 NLEEFVLSPAPRGVTIKCRISRDKKGMDRGLYPTYFM---HMEKEDGKKV----FLLAGRKRKKSKTSNYLISVDATDLSREGDSFIGKLRSNLMGTKFTVYDSG--------------SNPGKTVGALMEDSPARQEMAAVCYETNVLGFKGPRKMTVIIPGMNMN---FERLPVRPQNEQESLLSRWQNHSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQI-VHDNDPDYIVMQFGRVAEDIFTLDYNYPMCALQAFAIGLSSFDSKLACE 486          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: zmp:0000000711 (TUB like protein 3 [Source:NCBI gene;Acc:101160279])

HSP 1 Score: 104.76 bits (260), Expect = 1.750e-23
Identity = 78/282 (27.66%), Postives = 132/282 (46.81%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDF---NQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVL-----NLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            +L  F+L+P P+ V +KC++ +    +D+ L  T F+    + + D   V     L+ G   +KSK  +  +S D +D      S IG +++N +GT+F  +                 SN        ++D     ++  + Y+ +      PR +T  IP  +     ++     P+   E L     N   + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAI LS    K+A +
Sbjct:  260 NLEEFVLSPAPRGVTIKCRISRDKKGMDRGLYPTYFM---HMEKEDGKKV----FLLAGRKRKKSKTSNYLISVDATDLSREGDSFIGKLRSNLMGTKFTVYDSG--------------SNPGKTVGALMEDSPARQEMAAVCYETNVLGFKGPRKMTVIIPGMNMN---FERLPVRPQNEQESLLSRWQNHSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQI-VHDNDPDYIVMQFGRVAEDIFTLDYNYPMCALQAFAIGLSSFDSKLACE 516          
BLAST of Tubby-like protein vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 103.99 bits (258), Expect = 3.693e-23
Identity = 83/291 (28.52%), Postives = 136/291 (46.74%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEI---------NSNQNLKDF-----NQIGVIFYKNSKFVSSK-PRTITAAIP--NWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            DL  F L P P+ V VKC++ +    +D+ +  T   + L L   D   V     L+ G   +KSK  +  +S DP+D      S IG +++N +GT+F  +   ++   +           E+          + + LK +     N +   F + +  +  K PR ++  IP  N D  +      N+         N + + +I L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+     + +D+ YP+C  QAFAIALS    K+A +
Sbjct:  241 DLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPT---YYLHLEREDGKKV----FLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGLNPMKSTTSLEASNLRQELAAICYVSKRTAMKQLKLYCIVTDNVLLCHFIQETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-IHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 523          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000011278.1 (SMESG000011278.1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.222e-139
Identity = 253/257 (98.44%), Postives = 256/257 (99.61%), Query Frame = 2
Query:  341 NNEASTLRPLEILETKEISSNNNKVLSDQDSLSNESIEELDIRSSNKPGKTAYYKISFETXXXXXXXXXXXXXXXXXXXXXXXIQKSKLIITFEEELLFSEIIMNPNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFY 1111
            NNEASTLRPLEILETKEISSNNNKVLSDQDSLSNESIE+LDIRSSNKPGKTAYYKISFETNEENDSNLLKENNENSKEKATKEIQKSKLIITFEEELLFSEIIMNPNSQVNIN+ KKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRS+FVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFSKNVSASSNNNGNSTEISNDEINSNQNLKDFNQIGVIFY
Sbjct:   10 NNEASTLRPLEILETKEISSNNNKVLSDQDSLSNESIEDLDIRSSNKPGKTAYYKISFETNEENDSNLLKENNENSKEKATKEIQKSKLIITFEEELLFSEIIMNPNSQVNINNFKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSLFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFSKNVSASSNNNGNSTEISNDEINSNQNLKDFNQIGVIFY 266          

HSP 2 Score: 286.96 bits (733), Expect = 3.249e-90
Identity = 133/135 (98.52%), Postives = 133/135 (98.52%), Query Frame = 2
Query: 1103 IFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            I  KNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD
Sbjct:  378 IINKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD 512          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000043973.1 (SMESG000043973.1)

HSP 1 Score: 330.487 bits (846), Expect = 6.416e-104
Identity = 220/257 (85.60%), Postives = 223/257 (86.77%), Query Frame = 2
Query:  341 NNEASTLRPLEILETKEISSNNNKVLSDQDSLSNESIEELDIRSSNKPGKTAYYKISFETXXXXXXXXXXXXXXXXXXXXXXXIQKSKLIITFEEELLFSEIIMNPNSQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFY 1111
            +NEASTLRPLEILETKEISSNNNKVLSDQDSLSNESIEELDIRSSNKPGKT+YYKISFETNEENDSNLLKENNENSKEKATKEIQKSKLIITFEEELLFSEIIMNPNSQ                                  DKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRS+FVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFSKNVSASSNNNGNSTEISNDEINSNQNLKDFNQIGVIFY
Sbjct:  314 DNEASTLRPLEILETKEISSNNNKVLSDQDSLSNESIEELDIRSSNKPGKTSYYKISFETNEENDSNLLKENNENSKEKATKEIQKSKLIITFEEELLFSEIIMNPNSQ----------------------------------DKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSVFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFSKNVSASSNNNGNSTEISNDEINSNQNLKDFNQIGVIFY 536          

HSP 2 Score: 280.796 bits (717), Expect = 4.015e-85
Identity = 131/135 (97.04%), Postives = 132/135 (97.78%), Query Frame = 2
Query: 1103 IFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            I  KNSKFVSSKPRTITAAIPNWD+ KGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD
Sbjct:  648 IINKNSKFVSSKPRTITAAIPNWDESKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD 782          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000043973.1 (SMESG000043973.1)

HSP 1 Score: 281.567 bits (719), Expect = 1.448e-91
Identity = 131/135 (97.04%), Postives = 132/135 (97.78%), Query Frame = 2
Query: 1103 IFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD 1507
            I  KNSKFVSSKPRTITAAIPNWD+ KGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD
Sbjct:  118 IINKNSKFVSSKPRTITAAIPNWDESKGYYDFSNELPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTHYIVDFTYPLCPFQAFAIALSCCQRKIASD 252          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000009644.1 (SMESG000009644.1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.414e-21
Identity = 78/278 (28.06%), Postives = 127/278 (45.68%), Query Frame = 2
Query:  692 DLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFFXXXXXXXXXXXXXXTEISNDEINSNQNLKDFNQIGVIFYKNSKFVSSKPRTITAAIPNWDDGKGYYDFSNE------LPKERTEVLNLDKDEIICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKCKTH-YIVDFTYPLCPFQAFAIALSCCQRKIA 1501
            ++  F+  P P++ VVKC++ +    +DK +  T +L        +  +  P   L+     +  K  +  +S D +D   N    +  ++ NF+GT+F  +         N            +SN+ L+   ++  I ++ +      PR +T  IP     K   DF  +      L   RT  L    D ++ L N+ P ++ED + YVLNF GRVT+ SVKNF + ++ N     + Q G+   H + +DF YPL   QAF IALS    K+A
Sbjct:  246 EIESFVSKPAPQDCVVKCRITRDKRGMDKGMYPTYYL------HLERKNAKPL-FLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEPVN------------SSNKPLR--AELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKL----DNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQI-VHDNDAEYIIMQFGRTSDHSFSMDFAYPLSAVQAFGIALSSFDGKLA 497          
BLAST of Tubby-like protein vs. Planmine SMEST
Match: SMESG000073925.1 (SMESG000073925.1)

HSP 1 Score: 51.6026 bits (122), Expect = 8.897e-7
Identity = 32/110 (29.09%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  668 VNINDLKKDLHRFLLTPPPKNVVVKCQVMK-TNNIDKTLLFTNFLFSLQLVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIKTNFLGTRFMFF 994
            V+  D + DL  F+L P  +NV +KC++ +    +DK +  T   + L L   D   +     L+     +KS   +  +S D +D   +  S IG +++NFLGT F+ +
Sbjct:  177 VSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPT---YYLHLDRDDGKRL----FLLAARRRKKSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVY 279          
The following BLAST results are available for this feature:
BLAST of Tubby-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUB1.693e-2629.18TUB bipartite transcription factor [Source:HGNC Sy... [more]
TUB1.980e-2629.18TUB bipartite transcription factor [Source:HGNC Sy... [more]
TUB3.617e-2628.98TUB bipartite transcription factor [Source:HGNC Sy... [more]
TULP37.963e-2226.09TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12... [more]
TULP31.198e-2026.22TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tub-19.191e-1724.58Tubby protein homolog 1 [Source:UniProtKB/Swiss-P... [more]
tub-21.707e-740.00TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53... [more]
tub-27.430e-739.39TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ktub9.908e-2629.29gene:FBgn0015721 transcript:FBtr0089600[more]
ktub1.273e-2529.29gene:FBgn0015721 transcript:FBtr0342842[more]
Tusp1.205e-938.75gene:FBgn0039530 transcript:FBtr0335246[more]
Tusp1.206e-938.75gene:FBgn0039530 transcript:FBtr0302589[more]
Tusp1.206e-938.75gene:FBgn0039530 transcript:FBtr0302590[more]
back to top
BLAST of Tubby-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub1.144e-2729.39TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub1.582e-2729.39TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub2.672e-2729.39TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub4.092e-2729.39TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub4.616e-2729.60TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tars11.868e-2529.00threonyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-... [more]
tars11.968e-2529.11threonyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-... [more]
tars12.528e-2529.35threonyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-... [more]
tars16.806e-2529.35threonyl-tRNA synthetase 1 [Source:Xenbase;Acc:XB-... [more]
tulp31.727e-2428.18TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tulp21.018e-2827.08tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:18... [more]
Tulp21.119e-2827.27tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:18... [more]
Tulp23.002e-2827.78tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:18... [more]
Tulp23.733e-2827.78tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:18... [more]
Tulp23.860e-2827.97tubby-like protein 2 [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of Tubby-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46686|TULP2_MOUSE5.984e-2727.62Tubby-related protein 2 OS=Mus musculus OX=10090 G... [more]
sp|P50607|TUB_HUMAN9.510e-2629.18Tubby protein homolog OS=Homo sapiens OX=9606 GN=T... [more]
sp|B4KNA9|TULP_DROMO1.147e-2529.64Protein king tubby OS=Drosophila mojavensis OX=723... [more]
sp|P50586|TUB_MOUSE2.833e-2528.98Tubby protein OS=Mus musculus OX=10090 GN=Tub PE=1... [more]
sp|O88808|TUB_RAT3.601e-2528.98Tubby protein homolog OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of Tubby-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0DAM84.785e-2829.29Tubby-like protein OS=Mesocricetus auratus OX=1003... [more]
A0A3B3ZLS48.849e-2829.83Si:dkey-220f10.4 OS=Periophthalmus magnuspinnatus ... [more]
A0A3B3ZMI01.240e-2729.83Si:dkey-220f10.4 OS=Periophthalmus magnuspinnatus ... [more]
A0A1U8CW213.692e-2729.39Tubby-like protein OS=Mesocricetus auratus OX=1003... [more]
A0A1U7R3381.380e-2629.39Tubby-like protein OS=Mesocricetus auratus OX=1003... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub5.157e-2729.71TUB bipartite transcription factor [Source:NCBI ge... [more]
tub7.779e-2729.71TUB bipartite transcription factor [Source:NCBI ge... [more]
tub8.099e-2729.71TUB bipartite transcription factor [Source:NCBI ge... [more]
tub8.551e-2729.93TUB bipartite transcription factor [Source:NCBI ge... [more]
tulp1a1.439e-2527.85TUB like protein 1a [Source:ZFIN;Acc:ZDB-GENE-1104... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tub3.288e-2428.36TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubby-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO384122.214e-2226.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284622.214e-2226.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubby-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub6.168e-2629.60TUB bipartite transcription factor [Source:NCBI ge... [more]
tub6.582e-2629.60TUB bipartite transcription factor [Source:NCBI ge... [more]
zmp:00000007111.354e-2327.66TUB like protein 3 [Source:NCBI gene;Acc:101160279... [more]
zmp:00000007111.750e-2327.66TUB like protein 3 [Source:NCBI gene;Acc:101160279... [more]
tub3.693e-2328.52TUB bipartite transcription factor [Source:NCBI ge... [more]
back to top
BLAST of Tubby-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011278.11.222e-13998.44SMESG000011278.1[more]
SMESG000043973.16.416e-10485.60SMESG000043973.1[more]
SMESG000043973.11.448e-9197.04SMESG000043973.1[more]
SMESG000009644.11.414e-2128.06SMESG000009644.1[more]
SMESG000073925.18.897e-729.09SMESG000073925.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015354 ID=SMED30015354|Name=Tubby-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1672bp
AGAACGTTGATAATTTAAATATTTTATGACAAACATTTGTATTTTGATAC
ATAAGTTATATTACTTTTTCTAATAAAACAGAAACTTTATCCATTATTAA
ATTGGATTTATTAGTTCAAAACTACTTCTTTTTTTTGTGTTTAAATAATT
TTGATATAAAATATTATTGCTAGTTTACATTTAACTATTATTTCCGATCA
AATAATACATTATGGATGATTCAGGCGAGAGAAACGTGATGATGTCTAAA
TATGACGAATTAGAAAATGATAATCTCGGTTTTAATCAAACATTTCAAAA
ACCGATTGTCACTCAACTGATTGTTGTTCAACCAAAAATAAATAATGAAG
CCTCAACGTTAAGACCTCTGGAAATCTTGGAAACTAAGGAGATTTCTTCC
AATAACAATAAAGTTCTTTCTGATCAGGATTCTTTATCGAATGAAAGCAT
TGAAGAGCTGGATATTCGTTCTTCAAATAAACCTGGAAAGACAGCTTATT
ATAAAATTAGTTTTGAGACAAATGAAGAAAATGATTCAAATTTATTGAAA
GAAAATAACGAAAATTCTAAAGAAAAAGCAACCAAAGAAATTCAGAAATC
CAAATTAATAATTACTTTCGAAGAAGAATTATTATTTTCAGAAATAATCA
TGAATCCAAATAGTCAAGTGAATATAAATGATTTAAAAAAAGATTTACAC
AGGTTTTTATTGACTCCTCCACCAAAAAATGTCGTTGTTAAATGCCAAGT
TATGAAAACTAATAATATTGATAAAACATTGTTATTTACAAATTTTTTAT
TCTCATTGCAATTAGTCGAAACAGATTCTGTATCTGTAAATCCCTTTGAA
GTCTTAATGATCGGGTATCCAAACAGAAAGTCAAAAAAACGTTCTATTTT
CGTTTCTACTGATCCATCTGATACACATTCAAATTCATCTTCCGTTATCG
GTCATATAAAAACAAATTTTCTCGGTACTCGATTTATGTTTTTTTCGAAA
AATGTTTCTGCGTCATCAAACAACAATGGAAATTCGACTGAAATTTCCAA
TGATGAAATAAATTCTAACCAAAATTTGAAAGATTTTAATCAAATTGGCG
TTATTTTTTATAAAAATAGCAAATTTGTTTCCAGCAAGCCTCGTACAATA
ACCGCTGCAATTCCGAATTGGGATGATGGTAAAGGTTATTATGATTTCAG
CAACGAATTACCAAAAGAAAGAACAGAAGTCCTGAATTTAGATAAAGACG
AAATAATTTGTTTGGAAAATGAACTTCCTAAATACGATGAAGACAAGAAA
CTTTATGTTTTGAATTTCGGAGGACGTGTCACAGAAAGATCAGTGAAAAA
CTTTGCACTAAACATGAATATAAACGGCAAATCCAAGCGAGTTTATCAGC
TAGGGAAGTGCAAAACTCACTATATCGTTGATTTTACATATCCTTTATGT
CCATTCCAAGCTTTTGCCATCGCCCTCAGTTGTTGCCAAAGGAAAATTGC
ATCGGATTGATATGAACTTGTTTCTCTTCTGTACTAGAAGACGTCAAAAA
CCTCTTGTCATTTTAAAAATACGGATTCACCATTTTGTGCACTTTTAGAT
ATTGAAATTATTTTTATTTAAAATTTAAACTCAACAAACCAATGGCCTCC
CTAAATTATCAGCTGTGTTAGT
back to top

protein sequence of SMED30015354-orf-1

>SMED30015354-orf-1 ID=SMED30015354-orf-1|Name=SMED30015354-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=433bp
MDDSGERNVMMSKYDELENDNLGFNQTFQKPIVTQLIVVQPKINNEASTL
RPLEILETKEISSNNNKVLSDQDSLSNESIEELDIRSSNKPGKTAYYKIS
FETNEENDSNLLKENNENSKEKATKEIQKSKLIITFEEELLFSEIIMNPN
SQVNINDLKKDLHRFLLTPPPKNVVVKCQVMKTNNIDKTLLFTNFLFSLQ
LVETDSVSVNPFEVLMIGYPNRKSKKRSIFVSTDPSDTHSNSSSVIGHIK
TNFLGTRFMFFSKNVSASSNNNGNSTEISNDEINSNQNLKDFNQIGVIFY
KNSKFVSSKPRTITAAIPNWDDGKGYYDFSNELPKERTEVLNLDKDEIIC
LENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKC
KTHYIVDFTYPLCPFQAFAIALSCCQRKIASD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001664G-protein coupled receptor binding
GO:0019899enzyme binding
GO:0044877macromolecular complex binding
GO:0008081phosphoric diester hydrolase activity
GO:0032403protein complex binding
GO:0035091phosphatidylinositol binding
Vocabulary: biological process
TermDefinition
GO:0001841neural tube formation
GO:0001843neural tube closure
GO:0007420brain development
GO:0008277regulation of G-protein coupled receptor protein signaling pathway
GO:0008589regulation of smoothened signaling pathway
GO:0009952anterior/posterior pattern specification
GO:0021904dorsal/ventral neural tube patterning
GO:0021914negative regulation of smoothened signaling pathway involved in ventral spinal cord patterning
GO:0021915neural tube development
GO:0021953central nervous system neuron differentiation
GO:0031076embryonic camera-type eye development
GO:0042733embryonic digit morphogenesis
GO:0045879negative regulation of smoothened signaling pathway
GO:0048702embryonic neurocranium morphogenesis
GO:0060173limb development
GO:0060348bone development
GO:0060434bronchus morphogenesis
GO:0060831smoothened signaling pathway involved in dorsal/ventral neural tube patterning
GO:0061512protein localization to cilium
GO:0061548ganglion development
GO:0097500receptor localization to non-motile cilium
GO:1903546protein localization to photoreceptor outer segment
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005886plasma membrane
GO:0005930axoneme
GO:0097546ciliary base
GO:00977319+0 non-motile cilium
GO:0005576extracellular region
GO:0005737cytoplasm
GO:0005929cilium
Vocabulary: INTERPRO
TermDefinition
IPR000007Tubby_C
IPR025659Tubby-like_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000007Tubby, C-terminalPRINTSPR01573SUPERTUBBYcoord: 292..319
score: 18.67
coord: 245..269
score: 29.09
coord: 410..432
score: 55.53
coord: 369..385
score: 61.76
coord: 229..245
score: 24.6
coord: 351..368
score: 37.37
IPR000007Tubby, C-terminalPFAMPF01167Tubcoord: 169..424
e-value: 1.0E-42
score: 146.6
IPR025659Tubby-like, C-terminalGENE3DG3DSA:3.20.90.10coord: 154..432
e-value: 4.1E-48
score: 165.9
IPR025659Tubby-like, C-terminalSUPERFAMILYSSF54518Tubby C-terminal domain-likecoord: 160..430
NoneNo IPR availablePANTHERPTHR16517:SF7PROTEIN KING TUBBYcoord: 59..429
NoneNo IPR availablePANTHERPTHR16517TUBBY-RELATEDcoord: 59..429