ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30015352
Length (bp)2228
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30015352) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30015352) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30015352) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30015352) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015352

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015352SMESG000078716.1 SmedASXL_014774SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015352SMESG000078716.1 dd_Smed_v4_9826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015352SMESG000078716.1 dd_Smed_v4_9826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015352SMESG000078716.1 dd_Smed_v4_9826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015352SMESG000078716.1 dd_Smed_v4_9826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015352SMESG000078716.1 dd_Smed_v4_9826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015352SMESG000078716.1 dd_Smed_v6_9826_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015352SMESG000078716.1 OX_Smed_1.0.11893ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30015352SMESG000078716.1 Contig53389newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015352SMESG000078716.1 Contig53389uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015352SMESG000078716.1 Contig45571newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015352SMESG000078716.1 Contig45571uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ASPG (asparaginase [Source:HGNC Symbol;Acc:HGNC:20123])

HSP 1 Score: 359.762 bits (922), Expect = 8.950e-115
Identity = 210/558 (37.63%), Postives = 308/558 (55.20%), Query Frame = 1
Query:  280 KRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISRE---------------QRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTN-KEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVEL 1905
            +R+L +YTGGTIGMR + G   P        L  LPMF+D        +H   ++  +  +  V+P +  + R+++ V E  PL DSSDMT+ +++ +A+ I+  YE Y GF+++HGTDTM+F  S LSF+LENL+K VILTG+Q+P+  + SDGRENLL +L++A  Y IPEV LFF   LFR NR  K+ +  F AF SPN  PLA VG  I +    +   +       ++ M  DV +LR++P I    V+AFL PP++GVV+ T+GSGN P  + DLL+  + A +R  +I+N T C +G V   Y  G  +   G+  G DMT EAAL KLSYVL +   +++ ++  +T++LRGE+T    E  R                  S SQ+   + + L+   A C+ A +G+V  ++ + +   +    D+NG+T LH AA     E V  LL++ V VN  D  GF+PL  AV  R    +I  LR  GA +     +E   E+    ++ D E L +   AG DL     D ++ LH++   G L  V  L
Sbjct:    9 RRLLAVYTGGTIGMRSELGVLVPGTGL-AAILRTLPMFHDE-------EHA--RARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTDTMAFAASMLSFMLENLQKTVILTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRATKVDARRFAAFCSPNLLPLATVGADITINRELVRKVDGKAGLVVHSSMEQDVGLLRLYPGIPAALVRAFLQPPLKGVVMETFGSGNGP-TKPDLLQELRVATERGLVIVNCTHCLQGAVTTDYAAGMAMAGAGVISGFDMTSEAALAKLSYVLGQPGLSLDVRKELLTKDLRGEMTPPSVEERRPSLQGNTLGGGVSWLLSLSGSQEADALRNALVPSLA-CAAAHAGDVEALQALVELGSDLGLVDFNGQTPLHAAARGGHTEAVTMLLQRGVDVNTRDTDGFSPLLLAVRGR-HPGVIGLLREAGASLSTQELEEAGTELCRLAYRADLEGLQVWWQAGADLGQPGYDGHSALHVAEAAGNLAVVAFL 553          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ASPG (asparaginase [Source:HGNC Symbol;Acc:HGNC:20123])

HSP 1 Score: 343.199 bits (879), Expect = 1.184e-108
Identity = 194/498 (38.96%), Postives = 283/498 (56.83%), Query Frame = 1
Query:  280 KRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISRE---------------QRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKI 1728
            +R+L +YTGGTIGMR + G   P        L  LPMF+D        +H   ++  +  +  V+P +  + R+++ V E  PL DSSDMT+ +++ +A+ I+  YE Y GF+++HGTDTM+F  S LSF+LENL+K VILTG+Q+P+  + SDGRENLL +L++A  Y IPEV LFF   LFR NR  K+ +  F AF SPN  PLA VG  I +    +   +       ++ M  DV +LR++P I    V+AFL PP++GVV+ T+GSGN P  + DLL+  + A +R  +I+N T C +G V   Y  G  +   G+  G DMT EAAL KLSYVL +   +++ ++  +T++LRGE+T    E  R                  S SQ+   + + L+   A C+ A +G+V  ++ + +   +    D+NG+T LH AA     E V  LL++ V VN  D  GF+PL  AV  R    +I  LR  GA +
Sbjct:    9 RRLLAVYTGGTIGMRSELGVLVPGTGL-AAILRTLPMFHDE-------EHA--RARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTDTMAFAASMLSFMLENLQKTVILTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRATKVDARRFAAFCSPNLLPLATVGADITINRELVRKVDGKAGLVVHSSMEQDVGLLRLYPGIPAALVRAFLQPPLKGVVMETFGSGNGP-TKPDLLQELRVATERGLVIVNCTHCLQGAVTTDYAAGMAMAGAGVISGFDMTSEAALAKLSYVLGQPGLSLDVRKELLTKDLRGEMTPPSVEERRPSLQGNTLGGGVSWLLSLSGSQEADALRNALVPSLA-CAAAHAGDVEALQALVELGSDLGLVDFNGQTPLHAAARGGHTEAVTMLLQRGVDVNTRDTDGFSPLLLAVRGR-HPGVIGLLREAGASL 493          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ASPG (asparaginase [Source:HGNC Symbol;Acc:HGNC:20123])

HSP 1 Score: 128.257 bits (321), Expect = 3.911e-34
Identity = 55/102 (53.92%), Postives = 79/102 (77.45%), Query Frame = 1
Query:  496 RVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEV 801
            R+++ V E  PL DSSDMT+ +++ +A+ I+  YE Y GF+++HGTDTM+F  S LSF+LENL+K VILTG+Q+P+  + SDGRENLL +L++A  Y IPE+
Sbjct:    8 RILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTDTMAFAASMLSFMLENLQKTVILTGAQVPIHALWSDGRENLLGALLMAGQYVIPEL 109          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 75.0998 bits (183), Expect = 3.446e-13
Identity = 50/184 (27.17%), Postives = 88/184 (47.83%), Query Frame = 1
Query: 1468 NAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            +A+ G V +   + +       A   G T LHVAA    ++V + LL++    +   + G TPL  A  +  ++++ + L  KGA    T K  +  + +A  K+  +I S L++ G + NIV +   T LHL++  G  D V  LL  G    M  +   T+   A   D+V++ ++L+   +
Sbjct:  509 SAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAA-HYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGA 691          

HSP 2 Score: 66.6254 bits (161), Expect = 1.393e-10
Identity = 46/159 (28.93%), Postives = 71/159 (44.65%), Query Frame = 1
Query: 1528 EAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
             A   NG T LH+AA  NQ+++   LL    + N   + G TPL  A       +++  L  KGA I M+ K     + LA  +D   +  +L   G D +   +   T L ++  YG +  V  LLK G   + K ++  T   +A  +    I N+L
Sbjct:  595 HATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLAS-QEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL 752          

HSP 3 Score: 65.0846 bits (157), Expect = 3.944e-10
Identity = 57/206 (27.67%), Postives = 92/206 (44.66%), Query Frame = 1
Query: 1450 GAALCSNAKSGNVAM-----------VEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSR--ELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLL--------IDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            G+++ S  K GN A+           V+ + K   N  A   NG T L++AA  N I+VV++LLE     +   + GFTPL  A+    ++   +++E  +KG       K     + +A  KDDT+  +LL        + + + +N   E   T LH++A YG ++    LL  G       R+  T    A  R   ++  LL
Sbjct:   59 GSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKG-------KVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLL 257          

HSP 4 Score: 56.9954 bits (136), Expect = 1.389e-7
Identity = 46/184 (25.00%), Postives = 80/184 (43.48%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIME-LRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            A  GNV +   +  R    +    NG T LHVA+      +V+ LL++  Q++   + G TPL CA   R   + ++E L  +GA ++   K     + +A   D  E +  L+     ++ V  D  T LH++A  G       LL      + +  +  T    A  ++R+ +  LL  + +
Sbjct:  213 AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAA--RSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGA 394          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 75.0998 bits (183), Expect = 4.326e-13
Identity = 50/184 (27.17%), Postives = 88/184 (47.83%), Query Frame = 1
Query: 1468 NAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            +A+ G V +   + +       A   G T LHVAA    ++V + LL++    +   + G TPL  A  +  ++++ + L  KGA    T K  +  + +A  K+  +I S L++ G + NIV +   T LHL++  G  D V  LL  G    M  +   T+   A   D+V++ ++L+   +
Sbjct:  516 SAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAA-HYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGA 698          

HSP 2 Score: 66.6254 bits (161), Expect = 1.525e-10
Identity = 46/159 (28.93%), Postives = 71/159 (44.65%), Query Frame = 1
Query: 1528 EAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
             A   NG T LH+AA  NQ+++   LL    + N   + G TPL  A       +++  L  KGA I M+ K     + LA  +D   +  +L   G D +   +   T L ++  YG +  V  LLK G   + K ++  T   +A  +    I N+L
Sbjct:  602 HATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLAS-QEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL 759          

HSP 3 Score: 65.4698 bits (158), Expect = 3.993e-10
Identity = 67/276 (24.28%), Postives = 116/276 (42.03%), Query Frame = 1
Query: 1288 LSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIH-----------------------------KDDTEILSLL--------IDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            ++ +L +SD N    R+A   NL   +   +  I  +  + +Q+G+          AL   AK G+V +V+++  R  + ++A   G TALH+A+ + Q EVV+ L+++   +N   Q GFTPL  A       +++  L   GA      ++ F  + +A+                              KDDT+  +LL        + + + +N   E   T LH++A YG ++    LL  G       R+  T    A  R   ++  LL
Sbjct:    1 MTTMLQKSDSNASFLRAARAGNLDKVVEYLKGGI--DINTCNQNGL---------NALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAA-QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLL 264          

HSP 4 Score: 57.3806 bits (137), Expect = 1.044e-7
Identity = 46/184 (25.00%), Postives = 80/184 (43.48%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIME-LRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            A  GNV +   +  R    +    NG T LHVA+      +V+ LL++  Q++   + G TPL CA   R   + ++E L  +GA ++   K     + +A   D  E +  L+     ++ V  D  T LH++A  G       LL      + +  +  T    A  ++R+ +  LL  + +
Sbjct:  220 AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAA--RSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGA 401          

HSP 5 Score: 50.8322 bits (120), Expect = 9.955e-6
Identity = 55/231 (23.81%), Postives = 90/231 (38.96%), Query Frame = 1
Query: 1408 LSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCA----------------------------VLNRCSR----ELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            L     V D  L    AL   A  G+  + + +  +R N  A   NG T LH+A   N+I+V+  L++    +    ++G TP+  A                             L+  +R    E++  L   GA +    +E    + +A     TEI+ LL+      +    +  T LH+SA  G++D    LL+AG   S+  +   T    A     +D+  LL
Sbjct:  331 LQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 561          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: C27A7.5 (pep chromosome:WBcel235:V:12154875:12158553:-1 gene:WBGene00007756.1 transcript:C27A7.5d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C27A7.5)

HSP 1 Score: 455.292 bits (1170), Expect = 4.164e-151
Identity = 245/594 (41.25%), Postives = 359/594 (60.44%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIR-----VVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISRE----------QRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            RVL+LYTGGTIGM+  +G Y P P +  + L  +P  ND     +Y++       E  SNV V P S   +R     VV+ + EY PLLDS DMT DD+IRIA DI+  Y  YDGF++LHGTDT+++T SALSF++ENL KPVI+TGSQIP+ E+RSDG ENL+ +LI A ++DIPEV ++F+  L R NRT KL +   +AFDSPN  PLA + I+IKV    +   +    F  + ++C DV +LR+FPS+T E+V+AFL PP RG +L T+GSGNMP  R+D++   KEA  R  +++N +QC KG V   Y TG IL + G+ PG DMT EAA+ KL YVL + +W++  KRS +  NLRGE+T+      RE           R  S   + +  ++I+    C+ AK+ +V +++ +     N+ A DYN +TALHVAAS+  +E V +LL+    V+  D  G+  L CAV  + + + I+ +R  G  I  + ++I  E+ LA++++D E+L     AG  +   + D  T LH++A   + + V  LL+ G     K+    T  DEA  R+  ++ ++++   +
Sbjct:   55 RVLVLYTGGTIGMKTTDGVYCPVPGYLPEVLRDIPPLNDR----RYIE-------ESYSNVAVRPYSLPPVRNMKKRVVYWIVEYEPLLDSCDMTFDDWIRIATDIKKAYHKYDGFVVLHGTDTLAYTASALSFMMENLGKPVIITGSQIPVAEVRSDGMENLIGALITAGNFDIPEVCVYFNNKLMRGNRTVKLDNSALEAFDSPNMHPLAQMAINIKVNYDSIFRSDMVAAFTVHENLCRDVGMLRIFPSMTIESVRAFLQPPTRGCILQTFGSGNMPTRRQDIIMALKEAIARGVMVVNCSQCLKGQVDVNYATGKILYDIGVIPGSDMTSEAAMAKLCYVLGKDEWDLPMKRSMLQSNLRGEMTIASKGAMRELDIIPHIAKCLRVSSSQEVQLLRDIILPPMFCNAAKTNDVEILKSLKAAGVNFSATDYNLRTALHVAASNGHLESVNYLLKIGTNVHIKDMFGYNALVCAVKAK-AMDCIIAIRDAGGFIDASAQKIGVELCLAVYQNDMELLKCNEAAGTHMGEKDYDNRTALHVAASLNKPEIVAYLLQCGLNPHEKDDFGITPMDEAKRRNLQNLMDMMAEHQA 636          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: C27A7.5 (pep chromosome:WBcel235:V:12154875:12160982:-1 gene:WBGene00007756.1 transcript:C27A7.5e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C27A7.5)

HSP 1 Score: 455.292 bits (1170), Expect = 1.140e-150
Identity = 245/594 (41.25%), Postives = 359/594 (60.44%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIR-----VVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISRE----------QRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            RVL+LYTGGTIGM+  +G Y P P +  + L  +P  ND     +Y++       E  SNV V P S   +R     VV+ + EY PLLDS DMT DD+IRIA DI+  Y  YDGF++LHGTDT+++T SALSF++ENL KPVI+TGSQIP+ E+RSDG ENL+ +LI A ++DIPEV ++F+  L R NRT KL +   +AFDSPN  PLA + I+IKV    +   +    F  + ++C DV +LR+FPS+T E+V+AFL PP RG +L T+GSGNMP  R+D++   KEA  R  +++N +QC KG V   Y TG IL + G+ PG DMT EAA+ KL YVL + +W++  KRS +  NLRGE+T+      RE           R  S   + +  ++I+    C+ AK+ +V +++ +     N+ A DYN +TALHVAAS+  +E V +LL+    V+  D  G+  L CAV  + + + I+ +R  G  I  + ++I  E+ LA++++D E+L     AG  +   + D  T LH++A   + + V  LL+ G     K+    T  DEA  R+  ++ ++++   +
Sbjct:   92 RVLVLYTGGTIGMKTTDGVYCPVPGYLPEVLRDIPPLNDR----RYIE-------ESYSNVAVRPYSLPPVRNMKKRVVYWIVEYEPLLDSCDMTFDDWIRIATDIKKAYHKYDGFVVLHGTDTLAYTASALSFMMENLGKPVIITGSQIPVAEVRSDGMENLIGALITAGNFDIPEVCVYFNNKLMRGNRTVKLDNSALEAFDSPNMHPLAQMAINIKVNYDSIFRSDMVAAFTVHENLCRDVGMLRIFPSMTIESVRAFLQPPTRGCILQTFGSGNMPTRRQDIIMALKEAIARGVMVVNCSQCLKGQVDVNYATGKILYDIGVIPGSDMTSEAAMAKLCYVLGKDEWDLPMKRSMLQSNLRGEMTIASKGAMRELDIIPHIAKCLRVSSSQEVQLLRDIILPPMFCNAAKTNDVEILKSLKAAGVNFSATDYNLRTALHVAASNGHLESVNYLLKIGTNVHIKDMFGYNALVCAVKAK-AMDCIIAIRDAGGFIDASAQKIGVELCLAVYQNDMELLKCNEAAGTHMGEKDYDNRTALHVAASLNKPEIVAYLLQCGLNPHEKDDFGITPMDEAKRRNLQNLMDMMAEHQA 673          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: C27A7.5 (pep chromosome:WBcel235:V:12154875:12162299:-1 gene:WBGene00007756.1 transcript:C27A7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C27A7.5)

HSP 1 Score: 455.677 bits (1171), Expect = 2.070e-150
Identity = 245/594 (41.25%), Postives = 359/594 (60.44%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIR-----VVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISRE----------QRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            RVL+LYTGGTIGM+  +G Y P P +  + L  +P  ND     +Y++       E  SNV V P S   +R     VV+ + EY PLLDS DMT DD+IRIA DI+  Y  YDGF++LHGTDT+++T SALSF++ENL KPVI+TGSQIP+ E+RSDG ENL+ +LI A ++DIPEV ++F+  L R NRT KL +   +AFDSPN  PLA + I+IKV    +   +    F  + ++C DV +LR+FPS+T E+V+AFL PP RG +L T+GSGNMP  R+D++   KEA  R  +++N +QC KG V   Y TG IL + G+ PG DMT EAA+ KL YVL + +W++  KRS +  NLRGE+T+      RE           R  S   + +  ++I+    C+ AK+ +V +++ +     N+ A DYN +TALHVAAS+  +E V +LL+    V+  D  G+  L CAV  + + + I+ +R  G  I  + ++I  E+ LA++++D E+L     AG  +   + D  T LH++A   + + V  LL+ G     K+    T  DEA  R+  ++ ++++   +
Sbjct:  121 RVLVLYTGGTIGMKTTDGVYCPVPGYLPEVLRDIPPLNDR----RYIE-------ESYSNVAVRPYSLPPVRNMKKRVVYWIVEYEPLLDSCDMTFDDWIRIATDIKKAYHKYDGFVVLHGTDTLAYTASALSFMMENLGKPVIITGSQIPVAEVRSDGMENLIGALITAGNFDIPEVCVYFNNKLMRGNRTVKLDNSALEAFDSPNMHPLAQMAINIKVNYDSIFRSDMVAAFTVHENLCRDVGMLRIFPSMTIESVRAFLQPPTRGCILQTFGSGNMPTRRQDIIMALKEAIARGVMVVNCSQCLKGQVDVNYATGKILYDIGVIPGSDMTSEAAMAKLCYVLGKDEWDLPMKRSMLQSNLRGEMTIASKGAMRELDIIPHIAKCLRVSSSQEVQLLRDIILPPMFCNAAKTNDVEILKSLKAAGVNFSATDYNLRTALHVAASNGHLESVNYLLKIGTNVHIKDMFGYNALVCAVKAK-AMDCIIAIRDAGGFIDASAQKIGVELCLAVYQNDMELLKCNEAAGTHMGEKDYDNRTALHVAASLNKPEIVAYLLQCGLNPHEKDDFGITPMDEAKRRNLQNLMDMMAEHQA 702          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: C27A7.5 (pep chromosome:WBcel235:V:12154875:12162298:-1 gene:WBGene00007756.1 transcript:C27A7.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C27A7.5)

HSP 1 Score: 455.292 bits (1170), Expect = 2.608e-150
Identity = 245/594 (41.25%), Postives = 359/594 (60.44%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIR-----VVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISRE----------QRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            RVL+LYTGGTIGM+  +G Y P P +  + L  +P  ND     +Y++       E  SNV V P S   +R     VV+ + EY PLLDS DMT DD+IRIA DI+  Y  YDGF++LHGTDT+++T SALSF++ENL KPVI+TGSQIP+ E+RSDG ENL+ +LI A ++DIPEV ++F+  L R NRT KL +   +AFDSPN  PLA + I+IKV    +   +    F  + ++C DV +LR+FPS+T E+V+AFL PP RG +L T+GSGNMP  R+D++   KEA  R  +++N +QC KG V   Y TG IL + G+ PG DMT EAA+ KL YVL + +W++  KRS +  NLRGE+T+      RE           R  S   + +  ++I+    C+ AK+ +V +++ +     N+ A DYN +TALHVAAS+  +E V +LL+    V+  D  G+  L CAV  + + + I+ +R  G  I  + ++I  E+ LA++++D E+L     AG  +   + D  T LH++A   + + V  LL+ G     K+    T  DEA  R+  ++ ++++   +
Sbjct:  123 RVLVLYTGGTIGMKTTDGVYCPVPGYLPEVLRDIPPLNDR----RYIE-------ESYSNVAVRPYSLPPVRNMKKRVVYWIVEYEPLLDSCDMTFDDWIRIATDIKKAYHKYDGFVVLHGTDTLAYTASALSFMMENLGKPVIITGSQIPVAEVRSDGMENLIGALITAGNFDIPEVCVYFNNKLMRGNRTVKLDNSALEAFDSPNMHPLAQMAINIKVNYDSIFRSDMVAAFTVHENLCRDVGMLRIFPSMTIESVRAFLQPPTRGCILQTFGSGNMPTRRQDIIMALKEAIARGVMVVNCSQCLKGQVDVNYATGKILYDIGVIPGSDMTSEAAMAKLCYVLGKDEWDLPMKRSMLQSNLRGEMTIASKGAMRELDIIPHIAKCLRVSSSQEVQLLRDIILPPMFCNAAKTNDVEILKSLKAAGVNFSATDYNLRTALHVAASNGHLESVNYLLKIGTNVHIKDMFGYNALVCAVKAK-AMDCIIAIRDAGGFIDASAQKIGVELCLAVYQNDMELLKCNEAAGTHMGEKDYDNRTALHVAASLNKPEIVAYLLQCGLNPHEKDDFGITPMDEAKRRNLQNLMDMMAEHQA 704          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 67.3958 bits (163), Expect = 3.380e-11
Identity = 53/207 (25.60%), Postives = 91/207 (43.96%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIH-----------------------------KDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            +K G+  +V ++ KR+   +AA   G TALH+A+ + Q  +V  L+E    VN     GFTPL  A       E++  L   GA   ++ ++ F  + +A+                              KDDT   +LL+    + ++ ++   T LH++A YG  +    LL+ G   + + RH+ +    A    R ++ NLL
Sbjct:   74 SKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAA-QENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLL 279          

HSP 2 Score: 62.7734 bits (151), Expect = 8.858e-10
Identity = 41/147 (27.89%), Postives = 69/147 (46.94%), Query Frame = 1
Query: 1528 EAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEA 1968
            +AA  NG T LH+AA  NQ+E+   LL+ +   N   +AGFTPL  +      +E+   L   G+ +          + L   +D   +  +L + G ++N       T LH++  +G+L+ V  L++ G +   K R   T   +A
Sbjct:  617 KAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSA-QEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA 762          

HSP 3 Score: 62.3882 bits (150), Expect = 1.310e-9
Identity = 44/183 (24.04%), Postives = 87/183 (47.54%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            A  G+V + + +  R  +  +   NG T LH+A   N+I+VV  LL+    +    ++G TPL  A     +  +++ L  +GA   +        + LA   + T+++ +LI  G  ++    +  T LH+++  G  D V+ LL+AG  ++   R + +    A    + ++  +L + N+
Sbjct:  367 AHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAF-MGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNA 548          

HSP 4 Score: 60.077 bits (144), Expect = 6.530e-9
Identity = 41/158 (25.95%), Postives = 80/158 (50.63%), Query Frame = 1
Query: 1480 GNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNT 1953
            G + +V  + ++  N +     G+T LH+AA +NQ +VVR L+    +V+   +   TPL  A     + ++++ L   GA    T ++ +  + +A  +   E+  +L+D   D  ++ +   T LHL++ YG L+ V  LL+ G    ++ ++  T
Sbjct:  436 GAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIAS-RLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVT 592          

HSP 5 Score: 52.7582 bits (125), Expect = 1.123e-6
Identity = 54/238 (22.69%), Postives = 106/238 (44.54%), Query Frame = 1
Query: 1234 EYGIYPGLDMTLEAALNKLSYVLAR-SDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELI-IGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNR 1941
            E G+ P        A+N + Y+L + ++ ++ET R     +L      T+       R L ++G  +D++   +   L   ++ GN  +V  + +   N  A   +  + LH+AA   Q EV   LL+         + GFTPL  A     + E++  L  +G  + +  K     + +A H ++ ++  LL++ G       ++  T LH++A   +++    LL+   + + K+R
Sbjct:  423 ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDV-----VRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLAS-KYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSR 654          

HSP 6 Score: 49.6766 bits (117), Expect = 8.470e-6
Identity = 40/153 (26.14%), Postives = 77/153 (50.33%), Query Frame = 1
Query: 1453 AALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIME-LRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            A+    A++G++  V ++ +   +   ++ NG  +LH+A+     EVVR L++++ QV+   + G T L  A L    + LI+  L   GA + + +   F  + +A  ++  E++  L+  G +  +  ED  T L ++   G  D VV +L
Sbjct:   35 ASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASL--AGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGH-DRVVAVL 184          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG6428 (gene:FBgn0029689 transcript:FBtr0070625)

HSP 1 Score: 397.897 bits (1021), Expect = 4.455e-129
Identity = 219/545 (40.18%), Postives = 322/545 (59.08%), Query Frame = 1
Query:  283 RVLILYTGGTIGM-RKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMP-RSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTET----------EISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYG 1881
            RV ++YTGGTIGM R +     P PN   +++ K P  +D   + +        +        V+P     D RV++ + EY PLLDSS+MTM+D+ RIA DIQ  YE +DGF++LHGTDT+S+T SALSF+LENL K VI+TGSQIP+FE R+DG++N  ++LIIA +Y IPEV +FF   L R NRT K+SS   DAFDSPN PPLA +GI + V    +  P   + F  + ++  +V +LR+FPSI+  T +AFLAPPIRGVVL ++GSGN+P  RKDL++  + A +R  IIIN TQC  G V  IY TG +L + G+ PG DMT EAAL KL+YV+ + +W+++ K+  M  +LRGELT  +            ++R     S   +    E +  A + +    G+   +  +     +    +++ +TALH+A     +E+V++LL+  V V+  D+   TPL  AV    S E+I  L + GA +  +++ + +++  A  +     L     AG DL   +    T LH++A++G
Sbjct:   51 RVKVIYTGGTIGMVRNERNVLAPIPNALVRSIRKYPNIHDEEYALRRFGASASMA------PLVLPIVQGVDRRVIYQISEYTPLLDSSNMTMNDWARIASDIQQSYEFFDGFVVLHGTDTLSYTASALSFMLENLGKTVIITGSQIPIFETRTDGKDNFTSALIIAGNYIIPEVCIFFGHKLMRGNRTVKVSSNALDAFDSPNVPPLARIGIDVNVDYRLIFRPCTIERFCVHLNLDENVGLLRIFPSISHSTFRAFLAPPIRGVVLQSFGSGNIPSNRKDLIDELRAAGERGVIIINCTQCPNGTVAEIYDTGKVLCDVGVIPGFDMTPEAALAKLAYVIGKEEWSLDMKKQMMQSSLRGELTSLKAPKMEDYDLVDAVARSLHLSSPQELDQLGETLFPAMINAAVAEGDPKKINNLKAYGADLSGTNHDQRTALHLACQLGNVEIVKYLLQNGVSVHVRDRYDRTPLLEAVATD-SHEIIQLLINCGAHLTGSSRAVGEQLCAAAARGSMIRLKSYQYAGADLAQSDPSGRTALHVAALHG 588          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG8526 (gene:FBgn0037759 transcript:FBtr0082142)

HSP 1 Score: 348.977 bits (894), Expect = 1.482e-110
Identity = 204/566 (36.04%), Postives = 315/566 (55.65%), Query Frame = 1
Query:  265 KCRIMK---RVLILYTGGTIGM-RKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPR-SPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE-------ISREQRSLSQDGIVMDSEL---IIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKI---IMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            KC  +K   RV ++Y GGTIGM R + G     P    + L + P  +D   +SK  D            + V+P  S    RV++++ E+ PL+DSS M   D+ RIA ++   Y++YDGF+ILHGTDT++++ SAL+F+LE+L KPV+ TG+QIP+FE RSDGREN L +L+IA +Y IPEV +FF   + R  R+ KL+S  F A DSPN+ PL    ++I++ S ++  P   +PF  ++++  +V++LR++P I+   V+A L  P +GVVL T+G+GN P  R+DLL+  +EA  R  II+NITQC  G V  IY+T   L E G+ PG DMT EAA  KL+YVL++ +W+I  K+  M  +LRGELT  +         I    R+L     +   ++      A + +    G+V  +  + +   N    + +G++A+H+A    ++  V FL+     VN  D+   TPL  A+ +  + ++I  L   GAK+    +   E+   +T    +   + L     AG +L + +    T LH +   G  + V  LL
Sbjct:    5 KCGCLKKEARVHVIYVGGTIGMIRNESGVLHTAPKVLARQLQEFPSCHDRNYTSKDND----------GPMMVLPAVSGAPYRVLYDLIEFCPLMDSSCMGFCDWKRIANEVGKTYKSYDGFVILHGTDTLAYSASALAFMLESLNKPVVFTGAQIPIFEARSDGRENFLGALLIAGNYSIPEVLVFFGNKILRGCRSTKLNSDSFHALDSPNFAPLGRASVNIEINSRQIFRPCNIKPFSLHSELEKNVALLRIYPGISASVVQAILKEPTKGVVLQTFGAGNFPVNREDLLDELREAVHRGVIIVNITQCSAGMVANIYETSQGLMEVGVIPGYDMTQEAAFTKLAYVLSKPEWDIPNKKKVMLLSLRGELTTNKVAKINDIDLIEGVARTLHMSTAMERQQMCSTFYPALVAAAVTEGDVHKLGDLKQYGANLCDTNCDGRSAMHLACFLGKLNCVCFLISAGCPVNVHDRFNRTPLHEAI-DTDNHDIINALLKNGAKLNDQPLVQAELLRALT---ERGKIKRLESFRLAGANLTLADRTGRTALHYACQLGNHEVVDYLL 556          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG8526 (gene:FBgn0037759 transcript:FBtr0334682)

HSP 1 Score: 346.665 bits (888), Expect = 1.004e-109
Identity = 205/566 (36.22%), Postives = 316/566 (55.83%), Query Frame = 1
Query:  265 KCRIMK---RVLILYTGGTIGM-RKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPR-SPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE-------ISREQRSLSQDGIVMDSEL---IIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKI---IMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            KC  +K   RV ++Y GGTIGM R + G     P    + L + P  +D   +SK  D            + V+P  S    RV++++ E+ PL+DSS M   D+ RIA ++ T Y++YDGF+ILHGTDT++++ SAL+F+LE+L KPV+ TG+QIP+FE RSDGREN L +L+IA +Y IPEV +FF   + R  R+ KL+S  F A DSPN+ PL    ++I++ S ++  P   +PF  ++++  +V++LR++P I+   V+A L  P +GVVL T+G+GN P  R+DLL+  +EA  R  II+NITQC  G V  IY+T   L E G+ PG DMT EAA  KL+YVL++ +W+I  K+  M  +LRGELT  +         I    R+L     +   ++      A + +    G+V  +  + +   N    + +G++A+H+A    ++  V FL+     VN  D+   TPL  A+ +  + ++I  L   GAK+    +   E+   +T    +   + L     AG +L + +    T LH +   G  + V  LL
Sbjct:    5 KCGCLKKEARVHVIYVGGTIGMIRNESGVLHTAPKVLARQLQEFPSCHDRNYTSKDND----------GPMMVLPAVSGAPYRVLYDLIEFCPLMDSSCMGFCDWKRIANEVGT-YKSYDGFVILHGTDTLAYSASALAFMLESLNKPVVFTGAQIPIFEARSDGRENFLGALLIAGNYSIPEVLVFFGNKILRGCRSTKLNSDSFHALDSPNFAPLGRASVNIEINSRQIFRPCNIKPFSLHSELEKNVALLRIYPGISASVVQAILKEPTKGVVLQTFGAGNFPVNREDLLDELREAVHRGVIIVNITQCSAGMVANIYETSQGLMEVGVIPGYDMTQEAAFTKLAYVLSKPEWDIPNKKKVMLLSLRGELTTNKVAKINDIDLIEGVARTLHMSTAMERQQMCSTFYPALVAAAVTEGDVHKLGDLKQYGANLCDTNCDGRSAMHLACFLGKLNCVCFLISAGCPVNVHDRFNRTPLHEAI-DTDNHDIINALLKNGAKLNDQPLVQAELLRALT---ERGKIKRLESFRLAGANLTLADRTGRTALHYACQLGNHEVVDYLL 555          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG10011 (gene:FBgn0039590 transcript:FBtr0085319)

HSP 1 Score: 71.2478 bits (173), Expect = 3.398e-12
Identity = 54/164 (32.93%), Postives = 80/164 (48.78%), Query Frame = 1
Query: 1471 AKSGNVAMVEQI---GKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLE------------KEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAG 1917
            A  GN  ++E+     K   + E  DYNG+TAL++AA +  +EVV+ LL             K V VN  D+ G+TPLR A     S  + + +     KI + +KE    +  A      +IL LLI++G D+N V+    T L  ++  G  D V  LL+ G
Sbjct: 1243 ANDGNHQLLERALNACKSPIDLEIEDYNGQTALNIAARNGHLEVVKLLLSFSQPCNDGTGRMKRVDVNHADRDGWTPLRSASWGGHSEVVRLLIAQPACKIDLADKEGRTALRAAAWSGHEDILKLLIESGADVNSVDRQGRTSLIAASYMGHYDIVEILLENG 1406          

HSP 2 Score: 53.1434 bits (126), Expect = 1.164e-6
Identity = 41/137 (29.93%), Postives = 66/137 (48.18%), Query Frame = 1
Query: 1537 DYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNE---DKNTFLHLSAIYGRLDFVVELLKAGCETSMKN 1938
            D  G+T L + A+   +E VR LL++ +     D AG+TPL  A       E+ ++L   GAKI   + E    + LA  +     +  L+D  I  + V++   D  T   L+ + G +D V  LLK  C+ + K+
Sbjct: 1515 DSEGRTVLSIGAAQGNVETVRQLLDRGLDETHRDNAGWTPLHYAAF-EGFHEVCLQLLESGAKIDECDNEGKTALHLAAQEGRLHCVQALLD--IHSSFVDQKAHDGKTAFRLACLEGHMDTVEFLLKFCCDVNSKD 1648          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Kank (gene:FBgn0027596 transcript:FBtr0303758)

HSP 1 Score: 68.9366 bits (167), Expect = 7.127e-12
Identity = 49/159 (30.82%), Postives = 86/159 (54.09%), Query Frame = 1
Query: 1534 ADYNGKTALHVAASSNQIEVVRFLLEKEV-QVNCGDQAGFTPL---RCAVLNRCSRELIMELRSKGAKI-IMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLK-AGCETSMKNRHDNTAYDEAFVRDRVDI 1992
            +D NG TA+H A S    +VV  LL+ +V  VN  + AG+T +     A L + +   ++E   K A + I   K     + LA+   + +++++L+DAG D+NI +ED +T L  +A +GR+D +  LL    C++ + +   +TA+  A+     D+
Sbjct:  250 SDSNGNTAMHYAVSHGNFDVVSILLDSKVCDVNQMNNAGYTSVMLVSLAKLKQPAHRTVVERLFKMADVNIRAKKHCQTALMLAVSHGNGDMVNMLLDAGADINIQDEDGSTALMCAAEHGRVDVIKHLLSHPECDSLVTDVDGSTAFKIAWQAGHRDV 408          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: aspg (asparaginase homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-070820-14])

HSP 1 Score: 429.483 bits (1103), Expect = 7.587e-141
Identity = 255/637 (40.03%), Postives = 368/637 (57.77%), Query Frame = 1
Query:   79 EHDTFSINSQSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPS-NVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFD---EITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKN 1938
            +H+T + +S S T     ++R KL   QS  F+S     +     G +    S+   +  D    +  RVL++ TGGTIGM        PEPN F + L KLP+ +D     +Y  H     +  P  N  V+P S ++ R+V+ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ ENL KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF+SPN PPLA+  + IK+    +        F   T M  +V +LR+FP IT +TV+AFL PP+ G+VL TYGSGN P  R DLL+  ++A  R  I+IN TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ + +IE K+  ++ NLRGE         L+L+++  I    +SLS   ++ +    + +    +C  AK G++  +E I +   +   ADY+G+T LH+AA    ++VV +LL K   V   D+ G TPLR AV  R  ++++  LR  GA    + +E+ D   E+       D E L +   AG+DL + + D  T + ++   G ++  VE LK       +N
Sbjct:   12 KHNTSAPSSASMTSLCRALSRSKL--NQSDTFQSQKSLSRSAA--GQSRRRFSSSSESPPDVSPNVEARVLVINTGGTIGMTYHNNVLSPEPNAFVETLRKLPILHDE----QYAQHTRLYDYYKPQENTLVLPLSKQNKRIVYTVLEYSPLLDSCNMTTDDWATIGKDIEKHYEQYDGFVILHGTDTMAYTASALSFMCENLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFNSPNLPPLANAEVDIKINWDTVWRANTTAKFTVNTQMNRNVGLLRLFPGITADTVRAFLQPPMDGIVLETYGSGNAPDNRADLLDEIRKATQRGLIMINCTQCLRGSVTTSYATGQALSDAGLVAGCDMTPEAALSKLSYVLAKQNLSIEEKKKMLSHNLRGEMIADVGGAKLSLSDSRFIQVIAKSLSISCKEELEAIRDALTPTLVCVAAKIGDIDALEAIREMGTDLSMADYDGRTPLHIAACEGHLKVVEYLLGKGATVYAKDRFGHTPLRNAVRFR-HKDVVKLLRKTGAHF--SREEMADTGTELCSLAAAGDLEGLEIWQLAGVDLTMTSYDGQTPIEVARATGCVE-SVEFLKQAALYQTQN 636          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: aspg (asparaginase homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-070820-14])

HSP 1 Score: 429.483 bits (1103), Expect = 1.273e-140
Identity = 255/640 (39.84%), Postives = 370/640 (57.81%), Query Frame = 1
Query:   79 EHDTFSINSQSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPS-NVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFD---EITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHD 1947
            +H+T + +S S T     ++R KL   QS  F+S     +     G +    S+   +  D    +  RVL++ TGGTIGM        PEPN F + L KLP+ +D     +Y  H     +  P  N  V+P S ++ R+V+ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ ENL KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF+SPN PPLA+  + IK+    +        F   T M  +V +LR+FP IT +TV+AFL PP+ G+VL TYGSGN P  R DLL+  ++A  R  I+IN TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ + +IE K+  ++ NLRGE         L+L+++  I    +SLS   ++ +    + +    +C  AK G++  +E I +   +   ADY+G+T LH+AA    ++VV +LL K   V   D+ G TPLR AV  R  ++++  LR  GA    + +E+ D   E+       D E L +   AG+DL + + D  T + ++   G ++  VE LK       +++ D
Sbjct:   12 KHNTSAPSSASMTSLCRALSRSKL--NQSDTFQSQKSLSRSAA--GQSRRRFSSSSESPPDVSPNVEARVLVINTGGTIGMTYHNNVLSPEPNAFVETLRKLPILHDE----QYAQHTRLYDYYKPQENTLVLPLSKQNKRIVYTVLEYSPLLDSCNMTTDDWATIGKDIEKHYEQYDGFVILHGTDTMAYTASALSFMCENLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFNSPNLPPLANAEVDIKINWDTVWRANTTAKFTVNTQMNRNVGLLRLFPGITADTVRAFLQPPMDGIVLETYGSGNAPDNRADLLDEIRKATQRGLIMINCTQCLRGSVTTSYATGQALSDAGLVAGCDMTPEAALSKLSYVLAKQNLSIEEKKKMLSHNLRGEMIADVGGAKLSLSDSRFIQVIAKSLSISCKEELEAIRDALTPTLVCVAAKIGDIDALEAIREMGTDLSMADYDGRTPLHIAACEGHLKVVEYLLGKGATVYAKDRFGHTPLRNAVRFR-HKDVVKLLRKTGAHF--SREEMADTGTELCSLAAAGDLEGLEIWQLAGVDLTMTSYDGQTPIEVARATGCVE-SVEFLKQAALYQTQHQAD 639          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: aspg (asparaginase homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-070820-14])

HSP 1 Score: 428.328 bits (1100), Expect = 2.243e-140
Identity = 254/628 (40.45%), Postives = 366/628 (58.28%), Query Frame = 1
Query:   79 EHDTFSINSQSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPS-NVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFD---EITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLK 1911
            +H+T + +S S T     ++R KL   QS  F+S     +     G +    S+   +  D    +  RVL++ TGGTIGM        PEPN F + L KLP+ +D     +Y  H     +  P  N  V+P S ++ R+V+ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ ENL KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF+SPN PPLA+  + IK+    +        F   T M  +V +LR+FP IT +TV+AFL PP+ G+VL TYGSGN P  R DLL+  ++A  R  I+IN TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ + +IE K+  ++ NLRGE         L+L+++  I    +SLS   ++ +    + +    +C  AK G++  +E I +   +   ADY+G+T LH+AA    ++VV +LL K   V   D+ G TPLR AV  R  ++++  LR  GA    + +E+ D   E+       D E L +   AG+DL + + D  T + ++   G ++  VE LK
Sbjct:   12 KHNTSAPSSASMTSLCRALSRSKL--NQSDTFQSQKSLSRSAA--GQSRRRFSSSSESPPDVSPNVEARVLVINTGGTIGMTYHNNVLSPEPNAFVETLRKLPILHDE----QYAQHTRLYDYYKPQENTLVLPLSKQNKRIVYTVLEYSPLLDSCNMTTDDWATIGKDIEKHYEQYDGFVILHGTDTMAYTASALSFMCENLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFNSPNLPPLANAEVDIKINWDTVWRANTTAKFTVNTQMNRNVGLLRLFPGITADTVRAFLQPPMDGIVLETYGSGNAPDNRADLLDEIRKATQRGLIMINCTQCLRGSVTTSYATGQALSDAGLVAGCDMTPEAALSKLSYVLAKQNLSIEEKKKMLSHNLRGEMIADVGGAKLSLSDSRFIQVIAKSLSISCKEELEAIRDALTPTLVCVAAKIGDIDALEAIREMGTDLSMADYDGRTPLHIAACEGHLKVVEYLLGKGATVYAKDRFGHTPLRNAVRFR-HKDVVKLLRKTGAHF--SREEMADTGTELCSLAAAGDLEGLEIWQLAGVDLTMTSYDGQTPIEVARATGCVE-SVEFLK 627          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: aspg (asparaginase homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-070820-14])

HSP 1 Score: 423.32 bits (1087), Expect = 2.357e-138
Identity = 256/649 (39.45%), Postives = 369/649 (56.86%), Query Frame = 1
Query:   79 EHDTFSINSQSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPS-NVFVMPRSP------------EDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFD---EITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKN 1938
            +H+T + +S S T     ++R KL   QS  F+S     +     G +    S+   +  D    +  RVL++ TGGTIGM        PEPN F + L KLP+ +D     +Y  H     +  P  N  V+PRS             ++ R+V+ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ ENL KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF+SPN PPLA+  + IK+    +        F   T M  +V +LR+FP IT +TV+AFL PP+ G+VL TYGSGN P  R DLL+  ++A  R  I+IN TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ + +IE K+  ++ NLRGE         L+L+++  I    +SLS   ++ +    + +    +C  AK G++  +E I +   +   ADY+G+T LH+AA    ++VV +LL K   V   D+ G TPLR AV  R  ++++  LR  GA    + +E+ D   E+       D E L +   AG+DL + + D  T + ++   G ++  VE LK       +N
Sbjct:   12 KHNTSAPSSASMTSLCRALSRSKL--NQSDTFQSQKSLSRSAA--GQSRRRFSSSSESPPDVSPNVEARVLVINTGGTIGMTYHNNVLSPEPNAFVETLRKLPILHDE----QYAQHTRLYDYYKPQENTLVLPRSTHTADPLFHGLSKQNKRIVYTVLEYSPLLDSCNMTTDDWATIGKDIEKHYEQYDGFVILHGTDTMAYTASALSFMCENLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFNSPNLPPLANAEVDIKINWDTVWRANTTAKFTVNTQMNRNVGLLRLFPGITADTVRAFLQPPMDGIVLETYGSGNAPDNRADLLDEIRKATQRGLIMINCTQCLRGSVTTSYATGQALSDAGLVAGCDMTPEAALSKLSYVLAKQNLSIEEKKKMLSHNLRGEMIADVGGAKLSLSDSRFIQVIAKSLSISCKEELEAIRDALTPTLVCVAAKIGDIDALEAIREMGTDLSMADYDGRTPLHIAACEGHLKVVEYLLGKGATVYAKDRFGHTPLRNAVRFR-HKDVVKLLRKTGAHF--SREEMADTGTELCSLAAAGDLEGLEIWQLAGVDLTMTSYDGQTPIEVARATGCVE-SVEFLKQAALYQTQN 648          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: aspg (asparaginase homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-070820-14])

HSP 1 Score: 228.024 bits (580), Expect = 1.756e-68
Identity = 125/286 (43.71%), Postives = 172/286 (60.14%), Query Frame = 1
Query:   79 EHDTFSINSQSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPS-NVFVMPRSP------------EDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPP 897
            +H+T + +S S T     ++R KL   QS  F+S     +     G +    S+   +  D    +  RVL++ TGGTIGM        PEPN F + L KLP+ +D     +Y  H     +  P  N  V+PRS             ++ R+V+ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ ENL KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF+SPN PP
Sbjct:   12 KHNTSAPSSASMTSLCRALSRSKL--NQSDTFQSQKSLSRSAA--GQSRRRFSSSSESPPDVSPNVEARVLVINTGGTIGMTYHNNVLSPEPNAFVETLRKLPILHD----EQYAQHTRLYDYYKPQENTLVLPRSTHTADPLFHGLSKQNKRIVYTVLEYSPLLDSCNMTTDDWATIGKDIEKHYEQYDGFVILHGTDTMAYTASALSFMCENLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFNSPNLPP 289          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: aspg (asparaginase [Source:NCBI gene;Acc:100145621])

HSP 1 Score: 415.231 bits (1066), Expect = 3.083e-135
Identity = 235/557 (42.19%), Postives = 322/557 (57.81%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFND--HTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTET--EISREQRSLSQD-----GIVMDSEL------IIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNT-FLHLSAIYGRLDFVVE 1902
            RVL++ TGGTIGM  +     P+ N F K L  LP+ +D  +   +K  D       + P N  V+P S ++ R+V+ V EY+PLLDS +MT DD+ +IAKDI+  YE YDGF++LHGTDTM++T SALSF+ ENL K ++LTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN PPLA+  + I +    +      + F  +TDM  +V +LR+FP IT  TVKAFL PP+ G+VL TYGSGN P CR DLLE  K+A +R   IIN TQC +G V   Y TG  L   G+ PG D+T EAAL KLSYVL + + N E K+  +  NLRGE+T++ T  +IS       Q      G+    EL      +  +  C+ A +G+   +E I    GN  + DY+G+T LHVA+       V++LL     V   D+ G TPL  AV  R   E+I  LR  GA +     E    E+       D + L+    AG D+     D  T +  +S I  RL+   E
Sbjct:   78 RVLVINTGGTIGMMYQNEVLAPQANAFAKTLKTLPILHDEVYAQQTKLYDF-----HDFPENTLVLPLSKQNKRIVYTVLEYSPLLDSCNMTTDDWAKIAKDIKKYYEQYDGFVVLHGTDTMAYTASALSFMCENLGKTIVLTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFTSPNLPPLANAEVDITINWETVWRANTTKKFHVHTDMNRNVGLLRIFPGITAATVKAFLQPPMEGIVLETYGSGNAPDCRLDLLEELKKATERGVAIINCTQCLRGSVTESYATGKALTVVGVIPGCDLTPEAALAKLSYVLGKDNLNPEEKKRMLFENLRGEMTVSATGAKISLRDSKFIQVVAKSLGVSCKEELEAVRDALTPSLACAAAATGDTYALEAIRDMGGNLSSEDYDGRTPLHVASCDGHYAAVQYLLNNGATVYAKDRFGDTPLMNAVKFR-QLEVIKLLRQTGAHLSWEELEHTGTELCSLASLGDVDGLAAWELAGADMTQAGYDGQTPYQVVSEILHRLENTAE 628          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: aspg (asparaginase [Source:NCBI gene;Acc:100145621])

HSP 1 Score: 413.305 bits (1061), Expect = 3.284e-135
Identity = 232/559 (41.50%), Postives = 324/559 (57.96%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFND--HTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTET--EISREQRSLSQD-----GIVMDSEL------IIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNT-FLHLSAIYGRLDFVVELL 1908
            RVL++ TGGTIGM  +     P+ N F K L  LP+ +D  +   +K  D       + P N  V+P S ++ R+V+ V EY+PLLDS +MT DD+ +IAKDI+  YE YDGF++LHGTDTM++T SALSF+ ENL K ++LTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN PPLA+  + I +    +      + F  +TDM  +V +LR+FP IT  TVKAFL PP+ G+VL TYGSGN P CR DLLE  K+A +R   IIN TQC +G V   Y TG  L   G+ PG D+T EAAL KLSYVL + + N E K+  +  NLRGE+T++ T  +IS       Q      G+    EL      +  +  C+ A +G+   +E I    GN  + DY+G+T LHVA+       V++LL     V   D+ G TPL  AV  R   E+I  LR  GA +     E    E+       D + L+    AG D+     D  T +  + ++Y   ++++  L
Sbjct:   41 RVLVINTGGTIGMMYQNEVLAPQANAFAKTLKTLPILHDEVYAQQTKLYDF-----HDFPENTLVLPLSKQNKRIVYTVLEYSPLLDSCNMTTDDWAKIAKDIKKYYEQYDGFVVLHGTDTMAYTASALSFMCENLGKTIVLTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFTSPNLPPLANAEVDITINWETVWRANTTKKFHVHTDMNRNVGLLRIFPGITAATVKAFLQPPMEGIVLETYGSGNAPDCRLDLLEELKKATERGVAIINCTQCLRGSVTESYATGKALTVVGVIPGCDLTPEAALAKLSYVLGKDNLNPEEKKRMLFENLRGEMTVSATGAKISLRDSKFIQVVAKSLGVSCKEELEAVRDALTPSLACAAAATGDTYALEAIRDMGGNLSSEDYDGRTPLHVASCDGHYAAVQYLLNNGATVYAKDRFGDTPLMNAVKFR-QLEVIKLLRQTGAHLSWEELEHTGTELCSLASLGDVDGLAAWELAGADMTQAGYDGQTPYQVVKSVYQTHNYILYCL 593          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: aspg (asparaginase [Source:NCBI gene;Acc:100145621])

HSP 1 Score: 413.305 bits (1061), Expect = 1.484e-134
Identity = 231/549 (42.08%), Postives = 317/549 (57.74%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFND--HTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTET--EISREQRSLSQD-----GIVMDSEL------IIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYG 1881
            RVL++ TGGTIGM  +     P+ N F K L  LP+ +D  +   +K  D       + P N  V+P S ++ R+V+ V EY+PLLDS +MT DD+ +IAKDI+  YE YDGF++LHGTDTM++T SALSF+ ENL K ++LTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN PPLA+  + I +    +      + F  +TDM  +V +LR+FP IT  TVKAFL PP+ G+VL TYGSGN P CR DLLE  K+A +R   IIN TQC +G V   Y TG  L   G+ PG D+T EAAL KLSYVL + + N E K+  +  NLRGE+T++ T  +IS       Q      G+    EL      +  +  C+ A +G+   +E I    GN  + DY+G+T LHVA+       V++LL     V   D+ G TPL  AV  R   E+I  LR  GA +     E    E+       D + L+    AG D+     D  T   ++   G
Sbjct:   77 RVLVINTGGTIGMMYQNEVLAPQANAFAKTLKTLPILHDEVYAQQTKLYDF-----HDFPENTLVLPLSKQNKRIVYTVLEYSPLLDSCNMTTDDWAKIAKDIKKYYEQYDGFVVLHGTDTMAYTASALSFMCENLGKTIVLTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFTSPNLPPLANAEVDITINWETVWRANTTKKFHVHTDMNRNVGLLRIFPGITAATVKAFLQPPMEGIVLETYGSGNAPDCRLDLLEELKKATERGVAIINCTQCLRGSVTESYATGKALTVVGVIPGCDLTPEAALAKLSYVLGKDNLNPEEKKRMLFENLRGEMTVSATGAKISLRDSKFIQVVAKSLGVSCKEELEAVRDALTPSLACAAAATGDTYALEAIRDMGGNLSSEDYDGRTPLHVASCDGHYAAVQYLLNNGATVYAKDRFGDTPLMNAVKFR-QLEVIKLLRQTGAHLSWEELEHTGTELCSLASLGDVDGLAAWELAGADMTQAGYDGQTPYQVAEAAG 619          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: aspg (asparaginase [Source:NCBI gene;Acc:100145621])

HSP 1 Score: 413.305 bits (1061), Expect = 1.638e-134
Identity = 231/549 (42.08%), Postives = 317/549 (57.74%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFND--HTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTET--EISREQRSLSQD-----GIVMDSEL------IIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYG 1881
            RVL++ TGGTIGM  +     P+ N F K L  LP+ +D  +   +K  D       + P N  V+P S ++ R+V+ V EY+PLLDS +MT DD+ +IAKDI+  YE YDGF++LHGTDTM++T SALSF+ ENL K ++LTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN PPLA+  + I +    +      + F  +TDM  +V +LR+FP IT  TVKAFL PP+ G+VL TYGSGN P CR DLLE  K+A +R   IIN TQC +G V   Y TG  L   G+ PG D+T EAAL KLSYVL + + N E K+  +  NLRGE+T++ T  +IS       Q      G+    EL      +  +  C+ A +G+   +E I    GN  + DY+G+T LHVA+       V++LL     V   D+ G TPL  AV  R   E+I  LR  GA +     E    E+       D + L+    AG D+     D  T   ++   G
Sbjct:   77 RVLVINTGGTIGMMYQNEVLAPQANAFAKTLKTLPILHDEVYAQQTKLYDF-----HDFPENTLVLPLSKQNKRIVYTVLEYSPLLDSCNMTTDDWAKIAKDIKKYYEQYDGFVVLHGTDTMAYTASALSFMCENLGKTIVLTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFTSPNLPPLANAEVDITINWETVWRANTTKKFHVHTDMNRNVGLLRIFPGITAATVKAFLQPPMEGIVLETYGSGNAPDCRLDLLEELKKATERGVAIINCTQCLRGSVTESYATGKALTVVGVIPGCDLTPEAALAKLSYVLGKDNLNPEEKKRMLFENLRGEMTVSATGAKISLRDSKFIQVVAKSLGVSCKEELEAVRDALTPSLACAAAATGDTYALEAIRDMGGNLSSEDYDGRTPLHVASCDGHYAAVQYLLNNGATVYAKDRFGDTPLMNAVKFR-QLEVIKLLRQTGAHLSWEELEHTGTELCSLASLGDVDGLAAWELAGADMTQAGYDGQTPYQVAEAAG 619          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: aspg (asparaginase [Source:NCBI gene;Acc:100145621])

HSP 1 Score: 405.986 bits (1042), Expect = 9.270e-132
Identity = 232/568 (40.85%), Postives = 324/568 (57.04%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFND--HTVSSKYLDHCCRKSFEIPSNVFVMPR---------SPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTET--EISREQRSLSQD-----GIVMDSEL------IIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNT-FLHLSAIYGRLDFVVELL 1908
            RVL++ TGGTIGM  +     P+ N F K L  LP+ +D  +   +K  D       + P N  V+P          S ++ R+V+ V EY+PLLDS +MT DD+ +IAKDI+  YE YDGF++LHGTDTM++T SALSF+ ENL K ++LTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN PPLA+  + I +    +      + F  +TDM  +V +LR+FP IT  TVKAFL PP+ G+VL TYGSGN P CR DLLE  K+A +R   IIN TQC +G V   Y TG  L   G+ PG D+T EAAL KLSYVL + + N E K+  +  NLRGE+T++ T  +IS       Q      G+    EL      +  +  C+ A +G+   +E I    GN  + DY+G+T LHVA+       V++LL     V   D+ G TPL  AV  R   E+I  LR  GA +     E    E+       D + L+    AG D+     D  T +  + ++Y   ++++  L
Sbjct:   78 RVLVINTGGTIGMMYQNEVLAPQANAFAKTLKTLPILHDEVYAQQTKLYDF-----HDFPENTLVLPAVMLFLIHSLSKQNKRIVYTVLEYSPLLDSCNMTTDDWAKIAKDIKKYYEQYDGFVVLHGTDTMAYTASALSFMCENLGKTIVLTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFTSPNLPPLANAEVDITINWETVWRANTTKKFHVHTDMNRNVGLLRIFPGITAATVKAFLQPPMEGIVLETYGSGNAPDCRLDLLEELKKATERGVAIINCTQCLRGSVTESYATGKALTVVGVIPGCDLTPEAALAKLSYVLGKDNLNPEEKKRMLFENLRGEMTVSATGAKISLRDSKFIQVVAKSLGVSCKEELEAVRDALTPSLACAAAATGDTYALEAIRDMGGNLSSEDYDGRTPLHVASCDGHYAAVQYLLNNGATVYAKDRFGDTPLMNAVKFR-QLEVIKLLRQTGAHLSWEELEHTGTELCSLASLGDVDGLAAWELAGADMTQAGYDGQTPYQVVKSVYQTHNYILYCL 639          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Aspg (asparaginase [Source:MGI Symbol;Acc:MGI:2144822])

HSP 1 Score: 358.992 bits (920), Expect = 8.220e-115
Identity = 206/558 (36.92%), Postives = 315/558 (56.45%), Query Frame = 1
Query:  280 KRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSL------------SQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKA 1914
            +R+L +YTGGTIGMR + G   P        L  L MF+D   +         ++  +P +  V+P +  D R+++ V E  PL DSSDMT+ ++++IA+ I+  Y  Y GF+++HGTDTM+F  S LSF+LENL+KPV+LTG+Q+P+  + SDGRENLL +L++A  Y IPEV LFF   LFR NRT K+ +  F AF SPN PPLA VG  + +    +           ++ M PDV +LR++P I    V+ FL PP++GVV+ T+GSGN P  + DLL+  + A ++  II+N T C +G V + Y +G  +   GI  G DMT EAAL KLSYVL +   ++  ++  + ++LRGE+TL  T++  +   L            SQ+   M  ++++     + A +G++  ++   +   +    DY+G+T LHVAA      VV  LL++   V+  ++ G +PL  AV  R  + +I  LR+ GA++     E +  E+     + D+E L     AG DL   + D +  L ++   G  D VV LL++
Sbjct:    9 RRLLAIYTGGTIGMRSEGGVLVPG-RGLAAVLKTLHMFHDEEYA---------QAHSLPEDTLVLPPASPDQRIIYTVLECQPLFDSSDMTITEWVQIAQTIERHYAQYQGFVVIHGTDTMAFAASVLSFMLENLQKPVVLTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKACGKSHLVVHSSMEPDVGLLRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGP-TKPDLLQELRVAAEQGLIIVNCTHCLQGAVTSDYASGMAMAGAGIVSGFDMTSEAALAKLSYVLGQPGLSLNDRKKLLAKDLRGEMTLPATDVLLQDGMLGCRVAWLLSMNGSQEADTM-KDVLLPGLALAAAHAGDLDTLQAFVELDRDLNLKDYSGQTPLHVAARRGHAAVVTMLLQRGADVDARNEDGQSPLLLAVRGR-HQSVIGLLRAAGARLSPQELEDVGTELCRLASRGDSEGLRAWWQAGADLGQPDYDGHCALQVAEAAGNAD-VVALLQS 552          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Aspg (asparaginase [Source:MGI Symbol;Acc:MGI:2144822])

HSP 1 Score: 130.568 bits (327), Expect = 2.288e-34
Identity = 74/214 (34.58%), Postives = 105/214 (49.07%), Query Frame = 1
Query:  280 KRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISI 921
            +R+L +YTGGTIGMR + G   P        L  L MF+D   +         ++  +P +  V+P +  D R+++ V E  PL DSSDMT+ ++++IA+ I+                                          +P+  + SDGRENLL +L++A  Y IPEV LFF   LFR NRT K+ +  F AF SPN PPLA VG  +
Sbjct:   17 RRLLAIYTGGTIGMRSEGGVLVPG-RGLAAVLKTLHMFHDEEYA---------QAHSLPEDTLVLPPASPDQRIIYTVLECQPLFDSSDMTITEWVQIAQTIE------------------------------------------VPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRTTKVDARRFAAFCSPNLPPLATVGADV 178          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 74.3294 bits (181), Expect = 4.797e-13
Identity = 63/232 (27.16%), Postives = 106/232 (45.69%), Query Frame = 1
Query: 1336 SAMTRNLRGELTLTETEISREQ---RSLSQDGIVMDSELIIG-AALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            S  T N+RGE  L     S +    R L QDG  ++++       L  +A+ G   +V+Q+ ++  +  AA  +G T LH+AA     +V  FLL+    ++   + GFTPL  A       E+   L  K A      K     + +A H D+ ++  LL+D G   +   ++  T LH++A   ++D    LL+ G + +   R    +   A     VD+ +LL + N+
Sbjct:  466 SPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAA-KYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNA 696          

HSP 2 Score: 71.2478 bits (173), Expect = 4.686e-12
Identity = 44/145 (30.34%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1480 GNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLR-CAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLK 1911
            G+V +V Q+     +    +  G+TALH+AA S Q EVVR+L++   QV    +   TPL   A L +   +++ +L  +GA         +  + LA  +   ++ + L+D G  L+I  +   T LH++A YG+L+    LL+
Sbjct:  452 GHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKA--DIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 594          

HSP 3 Score: 70.8626 bits (172), Expect = 5.946e-12
Identity = 59/220 (26.82%), Postives = 93/220 (42.27%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIH-----------------------------KDDTEILSLL--------IDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            AL   +K G+V +V ++ +R  N +AA   G TALH+A+ + Q EVV+ L+     VN   Q GFTPL  A       E++  L   GA   +  ++ F  + +A+                              KDDT+  +LL        +++ + +N   E   T LH++A YG ++    LL          R+D T    A  R   ++  LL
Sbjct:   77 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAA-QENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLL 295          

HSP 4 Score: 63.929 bits (154), Expect = 8.494e-10
Identity = 43/163 (26.38%), Postives = 76/163 (46.63%), Query Frame = 1
Query: 1531 AADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            AA  NG T LH+AA  NQ+++   LLE     N   + G   +  A       +++  L S+ A + ++NK     + LA  +D   +  +L++ G  ++   +   T LH+   YG +  V  LL+   + + K ++  TA  +A  +    I N+L   N+
Sbjct:  634 AAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAA-QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 795          

HSP 5 Score: 63.1586 bits (152), Expect = 1.344e-9
Identity = 41/155 (26.45%), Postives = 70/155 (45.16%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGC 1920
            AL   A  G+  + + +  ++ +  A   NG T LH+A   N+I V+  LL+    +    ++G TP+  A        ++ +L   GA    TN      + +A      E++  L+  G  +    +D  T LH+SA  G+ D V +LL+ G 
Sbjct:  378 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAF-MGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGA 531          

HSP 6 Score: 56.225 bits (134), Expect = 1.695e-7
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query: 1537 DYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            + NG  ALH+A+    +EVV  LL++E  V+   + G T L  A L     E++  L + GA +   ++  F  + +A  ++  E++  L+D G   ++  ED  T L ++   G  D VV LL
Sbjct:   71 NQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASL-AGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGH-DQVVSLL 192          

HSP 7 Score: 55.0694 bits (131), Expect = 4.200e-7
Identity = 44/179 (24.58%), Postives = 76/179 (42.46%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIME-LRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            A  GN+ +   +  R    +    N  T LHVA+      +V+ LL++  +++   + G TPL C    R   E ++E L  + A I+   K     + +A   D    + LL+   + ++ V  D  T LH++A  G       LL      + K  +  T    A  ++R+ +  LL
Sbjct:  251 AHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGA--RSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 427          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 73.9442 bits (180), Expect = 6.261e-13
Identity = 63/232 (27.16%), Postives = 106/232 (45.69%), Query Frame = 1
Query: 1336 SAMTRNLRGELTLTETEISREQ---RSLSQDGIVMDSELIIG-AALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            S  T N+RGE  L     S +    R L QDG  ++++       L  +A+ G   +V+Q+ ++  +  AA  +G T LH+AA     +V  FLL+    ++   + GFTPL  A       E+   L  K A      K     + +A H D+ ++  LL+D G   +   ++  T LH++A   ++D    LL+ G + +   R    +   A     VD+ +LL + N+
Sbjct:  452 SPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAA-KYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNA 682          

HSP 2 Score: 73.1738 bits (178), Expect = 1.127e-12
Identity = 57/212 (26.89%), Postives = 92/212 (43.40%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIH-----------------------------KDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            AL   +K G+V +V ++ +R  N +AA   G TALH+A+ + Q EVV+ L+     VN   Q GFTPL  A       E++  L   GA   +  ++ F  + +A+                              KDDT+  +LL+    + ++ ++   T LH++A YG ++    LL          R+D T    A  R   ++  LL
Sbjct:   71 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAA-QENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLL 281          

HSP 3 Score: 70.0922 bits (170), Expect = 1.049e-11
Identity = 44/145 (30.34%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1480 GNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLR-CAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLK 1911
            G+V +V Q+     +    +  G+TALH+AA S Q EVVR+L++   QV    +   TPL   A L +   +++ +L  +GA         +  + LA  +   ++ + L+D G  L+I  +   T LH++A YG+L+    LL+
Sbjct:  438 GHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKA--DIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 580          

HSP 4 Score: 63.929 bits (154), Expect = 7.647e-10
Identity = 43/164 (26.22%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1528 EAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
             AA  NG T LH+AA  NQ+++   LLE     N   + G   +  A       +++  L S+ A + ++NK     + LA  +D   +  +L++ G  ++   +   T LH+   YG +  V  LL+   + + K ++  TA  +A  +    I N+L   N+
Sbjct:  619 HAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAA-QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 781          

HSP 5 Score: 62.3882 bits (150), Expect = 1.965e-9
Identity = 41/155 (26.45%), Postives = 70/155 (45.16%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGC 1920
            AL   A  G+  + + +  ++ +  A   NG T LH+A   N+I V+  LL+    +    ++G TP+  A        ++ +L   GA    TN      + +A      E++  L+  G  +    +D  T LH+SA  G+ D V +LL+ G 
Sbjct:  364 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAF-MGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGA 517          

HSP 6 Score: 55.8398 bits (133), Expect = 2.053e-7
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query: 1537 DYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            + NG  ALH+A+    +EVV  LL++E  V+   + G T L  A L     E++  L + GA +   ++  F  + +A  ++  E++  L+D G   ++  ED  T L ++   G  D VV LL
Sbjct:   65 NQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASL-AGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGH-DQVVSLL 186          

HSP 7 Score: 55.0694 bits (131), Expect = 4.227e-7
Identity = 44/179 (24.58%), Postives = 76/179 (42.46%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIME-LRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            A  GN+ +   +  R    +    N  T LHVA+      +V+ LL++  +++   + G TPL C    R   E ++E L  + A I+   K     + +A   D    + LL+   + ++ V  D  T LH++A  G       LL      + K  +  T    A  ++R+ +  LL
Sbjct:  237 AHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGA--RSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 413          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 73.9442 bits (180), Expect = 6.384e-13
Identity = 63/232 (27.16%), Postives = 106/232 (45.69%), Query Frame = 1
Query: 1336 SAMTRNLRGELTLTETEISREQ---RSLSQDGIVMDSELIIG-AALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            S  T N+RGE  L     S +    R L QDG  ++++       L  +A+ G   +V+Q+ ++  +  AA  +G T LH+AA     +V  FLL+    ++   + GFTPL  A       E+   L  K A      K     + +A H D+ ++  LL+D G   +   ++  T LH++A   ++D    LL+ G + +   R    +   A     VD+ +LL + N+
Sbjct:  441 SPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAA-KYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNA 671          

HSP 2 Score: 73.1738 bits (178), Expect = 1.129e-12
Identity = 57/212 (26.89%), Postives = 92/212 (43.40%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIH-----------------------------KDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            AL   +K G+V +V ++ +R  N +AA   G TALH+A+ + Q EVV+ L+     VN   Q GFTPL  A       E++  L   GA   +  ++ F  + +A+                              KDDT+  +LL+    + ++ ++   T LH++A YG ++    LL          R+D T    A  R   ++  LL
Sbjct:   60 ALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAA-QENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLL 270          

HSP 3 Score: 70.0922 bits (170), Expect = 9.404e-12
Identity = 44/145 (30.34%), Postives = 75/145 (51.72%), Query Frame = 1
Query: 1480 GNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLR-CAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLK 1911
            G+V +V Q+     +    +  G+TALH+AA S Q EVVR+L++   QV    +   TPL   A L +   +++ +L  +GA         +  + LA  +   ++ + L+D G  L+I  +   T LH++A YG+L+    LL+
Sbjct:  427 GHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKA--DIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQ 569          

HSP 4 Score: 63.5438 bits (153), Expect = 8.827e-10
Identity = 43/163 (26.38%), Postives = 76/163 (46.63%), Query Frame = 1
Query: 1531 AADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            AA  NG T LH+AA  NQ+++   LLE     N   + G   +  A       +++  L S+ A + ++NK     + LA  +D   +  +L++ G  ++   +   T LH+   YG +  V  LL+   + + K ++  TA  +A  +    I N+L   N+
Sbjct:  609 AAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAA-QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNA 770          

HSP 5 Score: 62.7734 bits (151), Expect = 1.865e-9
Identity = 41/155 (26.45%), Postives = 70/155 (45.16%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGC 1920
            AL   A  G+  + + +  ++ +  A   NG T LH+A   N+I V+  LL+    +    ++G TP+  A        ++ +L   GA    TN      + +A      E++  L+  G  +    +D  T LH+SA  G+ D V +LL+ G 
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAF-MGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGA 506          

HSP 6 Score: 55.8398 bits (133), Expect = 2.012e-7
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query: 1537 DYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            + NG  ALH+A+    +EVV  LL++E  V+   + G T L  A L     E++  L + GA +   ++  F  + +A  ++  E++  L+D G   ++  ED  T L ++   G  D VV LL
Sbjct:   54 NQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASL-AGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGH-DQVVSLL 175          

HSP 7 Score: 55.0694 bits (131), Expect = 4.468e-7
Identity = 44/179 (24.58%), Postives = 76/179 (42.46%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIME-LRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            A  GN+ +   +  R    +    N  T LHVA+      +V+ LL++  +++   + G TPL C    R   E ++E L  + A I+   K     + +A   D    + LL+   + ++ V  D  T LH++A  G       LL      + K  +  T    A  ++R+ +  LL
Sbjct:  226 AHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGA--RSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELL 402          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9U518|ASPG_DIRIM (L-asparaginase OS=Dirofilaria immitis OX=6287 PE=1 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 3.974e-144
Identity = 231/539 (42.86%), Postives = 335/539 (62.15%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE-------ISREQRSL---SQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLS 1869
             VL+LYTGGTIGM+  +G Y+PE N+   A+  L + ND    S Y      + + +P      P      RVV+ + EY+PLLDSSDMT DD+I I KDIQ  Y+ Y GF+ILHGTDT+++T  ALSF+LEN++KP+++TG+QIP+ E+RSDGRENL+ +LIIA++YDIPEV ++F+  LFR NRT K+ +   DAF+SPN  P+A + + IKV    +       PF  +  +C +V +LR+FPS++ E V+A L  PI GVVL T+G+GNMP  R D+++  K+A DR CIIIN +QC +G V   Y TG +L + GI PG DMT EAAL KLSYVL++  W +  K++ M +N+RGELT+ + E       +S+  R L   S   + +    I    LC  A +G++ M++ + +   +    DYNG+ ALHVAAS+  +  V++LL + V  +  DQ     L  AV  + ++ LI  LRS GA + + ++ +  E+ L     DTE L+  + AG D+N  + +  T LH++
Sbjct:    7 HVLVLYTGGTIGMKYIDGVYQPEANYLLHAIRDLSLLNDDDYVSTYYSDAEIRPYCLP------PLQHSKKRVVYWMIEYDPLLDSSDMTFDDWIHIGKDIQRAYDQYVGFVILHGTDTLAYTACALSFMLENVRKPIVITGAQIPVCEVRSDGRENLIGALIIAANYDIPEVTVYFNNKLFRGNRTVKIDNRSMDAFESPNMLPIAYMDVDIKVNYDSIFRSPSMAPFVVHDQLCRNVGLLRIFPSMSIENVRASLQAPIEGVVLQTFGAGNMPSHRTDIIDELKKAVDRGCIIINCSQCVRGQVDIHYLTGKVLYDMGIIPGSDMTAEAALTKLSYVLSKDCWELVEKKAMMVKNIRGELTVAKAEPLKDLEIVSQMARFLHLSSSHEMKLLCHAIFPQLLCYAASNGDIEMLKALHENGVDLSVVDYNGRNALHVAASAGHVGAVKYLLTQGVSFHLRDQWDENALVSAVKMK-NKILIETLRSAGALLSINSRRLGVELCLCASYGDTETLNSWLAAGADINQQDYNGETALHIA 538          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O88202|LPP60_RAT (60 kDa lysophospholipase OS=Rattus norvegicus OX=10116 GN=Aspg PE=1 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 7.674e-115
Identity = 210/561 (37.43%), Postives = 311/561 (55.44%), Query Frame = 1
Query:  280 KRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE--------ISREQRSLSQDGIVMDSELI-------IGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKA 1914
            +R+L +YTGGTIGMR + G   P        L  L M +D   +         ++  +P +  V+P +  D R+++ V E  PL DSSDMT+ ++++IA+ I+  Y  Y GF+++HGTDTM+F  S LSF+LENL+KPVILTG+Q+P+ E+ SDGRENLL +L++A  Y IPEV LFF   LFR NRT K+ +  F AF SPN PPLA VG  + +    +           +++M PDV +LR++P I    V+ FL PP++GVV+ T+GSGN P  + DL++  + A +R  II+N T C +G V + Y  G  +   GI  G DMT EAAL KLSYVL +   ++  ++  + ++LRGE+TL  T+          R    LS +G   D++ +       +  A         +    ++G+   +    DY+G+T LHVAA      VV  LL+K V V+  ++ G +PL  AV  R  + +I  LR+ GA +     E +  E+     + D+E L     AG DL   + D +  L ++   G  D VV LL++
Sbjct:    9 QRLLAIYTGGTIGMRSEGGVLVPG-RGLAAVLRTLHMLHDEEYA---------RAHSLPEDTLVLPPASSDQRIIYKVLECQPLFDSSDMTITEWVQIAQTIERHYTQYQGFVVIHGTDTMAFAASVLSFMLENLQKPVILTGAQVPIHELWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKASWKSHLVVHSNMEPDVGLLRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGP-TKPDLIQELRAAAERGLIIVNCTHCLQGAVTSDYAPGMAMAGAGIISGFDMTSEAALAKLSYVLGQPGLSLSDRKKLLAKDLRGEMTLPTTDDLLGDDMLGCRATWLLSMNG-SQDADAMKDVLLPGLALAAAHAGDLDTLQAFVELGR---DLNLKDYSGQTPLHVAARRGHASVVAMLLQKGVDVDACNEDGQSPLLLAVRGR-HQSVIRLLRAAGAHLSPQELEDVGTELCRLASRADSEGLRAWWQAGADLGQPDYDGHCALQVAEAAGNAD-VVALLQS 552          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86U10|LPP60_HUMAN (60 kDa lysophospholipase OS=Homo sapiens OX=9606 GN=ASPG PE=1 SV=3)

HSP 1 Score: 359.762 bits (922), Expect = 4.298e-114
Identity = 210/558 (37.63%), Postives = 308/558 (55.20%), Query Frame = 1
Query:  280 KRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISRE---------------QRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTN-KEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVEL 1905
            +R+L +YTGGTIGMR + G   P        L  LPMF+D        +H   ++  +  +  V+P +  + R+++ V E  PL DSSDMT+ +++ +A+ I+  YE Y GF+++HGTDTM+F  S LSF+LENL+K VILTG+Q+P+  + SDGRENLL +L++A  Y IPEV LFF   LFR NR  K+ +  F AF SPN  PLA VG  I +    +   +       ++ M  DV +LR++P I    V+AFL PP++GVV+ T+GSGN P  + DLL+  + A +R  +I+N T C +G V   Y  G  +   G+  G DMT EAAL KLSYVL +   +++ ++  +T++LRGE+T    E  R                  S SQ+   + + L+   A C+ A +G+V  ++ + +   +    D+NG+T LH AA     E V  LL++ V VN  D  GF+PL  AV  R    +I  LR  GA +     +E   E+    ++ D E L +   AG DL     D ++ LH++   G L  V  L
Sbjct:    9 RRLLAVYTGGTIGMRSELGVLVPGTGL-AAILRTLPMFHDE-------EHA--RARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTDTMAFAASMLSFMLENLQKTVILTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRATKVDARRFAAFCSPNLLPLATVGADITINRELVRKVDGKAGLVVHSSMEQDVGLLRLYPGIPAALVRAFLQPPLKGVVMETFGSGNGP-TKPDLLQELRVATERGLVIVNCTHCLQGAVTTDYAAGMAMAGAGVISGFDMTSEAALAKLSYVLGQPGLSLDVRKELLTKDLRGEMTPPSVEERRPSLQGNTLGGGVSWLLSLSGSQEADALRNALVPSLA-CAAAHAGDVEALQALVELGSDLGLVDFNGQTPLHAAARGGHTEAVTMLLQRGVDVNTRDTDGFSPLLLAVRGR-HPGVIGLLREAGASLSTQELEEAGTELCRLAYRADLEGLQVWWQAGADLGQPGYDGHSALHVAEAAGNLAVVAFL 553          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|A0JNU3|LPP60_MOUSE (60 kDa lysophospholipase OS=Mus musculus OX=10090 GN=Aspg PE=1 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 5.750e-114
Identity = 206/558 (36.92%), Postives = 315/558 (56.45%), Query Frame = 1
Query:  280 KRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSL------------SQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKA 1914
            +R+L +YTGGTIGMR + G   P        L  L MF+D   +         ++  +P +  V+P +  D R+++ V E  PL DSSDMT+ ++++IA+ I+  Y  Y GF+++HGTDTM+F  S LSF+LENL+KPV+LTG+Q+P+  + SDGRENLL +L++A  Y IPEV LFF   LFR NRT K+ +  F AF SPN PPLA VG  + +    +           ++ M PDV +LR++P I    V+ FL PP++GVV+ T+GSGN P  + DLL+  + A ++  II+N T C +G V + Y +G  +   GI  G DMT EAAL KLSYVL +   ++  ++  + ++LRGE+TL  T++  +   L            SQ+   M  ++++     + A +G++  ++   +   +    DY+G+T LHVAA      VV  LL++   V+  ++ G +PL  AV  R  + +I  LR+ GA++     E +  E+     + D+E L     AG DL   + D +  L ++   G  D VV LL++
Sbjct:    9 RRLLAIYTGGTIGMRSEGGVLVPG-RGLAAVLKTLHMFHDEEYA---------QAHSLPEDTLVLPPASPDQRIIYTVLECQPLFDSSDMTITEWVQIAQTIERHYAQYQGFVVIHGTDTMAFAASVLSFMLENLQKPVVLTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKACGKSHLVVHSSMEPDVGLLRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGP-TKPDLLQELRVAAEQGLIIVNCTHCLQGAVTSDYASGMAMAGAGIVSGFDMTSEAALAKLSYVLGQPGLSLNDRKKLLAKDLRGEMTLPATDVLLQDGMLGCRVAWLLSMNGSQEADTM-KDVLLPGLALAAAHAGDLDTLQAFVELDRDLNLKDYSGQTPLHVAARRGHAAVVTMLLQRGADVDARNEDGQSPLLLAVRGR-HQSVIGLLRAAGARLSPQELEDVGTELCRLASRGDSEGLRAWWQAGADLGQPDYDGHCALQVAEAAGNAD-VVALLQS 552          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P0A962|ASPG1_ECOLI (L-asparaginase 1 OS=Escherichia coli (strain K12) OX=83333 GN=ansA PE=1 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 1.222e-90
Identity = 159/368 (43.21%), Postives = 219/368 (59.51%), Query Frame = 1
Query:  280 KRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRL---LMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVK-AIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELT 1371
            K + + YTGGTIGM++ E  Y P      + L  +P F+                          P  P+     F + EY PL+DSSDMT +D+  IA+DI+  Y++YDGF+ILHGTDTM++T SALSF+LENL KPVI+TGSQIPL E+RSDG+ NLL +L +A++Y I EV LFF+  L+R NRT K  +  FDAF SPN PPL + GI I+    RL     P        +      + V+ ++P I+ + V+ FL  P++ ++L +YG GN P   K  L+  +EA DR  +++N+TQC  G V    Y TG  L   G+  G DMT+EA L KL Y+L++ + + ET R AM++NLRGELT
Sbjct:    4 KSIYVAYTGGTIGMQRSEQGYIPVSGHLQRQLALMPEFH-------------------------RPEMPD-----FTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTTKAHADGFDAFASPNLPPLLEAGIHIR----RLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAP-QNKAFLQELQEASDRGIVVVNLTQCMSGKVNMGGYATGNALAHAGVIGGADMTVEATLTKLHYLLSQ-ELDTETIRKAMSQNLRGELT 335          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JHK6 (L-asparaginase-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106173329 PE=4 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 2.208e-160
Identity = 260/633 (41.07%), Postives = 387/633 (61.14%), Query Frame = 1
Query:  166 FEFKS--IDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLD-HCCRKSFEIPS----NVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE-----------ISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSN 2010
            FE KS  +D  Y+PK +   +  ++ + DLN      R   RVL+LYTGGTIGMR  +G Y PEPNF    L KL +F+D     +YLD H      + P+    +   MP S E   V++ V+EY PLLDS +MTMDD+ RIA DI+T YE++DGF+ILHGTDTM++T SALSF+ ENL KP+ILTGSQIP+FEIRSDGR+NLL +LI+A +Y IPEV +FF+  L R NR+ K  S  FDAF SPN+PPLA +   I V+   +      Q    YT++CP V +LR+FPS+T  TV+ FLAPP++G+VL +YG+GN P  R+DL+++F EA  R  +++N TQC +G V   Y TG  L + G+ PG DMT EAAL KL++V+ R DW++E KR  +++N+RGEL    TE           + +  +  S++ +    + I  + +C+ A++G++A++++I K  G+    DY+G++ LH+A       +V++LL+    V+  D  G +PL   V+     ++I  L   GA +++   ++  E+ ++  +DD + L     +G +L+  + D  T LH++A +G  D V  LL+ G   + ++R   T   EA  +   +I  L+S+
Sbjct:   13 FEGKSFSMDPSYRPKKLKTTDT-EVKSTDLNY-----RRESRVLVLYTGGTIGMRIHDGVYTPEPNFLVNELRKLSIFHDQ----EYLDKHSICYGGQTPTPWMQSPLCMPLSKEKKNVIYCVYEYEPLLDSCNMTMDDWARIASDIKTYYEDFDGFVILHGTDTMAYTASALSFMFENLGKPIILTGSQIPIFEIRSDGRDNLLGALIMAGNYCIPEVMIFFNNKLLRGNRSIKFDSSSFDAFHSPNFPPLAVLETKIHVHWDEIFTSNTTQKCTLYTNLCPSVGLLRLFPSVTTATVRQFLAPPLKGMVLESYGAGNAPDSREDLMQVFSEATKRGVLLLNTTQCHRGSVNPSYATGKALTDAGVIPGSDMTPEAALTKLAFVIGREDWSLEQKRKKLSQNIRGELKTARTESLVSDFKLIDSLGKLMKISSKEEMQTLKDAIFPSLMCTAAQNGDLAVLQKIRKAGGHIGMVDYSGRSPLHIACGKGHFHIVQYLLQHGAPVHVRDNNGRSPLY-EVVKLKHLDIIRLLVQTGAHLVLPPYKLGSELCMSAAQDDVDSLKAWALSGANLSQSDYDGRTALHVAASHGHQDSVEFLLEQGVSVTAEDRFGYTPLKEATAKGHREISKLISD 634          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JJ11 (L-asparaginase-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106173329 PE=4 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 6.286e-160
Identity = 259/632 (40.98%), Postives = 387/632 (61.23%), Query Frame = 1
Query:  166 FEFK-SIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLD-HCCRKSFEIPS----NVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE-----------ISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSN 2010
            FE K S+D  Y+PK +   +  ++ + DLN      +   RVL+LYTGGTIGMR  +G Y PEPNF    L KL +F+D     +YLD H      + P+    +   MP S E   V++ V+EY PLLDS +MTMDD+ RIA DI+T YE++DGF+ILHGTDTM++T SALSF+ ENL KP+ILTGSQIP+FEIRSDGR+NLL +LI+A +Y IPEV +FF+  L R NR+ K  S  FDAF SPN+PPLA +   I V+   +      Q    YT++CP V +LR+FPS+T  TV+ FLAPP++G+VL +YG+GN P  R+DL+++F EA  R  +++N TQC +G V   Y TG  L + G+ PG DMT EAAL KL++V+ R DW++E KR  +++N+RGEL    TE           + +  +  S++ +    + I  + +C+ A++G++A++++I K  G+    DY+G++ LH+A       +V++LL+    V+  D  G +PL   V+     ++I  L   GA +++   ++  E+ ++  +DD + L     +G +L+  + D  T LH++A +G  D V  LL+ G   + ++R   T   EA  +   +I  L+S+
Sbjct:   14 FEGKTSMDPSYRPKKLKTTDT-EVKSTDLNY-----KHESRVLVLYTGGTIGMRIHDGVYTPEPNFLVNELRKLSIFHDQ----EYLDKHSICYGGQTPTPWMQSPLCMPLSKEKKNVIYCVYEYEPLLDSCNMTMDDWARIASDIKTYYEDFDGFVILHGTDTMAYTASALSFMFENLGKPIILTGSQIPIFEIRSDGRDNLLGALIMAGNYCIPEVMIFFNNKLLRGNRSIKFDSSSFDAFHSPNFPPLAVLETKIHVHWDEIFTSNTTQKCTLYTNLCPSVGLLRLFPSVTTATVRQFLAPPLKGMVLESYGAGNAPDSREDLMQVFSEATKRGVLLLNTTQCHRGSVNPSYATGKALTDAGVIPGSDMTPEAALTKLAFVIGREDWSLEQKRKKLSQNIRGELKTARTESLVSDFKLIDSLGKLMKISSKEEMQTLKDAIFPSLMCTAAQNGDLAVLQKIRKAGGHIGMVDYSGRSPLHIACGKGHFHIVQYLLQHGAPVHVRDNNGRSPLY-EVVKLKHLDIIRLLVQTGAHLVLPPYKLGSELCMSAAQDDVDSLKAWALSGANLSQSDYDGRTALHVAASHGHQDSVEFLLEQGVSVTAEDRFGYTPLKEATAKGHREISKLISD 634          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JHQ1 (L-asparaginase-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106173329 PE=4 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 2.376e-158
Identity = 256/625 (40.96%), Postives = 381/625 (60.96%), Query Frame = 1
Query:  184 DKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLD-HCCRKSFEIPS----NVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE-----------ISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSN 2010
            D  Y+PK +   +  +L + DLN      +   RVL+LYTGGTIGMR   G Y PEPNF    L KL +F+D     +YLD H      + P+    +   MP S E   V++ V+EY PLLDS +MTMDD+ RIA DI+T YE++DGF+ILHGTDTM++T SALSF+ ENL KP+ILTGSQIP+FEIRSDGR+NLL +LI+A +Y IPEV +FF+  L R NR+ K  S  FDAF SPN+PPLA +   I V+   +      Q    YT++CP V +LR+FPS+T  TV+ FLAPP++G+VL +YG+GN P  R+DL+++F EA  R  +++N TQC +G V   Y TG  L + G+ PG DMT EAAL KL++V+ R DW++E KR  +++N+RGEL    TE           + +  +  S++ +    + I  + +C+ A++G++A++++I K  G+    DY+G++ LH+A       +V++LL+    V+  D  G +PL   V+     ++I  L   GA +++   ++  E+ ++  +DD + L     +G +L+  + D  T LH++A +G  D V  LL+ G   + ++R   T   EA  +   +I  L+S+
Sbjct:   66 DPSYRPKKLKTTDT-ELKSTDLNY-----KRESRVLVLYTGGTIGMRIHGGVYTPEPNFLVNELRKLSIFHDQ----EYLDKHSICYGGQTPTPWMQSPLCMPLSKEKKNVIYCVYEYEPLLDSCNMTMDDWARIASDIKTYYEDFDGFVILHGTDTMAYTASALSFMFENLGKPIILTGSQIPIFEIRSDGRDNLLGALIMAGNYCIPEVMIFFNNKLLRGNRSIKFDSSSFDAFHSPNFPPLAVLETKIHVHWDEIFTSNTTQKCTLYTNLCPSVGLLRLFPSVTTATVRQFLAPPLKGMVLESYGAGNAPDSREDLMQVFSEATKRGVLLLNTTQCHRGSVNPSYATGKALTDAGVIPGSDMTPEAALTKLAFVIGREDWSLEQKRKKLSQNIRGELKTARTESLVSDFKLIDSLGKLMKISSKEEMQTLKDAIFPSLMCTAAQNGDLAVLQKIRKAGGHIGMVDYSGRSPLHIACGKGHFHIVQYLLQHGAPVHVRDNNGRSPLY-EVVKLKHLDIIRLLVQTGAHLVLPPYKLGSELCMSAAQDDVDSLKAWALSGANLSQSDYDGRTALHVAASHGHQDSVEFLLEQGVSVTAEDRFGYTPLKEATAKGHREISKLISD 679          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JHG6 (L-asparaginase-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106173312 PE=4 SV=1)

HSP 1 Score: 481.485 bits (1238), Expect = 1.259e-157
Identity = 258/625 (41.28%), Postives = 379/625 (60.64%), Query Frame = 1
Query:  178 SIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYL-DHCCRKSFEIPS----NVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE-----------ISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            SID  YKPK +        S  +L  +D   +   RVL+LYTGGTIGM   +G Y PEPNF    L KL +F+D     +YL  H      + P+    +   MP S E   VV+ V+EY PLLDSS+MTMDD+ RIA DI+T YE++DGF+ILHGTDTM++T SALSF+ ENL KP+ILTGSQIP+FE RSDGR+NLL +LI+A +Y IPEV +FF+  L R NR+ K  S  FDAF SPN+PPLA +   I V    +      Q    YT++CP V +LR+FPSIT  TV+ FLAPP++G+VL +YG+GN P  RKDL+++F EA +R  +++NITQC +G V   Y TG  L + G+ PG DMT EAAL KL++V+ R DW+ E KR  +++N+RGEL    TE           + +  +  S++ +    + I  + +C+ A++G++A++++I +  G+    DY+G++ LH+A       +V++LL+    ++  D  G +PL  AV  +   +++  L   GA +++   ++  E+ L+  +DD + L     +G +L+  + D  T LH++A +G  D V  LL+ G   + ++R   T   EA  +   +I  L+
Sbjct:   25 SIDPSYKPKKL------KTSDTELKSIDLDYKHESRVLVLYTGGTIGMCIHDGVYTPEPNFLVSELRKLSIFHDQ----EYLVKHSICDGGQTPTPWMQSPLCMPLSKEKKNVVYCVYEYEPLLDSSNMTMDDWARIASDIKTYYEDFDGFVILHGTDTMAYTASALSFMFENLGKPIILTGSQIPIFETRSDGRDNLLGALIMAGNYCIPEVMIFFNNKLLRGNRSTKFDSSSFDAFHSPNFPPLAVLETKIHVDWDEIFTSNTTQKCTLYTNLCPSVGLLRLFPSITTATVRQFLAPPLKGMVLESYGAGNAPDSRKDLMQVFSEATERGVLLLNITQCHRGSVNPSYATGKALIDAGVIPGSDMTPEAALTKLAFVIGREDWSSEHKRKKLSQNIRGELKTARTESLVSDFKLIDSLGKLMKISSKEEMQTLKDAIFPSLMCTAAQNGDLAVLQKIREGGGHIGMVDYSGRSPLHIACGKGHFHIVQYLLQHGAPLHVRDNNGRSPLYDAVKLK-HLDIVRLLVQTGAHLVLPPYKLGSELCLSAAQDDVDSLKAWALSGANLSQGDYDGRTALHVAASHGHQDSVEFLLEQGVSVTAEDRFGYTPLKEATAKGHREISKLI 638          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JID1 (L-asparaginase-like OS=Lingula unguis OX=7574 GN=LOC106173330 PE=4 SV=1)

HSP 1 Score: 479.945 bits (1234), Expect = 8.956e-157
Identity = 260/631 (41.20%), Postives = 382/631 (60.54%), Query Frame = 1
Query:  166 FEFKS--IDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYL-DHCCRKSFEIPS----NVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETE-----------ISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            FE KS  ID  YKPK +        S  +L  +D   +   RVL LYTGGTIGM   +G Y PEPNF    L KL +F+D     +YL  H      + P+    +   MP S E   VV+ V+EY PLLDSS+MTMDD+ RIA DI+T YE++DGF+ILHGTDTM++T SALSF+ ENL KP+ILTGSQIP+FE RSDGR+NLL +LI+A +Y IPEV +FF+  L R NR+ K  S  FDAF SPN+PPLA +   I V    +      Q    +T++CP V +LR+FPSIT  TV+ FLAPP++G+VL +YG+GN P  RKDL+++F EA +R  +++NITQC +G V   Y TG  L + G+ PG DMT EAAL KL++V+ R DW++E KR  +++N+RGEL    TE           + +  +  S++ +    + I  + +C+ A++G++A++++I +  G+    DY+G++ LH+A       +V++LL+    ++  D  G +PL  AV  +   +++  L   GA +++   ++  E+ L+  +DD + L     +G +L+  + D  T LH++A +G  D V  LL+ G   + ++R   T   EA  +   +I  L+
Sbjct:   44 FEGKSFSIDPSYKPKKL------KTSDTELKSIDLDYKHESRVLALYTGGTIGMCIHDGVYTPEPNFLVSELRKLSIFHDQ----EYLVKHSICDGGQTPTPWMQSPLCMPLSKEKKNVVYCVYEYEPLLDSSNMTMDDWARIASDIKTYYEDFDGFVILHGTDTMAYTASALSFMFENLGKPIILTGSQIPIFETRSDGRDNLLGALIMAGNYCIPEVMIFFNNKLLRGNRSTKFDSSSFDAFHSPNFPPLAVLETKIHVDWDEIFTSNTTQKCTLHTNLCPSVGLLRLFPSITTATVRQFLAPPLKGMVLESYGAGNAPDSRKDLMQVFSEATERGVLLLNITQCHRGSVNPSYATGKALIDAGVIPGSDMTPEAALTKLAFVIGREDWSLEHKRKKLSQNIRGELKTARTESLVSDFKLIDSLGKLMKISSKEEMQTLKDAIFPSLMCTAAQNGDLAVLQKIREGGGHIGMVDYSGRSPLHIACGKGHFHIVQYLLQHGAPLHVRDNNGRSPLYDAVKLK-HLDIVRLLVQTGAHLVLPPYKLGSELCLSAAQDDVDSLKAWALSGANLSQGDYDGRTALHVAASHGHQDSVEFLLEQGVSVTAEDRFGYTPLKEATAKGHREISKLI 663          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: aspg (asparaginase [Source:NCBI gene;Acc:103038278])

HSP 1 Score: 419.853 bits (1078), Expect = 3.268e-137
Identity = 235/566 (41.52%), Postives = 338/566 (59.72%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKN 1938
            RVL++ TGGTIGM        PEPN   KAL KLP+ +D   + +   +   + +E   N  V+P S ++ R+++ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ E+L KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN P LA+  + IK+    +        F+  T M  +V +LR+FP IT ETV+AFL PP+ G+VL TYGSGN P  R DLLE F++A +R  I++N TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ +   + KR  ++RNLRGE         LTL+++  I    +SLS   ++ +    + +     C+ AK G++  +E I +   N   ADY+G+T LH+AA    +++V++LL +   V   D+ G TPLR A+  R  ++++  LR  GA +     E    E+       D E L L   AG D+ + +      + + AI    D VV+ L+   +   +N
Sbjct:   75 RVLVINTGGTIGMMYHNNVLCPEPNALVKALRKLPILHDEQYAQQTRLY---EFYEHAENTLVLPLSKQNKRIMYTVIEYSPLLDSCNMTTDDWATIGKDIEKHYEKYDGFVILHGTDTMAYTASALSFMCEHLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFSSPNLPALANAEVDIKINWDTVWRANTTVKFRINTQMNRNVGLLRLFPGITAETVRAFLQPPMEGIVLETYGSGNAPDNRADLLEEFRKATERGVIMVNCTQCLRGSVTTSYATGKALSDAGLVAGCDMTPEAALSKLSYVLAKKELTTQEKRKMLSRNLRGEMIADLEGAKLTLSDSRFIQVIAKSLSISCKEELEAIRDALCPTLACAAAKIGDIEALEAIREMGSNLSMADYDGRTPLHIAACEGHLKLVQYLLGQGATVYAKDRYGDTPLRNAIRFR-YKDIVKLLRKTGAHLSWDEMEDAGTELCRLAACGDLEGLELWHLAGADVTMSSYSGQLPIEM-AIQSGTDEVVQFLQWAAQYRTQN 635          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: aspg (asparaginase [Source:NCBI gene;Acc:103038278])

HSP 1 Score: 419.853 bits (1078), Expect = 3.307e-137
Identity = 236/578 (40.83%), Postives = 343/578 (59.34%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFV 1974
            RVL++ TGGTIGM        PEPN   KAL KLP+ +D   + +   +   + +E   N  V+P S ++ R+++ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ E+L KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN P LA+  + IK+    +        F+  T M  +V +LR+FP IT ETV+AFL PP+ G+VL TYGSGN P  R DLLE F++A +R  I++N TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ +   + KR  ++RNLRGE         LTL+++  I    +SLS   ++ +    + +     C+ AK G++  +E I +   N   ADY+G+T LH+AA    +++V++LL +   V   D+ G TPLR A+  R  ++++  LR  GA +     E    E+       D E L L   AG D+ + +      + + AI    D VV+ L+   +   +++ D    +  F+
Sbjct:   75 RVLVINTGGTIGMMYHNNVLCPEPNALVKALRKLPILHDEQYAQQTRLY---EFYEHAENTLVLPLSKQNKRIMYTVIEYSPLLDSCNMTTDDWATIGKDIEKHYEKYDGFVILHGTDTMAYTASALSFMCEHLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFSSPNLPALANAEVDIKINWDTVWRANTTVKFRINTQMNRNVGLLRLFPGITAETVRAFLQPPMEGIVLETYGSGNAPDNRADLLEEFRKATERGVIMVNCTQCLRGSVTTSYATGKALSDAGLVAGCDMTPEAALSKLSYVLAKKELTTQEKRKMLSRNLRGEMIADLEGAKLTLSDSRFIQVIAKSLSISCKEELEAIRDALCPTLACAAAKIGDIEALEAIREMGSNLSMADYDGRTPLHIAACEGHLKLVQYLLGQGATVYAKDRYGDTPLRNAIRFR-YKDIVKLLRKTGAHLSWDEMEDAGTELCRLAACGDLEGLELWHLAGADVTMSSYSGQLPIEM-AIQSGTDEVVQFLQWAAQYRTQHQTDEFNENGEFI 647          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: aspg (asparaginase [Source:NCBI gene;Acc:103038278])

HSP 1 Score: 419.083 bits (1076), Expect = 1.176e-136
Identity = 238/589 (40.41%), Postives = 348/589 (59.08%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDI-CNLL 2004
            RVL++ TGGTIGM        PEPN   KAL KLP+ +D   + +   +   + +E   N  V+P S ++ R+++ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ E+L KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN P LA+  + IK+    +        F+  T M  +V +LR+FP IT ETV+AFL PP+ G+VL TYGSGN P  R DLLE F++A +R  I++N TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ +   + KR  ++RNLRGE         LTL+++  I    +SLS   ++ +    + +     C+ AK G++  +E I +   N   ADY+G+T LH+AA    +++V++LL +   V   D+ G TPLR A+  R  ++++  LR  GA +     E    E+       D E L L   AG D+ + +      + + AI    D VV+ L+   +   + +H    ++E    +  ++ C L+
Sbjct:   75 RVLVINTGGTIGMMYHNNVLCPEPNALVKALRKLPILHDEQYAQQTRLY---EFYEHAENTLVLPLSKQNKRIMYTVIEYSPLLDSCNMTTDDWATIGKDIEKHYEKYDGFVILHGTDTMAYTASALSFMCEHLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFSSPNLPALANAEVDIKINWDTVWRANTTVKFRINTQMNRNVGLLRLFPGITAETVRAFLQPPMEGIVLETYGSGNAPDNRADLLEEFRKATERGVIMVNCTQCLRGSVTTSYATGKALSDAGLVAGCDMTPEAALSKLSYVLAKKELTTQEKRKMLSRNLRGEMIADLEGAKLTLSDSRFIQVIAKSLSISCKEELEAIRDALCPTLACAAAKIGDIEALEAIREMGSNLSMADYDGRTPLHIAACEGHLKLVQYLLGQGATVYAKDRYGDTPLRNAIRFR-YKDIVKLLRKTGAHLSWDEMEDAGTELCRLAACGDLEGLELWHLAGADVTMSSYSGQLPIEM-AIQSGTDEVVQFLQWAAQ--YRTQHQTDEFNEPVFDENEEVHCGLV 656          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: aspg (asparaginase [Source:NCBI gene;Acc:103038278])

HSP 1 Score: 418.313 bits (1074), Expect = 1.631e-136
Identity = 236/578 (40.83%), Postives = 341/578 (59.00%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFV 1974
            RVL++ TGGTIGM        PEPN   KAL KLP+ +D   + +   +   + +E   N  V+P S ++ R+++ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ E+L KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN P LA+  + IK+    +        F+  T M  +V +LR+FP IT ETV+AFL PP+ G+VL TYGSGN P  R DLLE F++A +R  I++N TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ +   + KR  ++RNLRGE         LTL+++  I    +SLS   ++ +    + +     C+ AK G++  +E I +   N   ADY+G+T LH+AA    +++V++LL +   V   D+ G TPLR A+  R  ++++  LR  GA +     E    E+       D E L L   AG D+ + +      + + AI    D VV+ L+   +   +   D    +  F+
Sbjct:   75 RVLVINTGGTIGMMYHNNVLCPEPNALVKALRKLPILHDEQYAQQTRLY---EFYEHAENTLVLPLSKQNKRIMYTVIEYSPLLDSCNMTTDDWATIGKDIEKHYEKYDGFVILHGTDTMAYTASALSFMCEHLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFSSPNLPALANAEVDIKINWDTVWRANTTVKFRINTQMNRNVGLLRLFPGITAETVRAFLQPPMEGIVLETYGSGNAPDNRADLLEEFRKATERGVIMVNCTQCLRGSVTTSYATGKALSDAGLVAGCDMTPEAALSKLSYVLAKKELTTQEKRKMLSRNLRGEMIADLEGAKLTLSDSRFIQVIAKSLSISCKEELEAIRDALCPTLACAAAKIGDIEALEAIREMGSNLSMADYDGRTPLHIAACEGHLKLVQYLLGQGATVYAKDRYGDTPLRNAIRFR-YKDIVKLLRKTGAHLSWDEMEDAGTELCRLAACGDLEGLELWHLAGADVTMSSYSGQLPIEM-AIQSGTDEVVQFLQWAAQYRTQPVFDENEENGEFI 647          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: aspg (asparaginase [Source:NCBI gene;Acc:103038278])

HSP 1 Score: 416.387 bits (1069), Expect = 3.443e-136
Identity = 228/531 (42.94%), Postives = 324/531 (61.02%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKE-IFDEITLAIHKDDTEILSLLIDAGIDLNI 1833
            RVL++ TGGTIGM        PEPN   KAL KLP+ +D   + +   +   + +E   N  V+P S ++ R+++ V EY+PLLDS +MT DD+  I KDI+  YE YDGF+ILHGTDTM++T SALSF+ E+L KPVILTGSQ+P++E+R+DGR+NLL +L+IA  + IPEV L+FH  L+R NR  K+ +  F+AF SPN P LA+  + IK+    +        F+  T M  +V +LR+FP IT ETV+AFL PP+ G+VL TYGSGN P  R DLLE F++A +R  I++N TQC +G V   Y TG  L + G+  G DMT EAAL+KLSYVLA+ +   + KR  ++RNLRGE         LTL+++  I    +SLS   ++ +    + +     C+ AK G++  +E I +   N   ADY+G+T LH+AA    +++V++LL +   V   D+ G TPLR A+  R  ++++  LR  GA +     E    E+       D E L L   AG D+ +
Sbjct:   75 RVLVINTGGTIGMMYHNNVLCPEPNALVKALRKLPILHDEQYAQQTRLY---EFYEHAENTLVLPLSKQNKRIMYTVIEYSPLLDSCNMTTDDWATIGKDIEKHYEKYDGFVILHGTDTMAYTASALSFMCEHLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKVDAGSFNAFSSPNLPALANAEVDIKINWDTVWRANTTVKFRINTQMNRNVGLLRLFPGITAETVRAFLQPPMEGIVLETYGSGNAPDNRADLLEEFRKATERGVIMVNCTQCLRGSVTTSYATGKALSDAGLVAGCDMTPEAALSKLSYVLAKKELTTQEKRKMLSRNLRGEMIADLEGAKLTLSDSRFIQVIAKSLSISCKEELEAIRDALCPTLACAAAKIGDIEALEAIREMGSNLSMADYDGRTPLHIAACEGHLKLVQYLLGQGATVYAKDRYGDTPLRNAIRFR-YKDIVKLLRKTGAHLSWDEMEDAGTELCRLAACGDLEGLELWHLAGADVTM 601          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: anks1b (ankyrin repeat and sterile alpha motif domain containing 1B [Source:NCBI gene;Acc:565408])

HSP 1 Score: 68.1662 bits (165), Expect = 5.715e-12
Identity = 46/152 (30.26%), Postives = 77/152 (50.66%), Query Frame = 1
Query: 1507 GKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYD 1962
            G  R      +++ +TALH AA      VVR LLE+       +    TPL  A L     +++  L      ++  N +    + LA     T  + +L++AG+D+NI +E K + LH +A++GR+D V  LL+AG   +++++   TA D
Sbjct:  113 GPSRSPPNQQNHDNETALHCAAQYGHTAVVRLLLEELTDPTMRNARFETPLDLAAL-YGRLDVVTLLTRSHPNLLACNTKQHTPLHLAARNGHTGTVQVLLEAGMDVNIQSE-KGSALHEAALFGRVDVVRLLLEAGINVNIRDKQSKTALD 262          

HSP 2 Score: 65.4698 bits (158), Expect = 3.995e-11
Identity = 56/190 (29.47%), Postives = 88/190 (46.32%), Query Frame = 1
Query: 1459 LCSNAKSGNVAMVEQI-GKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLE---KEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDL---NIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLS 2007
            L   A++GNVA VE++   RRG                  S  ++ +  LL    +   VNC D +G+TPL  A LN   +E+++ L    A   + + +    + LA  + D +I+ +LI+ G      N  N D  T LH +A YG    V  LL+   + +M+N    T  D A +  R+D+  LL+
Sbjct:    7 LLEAARTGNVAAVEKLLASRRG----------------LGSATVQALPGLLTSIWRGPAVNCVDSSGYTPLHHAALN-GHKEVVLRLLQHEASTNVADAKGCFPLHLAAWRGDADIVRILIEHGPSRSPPNQQNHDNETALHCAAQYGHTAVVRLLLEELTDPTMRNARFETPLDLAALYGRLDVVTLLT 179          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 7.551e-12
Identity = 56/212 (26.42%), Postives = 90/212 (42.45%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIH-----------------------------KDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            AL   +K G+V +V ++ KR    + A   G TALH+AA + Q ++VR L+E    +N   Q GFTPL  A       E++  L   GA   +  ++ F  + +A+                              KDDT   +LL+    + ++ ++   T LH++A YG ++    LL  G       R+  T    A  R   ++  LL
Sbjct:   47 ALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAA-QENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLL 257          

HSP 2 Score: 63.1586 bits (152), Expect = 1.541e-10
Identity = 44/154 (28.57%), Postives = 69/154 (44.81%), Query Frame = 1
Query: 1543 NGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            NG T LH+AA  NQ+EV + LLE   + N   Q G  PL  A       +++  L  + A I +  K     + LA  +D   +  +L     D+N   +   T LH+++ YG +  V  LL+     + K R+  T   +A  +    + N L
Sbjct:  602 NGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAA-QEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNAL 754          

HSP 3 Score: 56.6102 bits (135), Expect = 1.538e-8
Identity = 45/174 (25.86%), Postives = 83/174 (47.70%), Query Frame = 1
Query: 1480 GNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSR-ELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL--------KAGCETSMKNRHDNTAYDEAFV 1974
            G++ +V+ + +   +  A +  G+T LH+A+ + Q+EVV+ LL+   +V    +   TPL  A  +R  + E++  L  +G+            +  A  +   ++ SLL++ G D++ V +   T LH+++ YGRL+    LL        K   +  +   H  T YD   V
Sbjct:  414 GHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIA--SRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKV 585          

HSP 4 Score: 53.5286 bits (127), Expect = 1.789e-7
Identity = 40/164 (24.39%), Postives = 72/164 (43.90%), Query Frame = 1
Query: 1513 RRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            R G   A   NG T LH+A   N+I+V+  LL+    ++   ++G TP+  A        ++  L   GA    TN      + +A      E++  L+ +G  + +   +  T LH+++  G+ + V  LL+ G + +      +T    A      D+ +LL
Sbjct:  359 RGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASF-MGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLL 521          

HSP 5 Score: 53.1434 bits (126), Expect = 2.016e-7
Identity = 43/155 (27.74%), Postives = 71/155 (45.81%), Query Frame = 1
Query: 1543 NGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIME-LRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            NG T LHVAA      +V+ LL++  +++   + G TPL CA   R   E ++E L  + A I+   K     + +A   +    + LL+     ++ V  D  T LH++A  G       LL  G E + +  +  T    A  ++R+ +  LL
Sbjct:  237 NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAA--RSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELL 389          

HSP 6 Score: 51.6026 bits (122), Expect = 6.727e-7
Identity = 39/148 (26.35%), Postives = 73/148 (49.32%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKA 1914
            A++GN+  +    K   +    + NG  ALH+A+    ++VV  LL++E +++   + G T L  A L     +++  L   GA I   ++  F  + +A  ++  EI+  L+D G + ++  ED  T L ++   G    V  LL++
Sbjct:   19 ARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAAL-AGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES 165          

HSP 7 Score: 48.9062 bits (115), Expect = 3.650e-6
Identity = 42/176 (23.86%), Postives = 75/176 (42.61%), Query Frame = 1
Query: 1480 GNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAV-LNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            G   +V+ + +R  +  A   +G T L+ A+     +V   LLE    ++   + GFTPL  A    R     ++  +   A   +  +     + +A H D  ++  LL+D G   +   ++  T LH++A   +L+    LL+ G ET+M  +        A      D+  LL
Sbjct:  480 GKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALL 655          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.506e-11
Identity = 70/266 (26.32%), Postives = 115/266 (43.23%), Query Frame = 1
Query: 1228 LKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTL------TETEISREQRSLSQDGIVMDSELII-GAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            + E G+ P   M + A +  L+ VL      ++   S    N+RGE  L       +TE+ R   SL ++G  +D++       L   A+ G + +V+ + +   + +AA  NG T LHVAA     +V   LLE    +    + GFTPL  A       E+   L  + A      K     + +A H D+ ++  LL+D G   +   ++  T LH++A   +L+    LL+ G ET+   R               D+ +LL
Sbjct:   44 VTESGLTP---MHVSAFMGNLNIVLIL----LQGGASPNATNVRGETALHMAARAGQTEVVR---SLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVAS-KYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLL 298          

HSP 2 Score: 57.3806 bits (137), Expect = 9.976e-9
Identity = 43/188 (22.87%), Postives = 82/188 (43.62%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            AL   A++G   +V  + +     +A     +T LH+AA   ++E+V+ LL+     +     G+TPL  A       ++   L   GA + +T K+ F  + +A      E+ SLL+      +   ++  T LH+++ Y      + LL  G       ++  T    A  +D+++I   L  + +
Sbjct:   84 ALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAA-REGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGA 270          

HSP 3 Score: 52.373 bits (124), Expect = 3.521e-7
Identity = 49/194 (25.26%), Postives = 88/194 (45.36%), Query Frame = 1
Query: 1363 ELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDF--VVELLKAGCETSMKN 1938
            E+  T  E   E  ++++ G+         A L   A+ G+  +   +  R  +   A  +G + LH+AA  +++ V   L++    VN   + G+TPL  A  +  + +++  L   GA +    K  +  +  A  +  T I++LL+  G   N V  + NT L   AI  RL +  VV+ LK   E ++ +
Sbjct:  260 EIATTLLEYGAETNAITRQGV---------APLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVAC-HYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTAL---AIARRLGYISVVDTLKVVTEETITS 440          

HSP 4 Score: 52.373 bits (124), Expect = 4.320e-7
Identity = 38/139 (27.34%), Postives = 63/139 (45.32%), Query Frame = 1
Query: 1543 NGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSK-GAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTA 1956
             G   LH+ A     +V   LL +   VN   ++G +PL  A      +  + E+  K GA +  T K  +  + +A H  + ++++ L+  G D+N   ++  T LH +A  G    V  LLK G   +    + NTA
Sbjct:  278 QGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQE--DKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTA 414          

HSP 5 Score: 51.2174 bits (121), Expect = 7.647e-7
Identity = 33/123 (26.83%), Postives = 60/123 (48.78%), Query Frame = 1
Query: 1543 NGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLK 1911
            NG T LH+A   N+I V+  LL+    +    ++G TP+  +     +  +++ L   GA    TN      + +A     TE++  L+  G  ++    ++ T LH++A  G+L+ V  LL+
Sbjct:   14 NGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAF-MGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQ 135          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.592e-11
Identity = 70/266 (26.32%), Postives = 115/266 (43.23%), Query Frame = 1
Query: 1228 LKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTL------TETEISREQRSLSQDGIVMDSELII-GAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            + E G+ P   M + A +  L+ VL      ++   S    N+RGE  L       +TE+ R   SL ++G  +D++       L   A+ G + +V+ + +   + +AA  NG T LHVAA     +V   LLE    +    + GFTPL  A       E+   L  + A      K     + +A H D+ ++  LL+D G   +   ++  T LH++A   +L+    LL+ G ET+   R               D+ +LL
Sbjct:  134 VTESGLTP---MHVSAFMGNLNIVLIL----LQGGASPNATNVRGETALHMAARAGQTEVVR---SLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVAS-KYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLL 388          

HSP 2 Score: 60.4622 bits (145), Expect = 1.468e-9
Identity = 46/152 (30.26%), Postives = 69/152 (45.39%), Query Frame = 1
Query: 1552 TALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSK-GAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            TALHVAA        + LL+K    N     GFTPL  A   + +R  +MEL  K GA I    +     + ++    +  I+ +L+  G   N  N    T LH++A  G+ + V  LL+ G +   K R + T    A    +++I  LL
Sbjct:   74 TALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIAC--KKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLL 223          

HSP 3 Score: 57.7658 bits (138), Expect = 8.847e-9
Identity = 43/188 (22.87%), Postives = 82/188 (43.62%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            AL   A++G   +V  + +     +A     +T LH+AA   ++E+V+ LL+     +     G+TPL  A       ++   L   GA + +T K+ F  + +A      E+ SLL+      +   ++  T LH+++ Y      + LL  G       ++  T    A  +D+++I   L  + +
Sbjct:  174 ALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAA-REGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGA 360          

HSP 4 Score: 52.373 bits (124), Expect = 4.320e-7
Identity = 49/194 (25.26%), Postives = 88/194 (45.36%), Query Frame = 1
Query: 1363 ELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDF--VVELLKAGCETSMKN 1938
            E+  T  E   E  ++++ G+         A L   A+ G+  +   +  R  +   A  +G + LH+AA  +++ V   L++    VN   + G+TPL  A  +  + +++  L   GA +    K  +  +  A  +  T I++LL+  G   N V  + NT L   AI  RL +  VV+ LK   E ++ +
Sbjct:  350 EIATTLLEYGAETNAITRQGV---------APLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVAC-HYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTAL---AIARRLGYISVVDTLKVVTEETITS 530          

HSP 5 Score: 52.373 bits (124), Expect = 4.469e-7
Identity = 38/153 (24.84%), Postives = 70/153 (45.75%), Query Frame = 1
Query: 1453 AALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLK 1911
            AA C + ++  V +      +  N      NG T LH+A   N+I V+  LL+    +    ++G TP+  +     +  +++ L   GA    TN      + +A     TE++  L+  G  ++    ++ T LH++A  G+L+ V  LL+
Sbjct:   79 AAHCGHYRTAKVLL-----DKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAF-MGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQ 225          

HSP 6 Score: 51.9878 bits (123), Expect = 5.343e-7
Identity = 38/139 (27.34%), Postives = 63/139 (45.32%), Query Frame = 1
Query: 1543 NGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSK-GAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTA 1956
             G   LH+ A     +V   LL +   VN   ++G +PL  A      +  + E+  K GA +  T K  +  + +A H  + ++++ L+  G D+N   ++  T LH +A  G    V  LLK G   +    + NTA
Sbjct:  368 QGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQE--DKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTA 504          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.856e-11
Identity = 46/159 (28.93%), Postives = 79/159 (49.69%), Query Frame = 1
Query: 1480 GNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEI-LSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNT 1953
            G+  +V+ +     +    D  G + LH A+SS QI VV+ LL+  V ++  +  G T L  A  N     ++ EL   GA +   N+  F  +  A       + L LL++ G D+N+ ++D  + LH++A++GR      L++ G E   ++R  NT
Sbjct:  182 GHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNG-QDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNT 339          

HSP 2 Score: 55.0694 bits (131), Expect = 6.194e-8
Identity = 40/134 (29.85%), Postives = 69/134 (51.49%), Query Frame = 1
Query: 1546 GKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITL-AIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRH 1944
            G TALHVA  + Q  VV  L++    VN  ++ GFTPL  A  +      +  L + GA + + +K+    + + A+H   T   +L+ + G +++  + D NT LH++A YG    +  L+  G +T+ +  H
Sbjct:  237 GNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGG-EIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIH 369          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: ASP1 (Cytosolic L-asparaginase, involved in asparagine catabolism; catalyzes hydrolysis of L-asparagine to aspartic acid and ammonia; important enzyme for the treatment of acute lymphoblastic leukemia; has low glutaminase activity and dependence; synthesized constitutively [Source:SGD;Acc:S000002729])

HSP 1 Score: 63.5438 bits (153), Expect = 3.565e-11
Identity = 62/259 (23.94%), Postives = 112/259 (43.24%), Query Frame = 1
Query:  403 TVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPL--LDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPE-----VALFFHENLFRANRTAKLSSVHFDAFDSPN--------------YPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVL---RMFPSITCETVKAFLAPPIRGVVLLTYGSGNMP 1107
            T++SK +D      + +   +  +  +  DI  V ++ EY  L  +DS D+  D   +I K +    + +DG +I HGTDT+S T   +   ++    P++  GS  P   + +DG  NL  ++ IAS+   P+     V +  ++ +       K ++   D+F+                 YPP+   G       H+  +    + FK      P+V +L   + FP      +   +A    G+VL T G+G++P
Sbjct:   64 TIASKAIDSSQTAGYHVDLTIQDLLDAIPDISKVCDI-EYEQLCNVDSKDINEDILYKIYKGVSESLQAFDGIVITHGTDTLSETAFFIESTIDAGDVPIVFVGSMRPSTSVSADGPMNLYQAICIASN---PKSRGRGVLVSLNDQISSGYYITKTNANSLDSFNVRQGYLGNFVNNEIHYYYPPVKPQG------CHKFKLRVDGKHFK-----LPEVCILYAHQAFP----PAIVNLVADKYDGIVLATMGAGSLP 303          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO48620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ51])

HSP 1 Score: 407.527 bits (1046), Expect = 3.657e-134
Identity = 224/556 (40.29%), Postives = 327/556 (58.81%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIV--MDSELIIGAA--------------LCSNAKSGNVA----MVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSR--ELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGR 1884
            RVL+LYTGGTIGM K +  Y+P+  F  K + +LPM  D    +   +    +S  +      MP SP ++RV++ + EY P+ DSS++ ++D++ +A DIQ  Y++Y+GF+++HGTDTM++T SALSF++ENL K ++LTGSQ+P++E R+DGR+NLL +L+IA HY IPEV L+F   L+R NR  K+ +  F AFDSPN PPL  + + I V    +        F  +T M P++ +LR+FP IT  TVK+FL PP++GVVL TYG+GN P  R DL+   K+A DR  II+N TQC  G V   Y TG  L + G+ PG DMT EAAL KLSYVL      ++ ++  M RNLRGEL + +   S+EQ SL     +  +   L IG++              +C  + SG+V     +++Q     GN    +Y+G+T LH+A  +  +E+ RFLL+    V+  D+   +PL  A+  R  +  EL++E    GA +  +  EI  E+     K+  + L L   A  DLN V+ D  T LH+ +   R
Sbjct:    7 RVLVLYTGGTIGMEKTQSGYQPKTGFLQKQIKRLPMLYDEDFMATRKNQQQTQSESLELEELAMPVSPYNVRVLYYIKEYVPIKDSSNLMIEDWVMMALDIQKHYDSYNGFVVIHGTDTMAYTASALSFMMENLGKTIVLTGSQVPIYEQRNDGRDNLLGALMIAGHYIIPEVGLYFGGCLYRGNRATKVDAGSFSAFDSPNLPPLVTMTVKIDVQWDAIFRCNNTTSFTVHTKMNPNIGLLRLFPGITAMTVKSFLQPPMQGVVLQTYGAGNAPNNRSDLINEIKQATDRGVIIVNCTQCIHGPVVDAYATGRTLIDAGVVPGSDMTPEAALTKLSYVLGHDHLTVKERQELMRRNLRGELKVAQ---SQEQFSLKDSEFIEAVACSLHIGSSEEMRYIRRALLPVLMCCASSSGSVQTLQKLLDQGADPNGN---INYDGRTPLHIACLNGNLEIARFLLQHGASVHVRDRFNRSPLEDAIKFRHQKVVELLVE---TGATLGRSTSEIAAEVCCLAAKNRVDDLRLWGTASADLNGVDYDGRTPLHVVSTMPR 553          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO31582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXJ3])

HSP 1 Score: 288.5 bits (737), Expect = 3.554e-90
Identity = 182/443 (41.08%), Postives = 240/443 (54.18%), Query Frame = 1
Query:  544 DMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWE-AADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEI-TLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHL 1866
            DM M  +I IA  I+  YE Y GF+ILHGTDT+ +T SALSF+ ENL K VI TGSQ P+ E  +DGR+NL  +L+IA H+ IPEV ++FH  L+R NR  K+ S  F AFDSPN+  LA V   I+V    +     +  F   T++ P V VLR+FP IT  TV+AFL PPIRG+VL TYGSGN P  RKDLL+   EA  R  +I+N TQC  G V   Y TG  L + G+ PG DMT EAAL KLSYVL   D  +  K+  M  N    L    + +S   R +    +                  G +   E +    GN   A D++G+T LH+A    Q EVV++LL +   ++  D  G  P+  A+  R   ++I  L   GA +  T  +I  E+ +L         L     AG D N+ + DK T LH+
Sbjct:    1 DMDMKGWIAIANIIKENYEKYSGFVILHGTDTLPYTASALSFMFENLGKSVIFTGSQSPINEHLNDGRDNLFGALMIAGHHVIPEVTVYFHGKLYRGNRCLKVDSRSFGAFDSPNFSELAKVESGIEVEWDEVFRCNVSGKFTVRTNLVPHVGVLRIFPGITTATVRAFLQPPIRGIVLETYGSGNGPDSRKDLLQELMEASKRGVLIVNCTQCLHGQVVDSYATGKALLDAGVIPGSDMTTEAALAKLSYVLGL-DLPVR-KQQQMDGNTCLGLIDGWSHMSWVNRWMGHTCL------------------GLIDGWEHMSWPGGNPNCATDHDGRTPLHIACLEGQEEVVKYLLYRGASIHVQDIYGQRPIDDAIGGR-HDDIIRLLVEAGAHLGPTTMDIARELCSLVAEPGCVPRLRAWYLAGADFNVGDYDKRTPLHV 422          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO27587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8U6])

HSP 1 Score: 220.32 bits (560), Expect = 8.630e-66
Identity = 130/340 (38.24%), Postives = 193/340 (56.76%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYD-----IPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFL-APPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVK-AIYKTGFILKEYGIYPGLDMTLEAAL 1281
            ++L++YTGGTIGM K       +   F K L+K+P         K LD C     EI +  F  P                  +DSS+M +  + +IA  I   Y  +DGF++LHG+DTMS++ SALSF+ ENL KP+I TGSQ+P+ ++R+D +ENL+ ++ IAS  +     I EV L+F   L+R NRT K+S+ HF+AF SPN+P LA+ G+ +KV    LL     +  K   +   +V +L++FP I  + V A +    ++G++L TYGSGN P      +E  K+A ++   +IN+TQC  G V    Y+T   L+E G+  G D+T EAA+
Sbjct:    6 QILLIYTGGTIGMVKDPDTGALKAFNFKKLLNKIPEL-------KLLD-C-----EIDTISFDEP------------------IDSSNMNIKYWQQIADIIDENYMRFDGFVVLHGSDTMSYSASALSFMFENLSKPIIFTGSQLPIGDLRTDAKENLITAIQIASLQEKGEATIQEVGLYFEYKLYRGNRTTKISAEHFNAFSSPNFPELAESGVHLKVNKDVLLKKVAGKTLKINKNFDQNVVILKVFPGINEKVVDAIINISGLKGIILETYGSGNAP-TENWFVEKLKQAIEKKIHVINVTQCTGGAVAMGQYETSTQLREIGVISGFDITTEAAI 313          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 51.9878 bits (123), Expect = 1.395e-7
Identity = 39/150 (26.00%), Postives = 72/150 (48.00%), Query Frame = 1
Query: 1522 NWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFT---PLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLI-DAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAY 1959
            N    D +G + LH A ++N +++V+ LL+    V+           P+ CA          + LR+ GA + +TN      +  A  +  ++++ LL+ D  +D+N+V+ D  T LH++A+ G    +  LL  G   + K+    TA+
Sbjct:   21 NLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRA-GADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAF 169          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 53.1434 bits (126), Expect = 1.540e-7
Identity = 70/268 (26.12%), Postives = 118/268 (44.03%), Query Frame = 1
Query: 1318 NIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRC-SRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLID-AGIDL---------------------NIVNEDKN----TFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLS----NFNS*NK 2028
            N   KR    R  +G    +ET+     RS  +  I  +S ++  +A+ S    G+V  V+++  +  +    + +G TALH A      ++V+ L++K   ++  D  G+T L  A    C S E+   L   GA +   N E    + LA  +D  ++L+  I+  GID+                     N +NE K+    + LH+++  G L  +  LL+ G E + K+  + T    A    + D C LLS    +FN+ NK
Sbjct:   14 NALQKRQDSLRRWKG----SETDRQPVDRSRKKPKIQFNSGIVFLSAVSS----GDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAA--SCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: aspg (asparaginase [Source:NCBI gene;Acc:101159546])

HSP 1 Score: 402.134 bits (1032), Expect = 1.673e-130
Identity = 225/564 (39.89%), Postives = 328/564 (58.16%), Query Frame = 1
Query:  283 RVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGE---------LTLTETE-ISREQRSLS---QDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTN-KEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSM 1932
            RVL+L TGGTIGM   +    P+ N   ++L KLP+ +D      Y    C   +    N  V+P S  + R+++ + EY+PLLDSS+MT DD+ RI KDI+  YE+YDGF+ILHGTDTM++T SALSF+ E+L KP++LTGSQ+P++E+++DGR+NLL +L+IA  + IPEV L+F+  L+R NR  K+ +  F+AF SPN PPLA   + I +    +        F+  T++  +V +LR+FP IT  +V+AFL PP++G+VL TYGSGN P  R DLL   K A D   IIIN TQC +G V A Y TG +L E G+  G DMT EAAL+KLSYVLA+ +  ++ K+  M +NLRGE         L L+ +  I    +SLS   ++ +    + +     C+ A+ G++  +E + +   N    DY+G+T LHVAA     +VV++LL     V   D+ G TPL  AV  R  ++++  LR  GA       +E   E+       D + L +   AG DLN    D    + ++    + + V  L++   + SM
Sbjct:   62 RVLVLNTGGTIGMTLHDNVLAPKANTLVQSLRKLPILHDEL----YAQQTCLYEYYGSENSLVLPLSKSNKRIIYTIMEYSPLLDSSNMTTDDWGRIGKDIEKNYEHYDGFVILHGTDTMAYTASALSFMCEHLGKPIVLTGSQVPIYELKNDGRDNLLGALLIAGQFVIPEVCLYFYNKLYRGNRVTKVDAGSFNAFSSPNLPPLATSEVDISINWDTVWRANTTAKFQVSTELNRNVGLLRLFPGITSSSVRAFLQPPMQGIVLETYGSGNAPDNRPDLLAELKAATDSGVIIINCTQCLRGTVSASYATGKVLMEAGLIAGGDMTPEAALSKLSYVLAKKNLGLDAKKKLMAQNLRGEMNIDLEGAKLCLSNSRFIQVIAKSLSISCKEELEAIRDALTPPLTCAAARIGDIDALEALKEMGSNLCLGDYDGRTPLHVAACEGHFKVVQYLLSHGASVYVKDRYGDTPLSNAVRFR-HKDVVKLLRKTGAHFSRDQLEEAGTELCSLAASGDLDGLEIWCLAGADLNRPGYDGKIAVEVAEAVNKKEVVALLVQLMSKKSM 620          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:101166639])

HSP 1 Score: 72.7886 bits (177), Expect = 4.909e-14
Identity = 52/157 (33.12%), Postives = 80/157 (50.96%), Query Frame = 1
Query: 1537 DYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRE-LIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            D + +TALH A S+    +V FLL+  V+VN  D A +TPL  A      RE ++  L SKGA++   N+     +  A  KD  EI  +L++ G D N  ++ + T LH ++  G    +  LLK    T++++   NT    A   +RV+   LL
Sbjct:   37 DQDRRTALHWACSAGHTNIVEFLLDLGVEVNLQDDASWTPLHIAA--SAGREDIVKALISKGAQLNSVNQNGCTPLHYAASKDRYEIALMLLENGADPNATDKLEWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLL 191          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:101162667])

HSP 1 Score: 75.485 bits (184), Expect = 1.564e-13
Identity = 55/192 (28.65%), Postives = 93/192 (48.44%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDR-----VDICNLLSNFNS*NKY 2031
            A+ G+V  +  + +++      D +G+TALHVAA    ++VV +L   +   N  D+    PL CA  +  S  +   L   G  +  TN+E    +  A  +   +I+  L++   DL   ++D +T LHL+    ++D V  LLK  C+   ++RH NTA   A  +D      + IC   +N +  NK+
Sbjct:  414 ARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYS-AVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDKDGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIA-CKDGNLPIVIAICGAKANLDLPNKH 603          

HSP 2 Score: 53.9138 bits (128), Expect = 6.700e-7
Identity = 48/170 (28.24%), Postives = 85/170 (50.00%), Query Frame = 1
Query: 1402 RSLSQDGIVMDSELIIG-AALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            R+L Q G  +++    G + L + +  G V +VE + + R + +A D +G TALH+A    Q++VVR LL+   Q +  D+ G T L  A  +  +  +++ +    A + + NK     + LA      E++  L  AG +++ V  D  T   L++   R + +V LL
Sbjct:  489 RALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDKDGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIACKD-GNLPIVIAICGAKANLDLPNKHGRTPLHLAAKNGSLEVVRHLCLAGANIDAVTNDGKTAEDLASA-DRHEPIVSLL 656          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:101162667])

HSP 1 Score: 75.485 bits (184), Expect = 1.620e-13
Identity = 55/192 (28.65%), Postives = 93/192 (48.44%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDR-----VDICNLLSNFNS*NKY 2031
            A+ G+V  +  + +++      D +G+TALHVAA    ++VV +L   +   N  D+    PL CA  +  S  +   L   G  +  TN+E    +  A  +   +I+  L++   DL   ++D +T LHL+    ++D V  LLK  C+   ++RH NTA   A  +D      + IC   +N +  NK+
Sbjct:  420 ARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYS-AVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDKDGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIA-CKDGNLPIVIAICGAKANLDLPNKH 609          

HSP 2 Score: 53.9138 bits (128), Expect = 7.238e-7
Identity = 48/170 (28.24%), Postives = 85/170 (50.00%), Query Frame = 1
Query: 1402 RSLSQDGIVMDSELIIG-AALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            R+L Q G  +++    G + L + +  G V +VE + + R + +A D +G TALH+A    Q++VVR LL+   Q +  D+ G T L  A  +  +  +++ +    A + + NK     + LA      E++  L  AG +++ V  D  T   L++   R + +V LL
Sbjct:  495 RALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDKDGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIACKD-GNLPIVIAICGAKANLDLPNKHGRTPLHLAAKNGSLEVVRHLCLAGANIDAVTNDGKTAEDLASA-DRHEPIVSLL 662          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:101162667])

HSP 1 Score: 75.485 bits (184), Expect = 1.624e-13
Identity = 55/192 (28.65%), Postives = 93/192 (48.44%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDR-----VDICNLLSNFNS*NKY 2031
            A+ G+V  +  + +++      D +G+TALHVAA    ++VV +L   +   N  D+    PL CA  +  S  +   L   G  +  TN+E    +  A  +   +I+  L++   DL   ++D +T LHL+    ++D V  LLK  C+   ++RH NTA   A  +D      + IC   +N +  NK+
Sbjct:  346 ARHGHVETLRFLHEKKCPLNVQDKSGETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYS-AVARALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDKDGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIA-CKDGNLPIVIAICGAKANLDLPNKH 535          

HSP 2 Score: 53.9138 bits (128), Expect = 7.172e-7
Identity = 48/170 (28.24%), Postives = 85/170 (50.00%), Query Frame = 1
Query: 1402 RSLSQDGIVMDSELIIG-AALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            R+L Q G  +++    G + L + +  G V +VE + + R + +A D +G TALH+A    Q++VVR LL+   Q +  D+ G T L  A  +  +  +++ +    A + + NK     + LA      E++  L  AG +++ V  D  T   L++   R + +V LL
Sbjct:  421 RALCQAGCDVNATNREGESPLLTASARGFVDIVECLVEHRADLQATDKDGHTALHLAVRRCQVDVVRCLLKHNCQQDQQDRHGNTALHIACKD-GNLPIVIAICGAKANLDLPNKHGRTPLHLAAKNGSLEVVRHLCLAGANIDAVTNDGKTAEDLASA-DRHEPIVSLL 588          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000078716.1 (SMESG000078716.1)

HSP 1 Score: 1318.52 bits (3411), Expect = 0.000e+0
Identity = 640/650 (98.46%), Postives = 640/650 (98.46%), Query Frame = 1
Query:   70 MSTEHDTFSINSQSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            MSTEHDTFSINS SYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTV         RKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS
Sbjct:    1 MSTEHDTFSINSPSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTV---------RKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 641          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000078716.1 (SMESG000078716.1)

HSP 1 Score: 1066.99 bits (2758), Expect = 0.000e+0
Identity = 516/516 (100.00%), Postives = 516/516 (100.00%), Query Frame = 1
Query:  472 MPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 2019
            MPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS
Sbjct:    1 MPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS 516          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000051813.1 (SMESG000051813.1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 295/584 (50.51%), Postives = 410/584 (70.21%), Query Frame = 1
Query:  166 FEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWEYNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSFLLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHENLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLL-MPEKNQPFKAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRKDLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTLEAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEIS--REQRSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEV-QVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGA---KIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFV 1896
            +EF  ID YY+PK   G +  +L   D+  LDP C    ++L++YTGGTIGMR K+  Y+PE N+FCKAL KLPMF+D+ + S+     C        N F+MPRS +  RV++ VWEY+PLLDS+D+T+DDYI IA DI+ EYE YDGF+ILHGTDT+++TG+ LSF+L NL KP+ILTGSQIP+FE+RSDGRENLL SL++ SHY+IPEVA+FFHE LFRANR +K+SSVHFDAFDSPNYPPLA +G+ I V SH +   P +NQ F  YT +C +VSVLRMFPSITC+TV A L PPI+GVVL TYGSGN+P  R+D+L+ FKEA D+  IIINI+QC+ GGV++ YK+G IL+EYG+  G+DMT EAAL+KLSYVL  ++W++  KR  M+ +LRGE++L    +S  + +R + QD ++M  ++++  A+CS AKSG++ M+E+I K    W++++ +G T LH+AA +N+I V+ FLL K +  V+  D+   TPL  A++N+    LI  L + GA   +I    + +F  + +    +D EIL     A  + N+ +      +H+S  +  +D +
Sbjct:   60 WEFSQIDPYYQPKSTCGPSDINLDDVDIMSLDPDCTSQSKILVIYTGGTIGMRLKKEGYQPESNYFCKALRKLPMFHDNNIRSEIFSKYC--------NAFIMPRSRDGRRVIYVVWEYDPLLDSTDITVDDYIHIAHDIEAEYEKYDGFVILHGTDTLAYTGACLSFILNNLSKPIILTGSQIPVFELRSDGRENLLTSLLLVSHYNIPEVAVFFHEKLFRANRCSKISSVHFDAFDSPNYPPLATIGVEIVVNSHLVRDAPNENQKFTIYTHLCTEVSVLRMFPSITCQTVTALLNPPIQGVVLQTYGSGNVPISREDILKCFKEASDKGVIIINISQCFHGGVRSTYKSGSILQEYGVISGIDMTPEAALSKLSYVLGNTEWDLTEKRRIMSCDLRGEISLNLLTMSSMKNKRPI-QDNLIMSKKVVV-MAMCSAAKSGDIVMMEKIAKHYNKWDSSNEHGHTPLHLAAEANKINVINFLLSKGIANVDILDRKNKTPLLNAIINKSDEALITLLTNNGASINRIYQVEQIVFKYLIV----NDLEILKRFQLAKFNFNVADN-----IHVSCRWQIMDMI 624          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000078716.1 (SMESG000078716.1)

HSP 1 Score: 234.187 bits (596), Expect = 1.707e-73
Identity = 112/113 (99.12%), Postives = 112/113 (99.12%), Query Frame = 1
Query:   70 MSTEHDTFSINSQSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTV 408
            MSTEHDTFSINS SYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTV
Sbjct:    1 MSTEHDTFSINSPSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGANLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCKALHKLPMFNDHTV 113          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 75.485 bits (184), Expect = 1.260e-13
Identity = 56/179 (31.28%), Postives = 88/179 (49.16%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIG-KRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            +K G V +  Q+    + N  +  ++G T LHVA   N  E++  LL+ E  VNC  + G+TPL   V  +   E+   L  +GA +   +++ F  + L     + EI+ LL+DA  D+N   E+  T LHL+A   R D V +LLK   + S K +   TA   A    ++    +L
Sbjct:  606 SKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHL-VAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKML 783          

HSP 2 Score: 68.5514 bits (166), Expect = 1.498e-11
Identity = 57/202 (28.22%), Postives = 88/202 (43.56%), Query Frame = 1
Query: 1402 RSLSQDGIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILS-LLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            + +  D + MD       AL   A  GN+   E + K   N  A   NG T LH+A    Q ++V  L++ +  +N   + G TPL  A     S+E++  L   GA I  T  +  + + LA   +  E    LL+    + N    +  T LH++   G    V +LL AG + +M  + + TA   A    R +I  LL
Sbjct:  388 KGIDVDAVTMD----YLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAF-MGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLL 584          

HSP 3 Score: 63.5438 bits (153), Expect = 4.948e-10
Identity = 42/132 (31.82%), Postives = 67/132 (50.76%), Query Frame = 1
Query: 1543 NGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRE-LIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMK 1935
            N  T LHVAA   + E+++ L+ ++  VN   + G +P+ CA   R   E +I+ L   GA I   +K     + +A   D  E+   LI+ GID++ V  D  T LH++A  G ++    LLK  C  + +
Sbjct:  299 NNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAA--RSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNAR 428          

HSP 4 Score: 55.8398 bits (133), Expect = 1.160e-7
Identity = 51/208 (24.52%), Postives = 88/208 (42.31%), Query Frame = 1
Query: 1480 GNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLN---RCSRELIME------------------------------LRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLL 2004
            GN ++VEQ+     +      +  TALH+AA   + E+ R LLE + + +   + GFTPL  A      + +R+L++                               L    A +    K  +  + L   K+  E+  LLID G ++N  ++   T LHL+++ G  + +  LL A  + + +  +  TA   A  ++R DI   L
Sbjct:  543 GNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQL 750          

HSP 5 Score: 55.8398 bits (133), Expect = 1.352e-7
Identity = 33/114 (28.95%), Postives = 62/114 (54.39%), Query Frame = 1
Query: 1471 AKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLID 1812
            AK GN  +V+ + +   + + A   G T+LH+A+ + ++EVV  LLE +  +N   Q GFTPL  A       +++  L   GA   +T  + F  + +A+ + + +++ +L+D
Sbjct:  113 AKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAA-QENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLD 225          

HSP 6 Score: 53.1434 bits (126), Expect = 9.784e-7
Identity = 49/204 (24.02%), Postives = 81/204 (39.71%), Query Frame = 1
Query: 1492 MVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVL--NRCSRELIM------------------------------ELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLS 2007
            M+E +     N      NG T LH+ A  N IEV + L+++   VN   Q GFTPL    +  N+   EL++                              +L    A I    +  +  +  A+H    + + +L++   D+N       T LHL+A  G +  V  LL    + + +N+   TA + A  +  ++I   LS
Sbjct:  647 MIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLS 850          

HSP 7 Score: 50.447 bits (119), Expect = 5.722e-6
Identity = 41/151 (27.15%), Postives = 76/151 (50.33%), Query Frame = 1
Query: 1456 ALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVAASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKGAKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLSAIYGRLDFVVELL 1908
            A    A+SGNV  V++  +     + ++ NG  A+H+AA     EVV+ L+E  + V+   + G T L  A L     E++  L    A I + ++  F  + +A  ++  +++ +L++ G +  I  +D  T L ++   G  D VV++L
Sbjct:   75 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASL-AGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGN-DKVVQIL 223          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASPG8.950e-11537.63asparaginase [Source:HGNC Symbol;Acc:HGNC:20123][more]
ASPG1.184e-10838.96asparaginase [Source:HGNC Symbol;Acc:HGNC:20123][more]
ASPG3.911e-3453.92asparaginase [Source:HGNC Symbol;Acc:HGNC:20123][more]
ANK23.446e-1327.17ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK24.326e-1327.17ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C27A7.54.164e-15141.25pep chromosome:WBcel235:V:12154875:12158553:-1 gen... [more]
C27A7.51.140e-15041.25pep chromosome:WBcel235:V:12154875:12160982:-1 gen... [more]
C27A7.52.070e-15041.25pep chromosome:WBcel235:V:12154875:12162299:-1 gen... [more]
C27A7.52.608e-15041.25pep chromosome:WBcel235:V:12154875:12162298:-1 gen... [more]
unc-443.380e-1125.60AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG64284.455e-12940.18gene:FBgn0029689 transcript:FBtr0070625[more]
CG85261.482e-11036.04gene:FBgn0037759 transcript:FBtr0082142[more]
CG85261.004e-10936.22gene:FBgn0037759 transcript:FBtr0334682[more]
CG100113.398e-1232.93gene:FBgn0039590 transcript:FBtr0085319[more]
Kank7.127e-1230.82gene:FBgn0027596 transcript:FBtr0303758[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aspg7.587e-14140.03asparaginase homolog (S. cerevisiae) [Source:ZFIN;... [more]
aspg1.273e-14039.84asparaginase homolog (S. cerevisiae) [Source:ZFIN;... [more]
aspg2.243e-14040.45asparaginase homolog (S. cerevisiae) [Source:ZFIN;... [more]
aspg2.357e-13839.45asparaginase homolog (S. cerevisiae) [Source:ZFIN;... [more]
aspg1.756e-6843.71asparaginase homolog (S. cerevisiae) [Source:ZFIN;... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aspg3.083e-13542.19asparaginase [Source:NCBI gene;Acc:100145621][more]
aspg3.284e-13541.50asparaginase [Source:NCBI gene;Acc:100145621][more]
aspg1.484e-13442.08asparaginase [Source:NCBI gene;Acc:100145621][more]
aspg1.638e-13442.08asparaginase [Source:NCBI gene;Acc:100145621][more]
aspg9.270e-13240.85asparaginase [Source:NCBI gene;Acc:100145621][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aspg8.220e-11536.92asparaginase [Source:MGI Symbol;Acc:MGI:2144822][more]
Aspg2.288e-3434.58asparaginase [Source:MGI Symbol;Acc:MGI:2144822][more]
Ank34.797e-1327.16ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank36.261e-1327.16ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank36.384e-1327.16ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U518|ASPG_DIRIM3.974e-14442.86L-asparaginase OS=Dirofilaria immitis OX=6287 PE=1... [more]
sp|O88202|LPP60_RAT7.674e-11537.4360 kDa lysophospholipase OS=Rattus norvegicus OX=1... [more]
sp|Q86U10|LPP60_HUMAN4.298e-11437.6360 kDa lysophospholipase OS=Homo sapiens OX=9606 G... [more]
sp|A0JNU3|LPP60_MOUSE5.750e-11436.9260 kDa lysophospholipase OS=Mus musculus OX=10090 ... [more]
sp|P0A962|ASPG1_ECOLI1.222e-9043.21L-asparaginase 1 OS=Escherichia coli (strain K12) ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JHK62.208e-16041.07L-asparaginase-like isoform X3 OS=Lingula unguis O... [more]
A0A1S3JJ116.286e-16040.98L-asparaginase-like isoform X2 OS=Lingula unguis O... [more]
A0A1S3JHQ12.376e-15840.96L-asparaginase-like isoform X1 OS=Lingula unguis O... [more]
A0A1S3JHG61.259e-15741.28L-asparaginase-like isoform X1 OS=Lingula unguis O... [more]
A0A1S3JID18.956e-15741.20L-asparaginase-like OS=Lingula unguis OX=7574 GN=L... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aspg3.268e-13741.52asparaginase [Source:NCBI gene;Acc:103038278][more]
aspg3.307e-13740.83asparaginase [Source:NCBI gene;Acc:103038278][more]
aspg1.176e-13640.41asparaginase [Source:NCBI gene;Acc:103038278][more]
aspg1.631e-13640.83asparaginase [Source:NCBI gene;Acc:103038278][more]
aspg3.443e-13642.94asparaginase [Source:NCBI gene;Acc:103038278][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anks1b5.715e-1230.26ankyrin repeat and sterile alpha motif domain cont... [more]
ENSPMAT00000000095.17.551e-1226.42pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007449.11.506e-1126.32pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.11.592e-1126.32pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000003991.11.856e-1128.93pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ASP13.565e-1123.94Cytosolic L-asparaginase, involved in asparagine c... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO486203.657e-13440.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315823.554e-9041.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275878.630e-6638.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391131.395e-726.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436901.540e-726.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aspg1.673e-13039.89asparaginase [Source:NCBI gene;Acc:101159546][more]
psmd104.909e-1433.12proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
dapk11.564e-1328.65death associated protein kinase 1 [Source:NCBI gen... [more]
dapk11.620e-1328.65death associated protein kinase 1 [Source:NCBI gen... [more]
dapk11.624e-1328.65death associated protein kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078716.10.000e+098.46SMESG000078716.1[more]
SMESG000078716.10.000e+0100.00SMESG000078716.1[more]
SMESG000051813.10.000e+050.51SMESG000051813.1[more]
SMESG000078716.11.707e-7399.12SMESG000078716.1[more]
SMESG000026655.11.260e-1331.28SMESG000026655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015352 ID=SMED30015352|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2228bp
GTTTTTAGCTGTTTAGGCCAAATTTGTCAAGCAATTTGTTGTAAATCTTA
ACAACATTTATAATAGAAAATGAGTACAGAACATGATACGTTTTCAATAA
ACAGCCAATCTTATACGGATAATGCAGATAAAATTAATAGAAGAAAACTC
GTATCTGAACAAAGTTTTGAATTCAAGAGCATTGATAAGTATTACAAACC
AAAAGTTATATTTGGAGCAAATCTACCCGATCTATCAACAGATGACTTGA
ACAAATTGGATCCAAAATGCAGAATTATGAAACGAGTTTTGATTTTATAT
ACCGGTGGAACAATTGGAATGAGAAAAAAAGAAGGTGCATATGAACCAGA
GCCGAATTTCTTTTGTAAAGCTCTTCATAAACTCCCAATGTTTAACGATC
ACACTGTTAGTTCTAAATATCTAGATCATTGTTGCAGAAAATCTTTCGAG
ATTCCAAGTAACGTATTTGTAATGCCGAGATCCCCGGAAGATATTCGCGT
GGTGTTCAATGTTTGGGAATATAATCCTCTATTAGATTCATCTGATATGA
CAATGGATGATTATATTCGAATTGCGAAAGATATTCAAACTGAATACGAA
AATTACGATGGATTTATTATCCTCCATGGAACTGACACTATGTCTTTTAC
TGGATCAGCTCTTTCCTTTTTACTTGAAAATTTAAAGAAACCTGTCATAT
TGACAGGATCACAAATTCCATTATTTGAGATTAGAAGCGATGGTCGAGAA
AATCTGCTAGCATCACTGATAATAGCTAGTCACTACGACATTCCCGAAGT
TGCTCTTTTCTTTCATGAAAATTTGTTTAGAGCTAATAGAACAGCAAAAC
TATCTAGCGTTCATTTTGATGCATTTGACTCACCAAATTATCCCCCATTG
GCTGACGTGGGGATATCAATAAAAGTTTATTCACATCGCTTATTAATGCC
TGAAAAAAACCAACCATTTAAAGCTTATACTGATATGTGTCCAGATGTTT
CCGTTTTAAGAATGTTTCCATCAATAACTTGTGAAACTGTCAAAGCGTTT
TTAGCTCCACCAATAAGAGGTGTTGTTCTTTTGACATATGGTTCAGGAAA
CATGCCGTTTTGTCGCAAGGATCTATTGGAACTATTCAAAGAAGCATTTG
ATCGTGATTGTATCATAATTAATATAACCCAATGTTGGAAGGGAGGAGTG
AAAGCAATCTACAAGACCGGGTTTATTTTGAAAGAGTACGGAATATATCC
CGGTCTTGATATGACGCTGGAAGCAGCATTAAATAAATTGTCATATGTTT
TGGCTAGATCAGATTGGAATATCGAAACGAAACGTTCAGCAATGACTCGA
AATCTACGAGGTGAATTGACACTTACAGAAACAGAAATTAGTAGAGAGCA
AAGATCACTGAGTCAAGATGGAATAGTTATGGATAGTGAACTAATTATTG
GAGCAGCTTTATGTTCAAATGCAAAATCCGGTAACGTCGCAATGGTTGAA
CAAATCGGTAAACGCCGGGGAAATTGGGAGGCGGCTGATTACAACGGCAA
AACAGCTTTACATGTTGCTGCGTCGTCAAATCAAATAGAAGTCGTCCGTT
TTCTTCTTGAAAAGGAAGTACAGGTCAATTGTGGAGATCAGGCAGGCTTC
ACTCCATTAAGATGTGCTGTTTTGAATCGATGCAGTAGAGAACTTATTAT
GGAACTAAGGAGTAAAGGAGCGAAGATAATAATGACAAATAAAGAAATAT
TCGATGAAATTACTTTAGCTATTCATAAAGATGACACGGAAATTCTATCT
TTACTCATTGATGCGGGGATTGATTTAAATATTGTCAATGAAGATAAAAA
TACCTTTCTACATTTATCTGCAATTTATGGCCGGTTGGATTTTGTTGTGG
AATTGCTCAAAGCAGGTTGTGAGACAAGCATGAAAAATCGTCACGATAAC
ACTGCATATGATGAAGCGTTTGTTCGTGACCGTGTCGATATCTGCAATCT
TTTATCCAATTTCAATTCATAAAATAAATATTTCAATCAATATCTCTTAT
TAATTAGAGTTCGTATTTTCGTGAGTACTTTTCCAGAGAATATCTTTTCC
GTTCTTATTTATAAATTGTTACTATTATATCATTAGTAACTATCTATATT
GATTGATTGACACTATTTTTCCGTTTATTTGGGTTTTTGTTTTAATTTTA
TTCTGTTTTAAAATAAAAATGTATCTGC
back to top

protein sequence of SMED30015352-orf-1

>SMED30015352-orf-1 ID=SMED30015352-orf-1|Name=SMED30015352-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=651bp
MSTEHDTFSINSQSYTDNADKINRRKLVSEQSFEFKSIDKYYKPKVIFGA
NLPDLSTDDLNKLDPKCRIMKRVLILYTGGTIGMRKKEGAYEPEPNFFCK
ALHKLPMFNDHTVSSKYLDHCCRKSFEIPSNVFVMPRSPEDIRVVFNVWE
YNPLLDSSDMTMDDYIRIAKDIQTEYENYDGFIILHGTDTMSFTGSALSF
LLENLKKPVILTGSQIPLFEIRSDGRENLLASLIIASHYDIPEVALFFHE
NLFRANRTAKLSSVHFDAFDSPNYPPLADVGISIKVYSHRLLMPEKNQPF
KAYTDMCPDVSVLRMFPSITCETVKAFLAPPIRGVVLLTYGSGNMPFCRK
DLLELFKEAFDRDCIIINITQCWKGGVKAIYKTGFILKEYGIYPGLDMTL
EAALNKLSYVLARSDWNIETKRSAMTRNLRGELTLTETEISREQRSLSQD
GIVMDSELIIGAALCSNAKSGNVAMVEQIGKRRGNWEAADYNGKTALHVA
ASSNQIEVVRFLLEKEVQVNCGDQAGFTPLRCAVLNRCSRELIMELRSKG
AKIIMTNKEIFDEITLAIHKDDTEILSLLIDAGIDLNIVNEDKNTFLHLS
AIYGRLDFVVELLKAGCETSMKNRHDNTAYDEAFVRDRVDICNLLSNFNS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040919Asparaginase_C
IPR037152L-asparaginase_N_sf
IPR036770Ankyrin_rpt-contain_sf
IPR041725L-asparaginase_I
IPR036152Asp/glu_Ase-like_sf
IPR002110Ankyrin_rpt
IPR006034Asparaginase/glutaminase-like
IPR027473L-asparaginase_C
IPR020683Ankyrin_rpt-contain_dom
IPR027474L-asparaginase_N
IPR027475Asparaginase/glutaminase_AS2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004067asparaginase activity
GO:0005524ATP binding
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0006520cellular amino acid metabolic process
GO:0006412translation
GO:0006450regulation of translational fidelity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006034Asparaginase/glutaminase-likePRINTSPR00139ASNGLNASEcoord: 359..377
score: 21.8
coord: 73..84
score: 57.54
coord: 180..198
score: 54.14
IPR006034Asparaginase/glutaminase-likeSMARTSM00870Asparaginase_2coord: 72..421
e-value: 2.2E-98
score: 342.9
IPR006034Asparaginase/glutaminase-likePIRSFPIRSF001220L-ASNase_gatDcoord: 68..132
e-value: 0.0015
score: 15.4
coord: 130..433
e-value: 1.3E-68
score: 229.3
IPR006034Asparaginase/glutaminase-likePROSITEPS51732ASN_GLN_ASE_3coord: 71..428
score: 63.041
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 575..589
score: 31.98
coord: 493..508
score: 42.37
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 525..555
e-value: 500.0
score: 7.2
coord: 592..621
e-value: 0.22
score: 20.6
coord: 492..521
e-value: 7.2E-6
score: 35.5
coord: 559..588
e-value: 64.0
score: 12.4
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 592..624
score: 9.404
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 492..524
score: 13.01
NoneNo IPR availablePFAMPF13857Ank_5coord: 579..633
e-value: 5.6E-10
score: 39.3
NoneNo IPR availablePIRSFPIRSF500176L_ASNasecoord: 130..431
e-value: 2.8E-79
score: 264.4
coord: 69..135
e-value: 9.6E-5
score: 19.4
NoneNo IPR availableSFLDSFLDS00057Glutaminase/Asparaginasecoord: 68..434
e-value: 0.0
score: 394.8
NoneNo IPR availablePANTHERPTHR11707L-ASPARAGINASEcoord: 69..438
NoneNo IPR availablePANTHERPTHR11707:SF2860 KDA LYSOPHOSPHOLIPASEcoord: 69..438
IPR040919Asparaginase/glutaminase, C-terminalPFAMPF17763Asparaginase_Ccoord: 310..415
e-value: 1.5E-19
score: 70.3
IPR037152L-asparaginase, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.1170coord: 70..307
e-value: 1.1E-87
score: 295.1
IPR027474L-asparaginase, N-terminalPFAMPF00710Asparaginasecoord: 72..289
e-value: 1.4E-61
score: 207.4
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 468..556
e-value: 5.0E-10
score: 39.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 468..650
score: 36.1
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 566..647
e-value: 2.6E-15
score: 58.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 453..565
e-value: 1.5E-19
score: 72.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 463..648
IPR027473L-asparaginase, C-terminalGENE3DG3DSA:3.40.50.40coord: 308..435
e-value: 1.9E-39
score: 136.2
IPR027475Asparaginase/glutaminase, active site 2PROSITEPS00917ASN_GLN_ASE_2coord: 181..191
IPR041725Type I (cytosolic) L-asparaginaseCDDcd08963L-asparaginase_Icoord: 71..415
e-value: 1.43522E-109
score: 331.08
IPR036152Asparaginase/glutaminase-like superfamilySUPERFAMILYSSF53774Glutaminase/Asparaginasecoord: 70..434