Ciliogenesis-associated TTC17-interacting protein

Overview
NameCiliogenesis-associated TTC17-interacting protein
Smed IDSMED30015332
Length (bp)1699
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ciliogenesis-associated TTC17-interacting protein (SMED30015332) t-SNE clustered cells

Violin plots show distribution of expression levels for Ciliogenesis-associated TTC17-interacting protein (SMED30015332) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ciliogenesis-associated TTC17-interacting protein (SMED30015332) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ciliogenesis-associated TTC17-interacting protein (SMED30015332) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015332

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015332SMESG000009424.1 SmedASXL_013964SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015332SMESG000009424.1 dd_Smed_v4_5952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015332SMESG000009424.1 dd_Smed_v4_5952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015332SMESG000009424.1 dd_Smed_v4_5952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015332SMESG000009424.1 dd_Smed_v4_5952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30015332SMESG000009424.1 dd_Smed_v4_5952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015332SMESG000009424.1 dd_Smed_v6_5952_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015332SMESG000009424.1 dd_Smed_v4_5952_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Human
Match: CATIP (ciliogenesis associated TTC17 interacting protein [Source:HGNC Symbol;Acc:HGNC:25062])

HSP 1 Score: 167.548 bits (423), Expect = 6.295e-46
Identity = 102/338 (30.18%), Postives = 173/338 (51.18%), Query Frame = 2
Query:  137 IPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGD-----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNE-KREVTERTFAHAVMHGYISEGANIVLQRIIMSKGL-PDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATF 1129
            +P A+  A+ F+  +   +L+  FF + L   ++  +  G     V+ G Y+        C+ V A S G ++ + C   +L YL+  L+ + Q   + ++        ++++ + D  +    + + IK+G E K  VT  +F  + + G+ISE AN+VL R++  + + P     ++ D +  LC  +Y++L    IQ+      Q   + +E+ +     +P++ Q Y  SDGHL  R+Q+GSP    +  +P L E DE  P P F +  L W +D++L   F DRKEEL   +  Y+R HPE   LI+DFL  LL  +PE+ + FA +FF  F
Sbjct:   25 LPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLA---VTRSIKEGEEVKTGVT--SFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQV---DHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPF 354          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Zebrafish
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:767803])

HSP 1 Score: 192.971 bits (489), Expect = 7.770e-56
Identity = 119/352 (33.81%), Postives = 189/352 (53.69%), Query Frame = 2
Query:  146 ASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIM-SKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKL-----------IEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNRFIYGASSQL 1165
            AS +A+ FI  I   DL+   F D L+T ++  +E+G +  +V +  Y  + C ++ A S G ++ VPC T ++AY++  L+ L +  HE V+L +     ++ I   D  +   R+  E ++G + + +    F  + + G++SE +N +L RI+   K +P+    +S DAD+ L  + YK L   K  +G   +  +  +GIER +        TW  +F  DGHL SRVQ+GSP  MK+  +P L           +E D+   +P   +  L W +D++L   F DRKEEL A    Y+R HPEL+ L+ADFLQ LL  KP++   FA DFFA F+++   G S + 
Sbjct:   16 ASVSAVEFIH-IAQRDLEQCLFADSLVTVSDSGRELGDFSVSVTKASYNEELCYLLHANSHGTIDDVPCGTSIVAYISRKLEILEENHHEYVKLEKKTVDRKIHIVRQDDQLVVDRVISE-REGVKTQTLK---FPLSSLDGFVSEASNFLLLRIMARQKIVPENMTFLSLDADSGLSKSVYKALGWQKQMVG---EDLVDIFGIERTIYSANLSSATWHCFFMPDGHLASRVQLGSPAVMKLLHLPFLLDGVIKTFFFLVEKDK---IPVMEKKPLIWEEDMELYSKFLDRKEELKADYSSYLRQHPELKALLADFLQFLLLRKPQDVFSFARDFFAPFASQSPPGKSQEF 356          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Xenopus
Match: ENSXETT00000050581.1 (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:100495462])

HSP 1 Score: 221.861 bits (564), Expect = 2.664e-66
Identity = 125/336 (37.20%), Postives = 202/336 (60.12%), Query Frame = 2
Query:  143 TASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGD----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNE-KREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSN 1135
            +AS  AL F+  +   +L    F D L+T +    E+G Y  +V+   Y+ D    +C +V A S+G ++GVPC T ++ +++  L+TL Q LHE V+L +G +LD+ T T   G  +   I + I +G +  RE T  +   + + G+ISE AN+++ RI+  + + +  + ++FD + NLC+++Y  L +    IG  +QT +  +GIER +    +VP TWQ ++ SDGHL + VQIGS + +K+  +P L E DE  P P F +  L+W++DLQL   F DRKEE  + +  Y+R HPE++ L+ADF+Q LL  KP++ + FA ++F  FS+
Sbjct:   38 SASSEALEFLRSVGQEELNLCLFADSLVTESVSGVEVGTYTVSVQPAYYELDGMEEKCFLVHAASQGSIDGVPCGTSIIGHISYKLETLEQHLHEYVKL-RGHSLDKKTQTVRQG--DEIVINRIITEGEKLHRETT--SHPASSLCGFISEAANLLIMRILARRKMKEPLEFLAFDEEANLCVSTYAALGSQTQMIG--KQT-VDVFGIERTIHS-PEVPTTWQCFYLSDGHLATHVQIGSSVTIKLTEMPILSEPDEKDPKPVFEKKPLDWQEDLQLHSEFLDRKEEFISDHETYLRRHPEMKVLLADFMQFLLLRKPDDIVDFAAEYFQPFSS 364          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Mouse
Match: Catip (ciliogenesis associated TTC17 interacting protein [Source:MGI Symbol;Acc:MGI:2685062])

HSP 1 Score: 157.918 bits (398), Expect = 1.813e-41
Identity = 99/335 (29.55%), Postives = 168/335 (50.15%), Query Frame = 2
Query:  146 ASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGD-----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFS 1132
            A P     +    L D+   FF + L   ++  +  G     V+ G YK D      C++V A S G ++   C + +L YLN +L+ + Q   E ++ P      ++++ + DG    + + + +K+G E +      F +    G++S  AN+VL R++   + +P     ++ D++  LC  +YK L    IQ+G+    Q + + +E+ +     +P + Q Y   DGHL  RVQ+GSP    +  +P + E D     P F +  L W +DL+L   F DRKE+L  ++  Y+R HPE Q L++DFL  LL  +PE+ + FA + F  F+
Sbjct:   16 AGPGETASLHHPGLEDM-LLFFPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQ---FVVTRSVKEGEETKTGVS-VFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGN---QQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHLAKRVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFRPFA 342          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Mouse
Match: Catip (ciliogenesis associated TTC17 interacting protein [Source:MGI Symbol;Acc:MGI:2685062])

HSP 1 Score: 156.762 bits (395), Expect = 3.238e-41
Identity = 95/315 (30.16%), Postives = 162/315 (51.43%), Query Frame = 2
Query:  206 FFIDDLMTFTEDDKEIGFYRANVKEGCYKGD-----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFS 1132
            FF + L   ++  +  G     V+ G YK D      C++V A S G ++   C + +L YLN +L+ + Q   E ++ P      ++++ + DG    + + + +K+G E +      F +    G++S  AN+VL R++   + +P     ++ D++  LC  +YK L    IQ+G+    Q + + +E+ +     +P + Q Y   DGHL  RVQ+GSP    +  +P + E D     P F +  L W +DL+L   F DRKE+L  ++  Y+R HPE Q L++DFL  LL  +PE+ + FA + F  F+
Sbjct:   16 FFPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQ---FVVTRSVKEGEETKTGVS-VFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGN---QQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHLAKRVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFRPFA 323          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Mouse
Match: Catip (ciliogenesis associated TTC17 interacting protein [Source:MGI Symbol;Acc:MGI:2685062])

HSP 1 Score: 89.7373 bits (221), Expect = 1.368e-19
Identity = 55/214 (25.70%), Postives = 104/214 (48.60%), Query Frame = 2
Query:  206 FFIDDLMTFTEDDKEIGFYRANVKEGCYKGD-----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHL 829
            FF + L   ++  +  G     V+ G YK D      C++V A S G ++   C + +L YLN +L+ + Q   E ++ P      ++++ + DG    + + + +K+G E +      F +    G++S  AN+VL R++   + +P     ++ D++  LC  +YK L    IQ+G+    Q + + +E+ +     +P + Q Y   DGHL
Sbjct:   60 FFPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQ---FVVTRSVKEGEETKTGVS-VFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGN---QQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHL 266          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. UniProt/SwissProt
Match: sp|Q0IHI3|CATIP_XENLA (Ciliogenesis-associated TTC17-interacting protein OS=Xenopus laevis OX=8355 GN=catip PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 9.078e-63
Identity = 122/330 (36.97%), Postives = 193/330 (58.48%), Query Frame = 2
Query:  161 LGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGD-----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSN 1135
            L F+  + L +L    F D L T +    E+G +  +V+   Y+ D     +C +V A S+G ++GVPC T ++ +++  L+TL Q +HE V+L +G +LD+ T     G  +   I + I +G EK      + + +++ G ISE AN+++ RI+  + + D    ++FD + NLC ++Y  L +    IG   +  +  +GIER +    +VP TWQ +F SDGHL S VQIGSP+ +K+  +P L E DE  P P F +  L W++DLQL   F DRKEEL + +  Y+R HPE++ L+ADF+Q LL  KP++ + FA ++F  FS+
Sbjct:   33 LEFLCSVGLEELNLCLFTDSLATVSVSGVELGNFAVSVQPAYYQLDGLEEEKCFLVHAASQGTIDGVPCGTSIIGHISYKLETLEQHVHEYVKL-KGHSLDKKTQIVRQG--DKLVINRIITEG-EKLHRETSSHSTSLLSGLISEAANLLIMRILARRKIKDPLKFLAFDEEGNLCTSTYAPLGSQAQVIG---KEMVDVFGIERTIHS-PEVPTTWQCFFLSDGHLASHVQIGSPVTIKLNEMPVLSEPDEKDPKPVFEKKPLAWQEDLQLHSEFLDRKEELISDHETYLRRHPEVKVLLADFMQFLLLRKPDDIMDFAAEYFKPFSS 354          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. UniProt/SwissProt
Match: sp|Q08CH6|CATIP_DANRE (Ciliogenesis-associated TTC17-interacting protein OS=Danio rerio OX=7955 GN=catip PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 5.866e-55
Identity = 119/352 (33.81%), Postives = 189/352 (53.69%), Query Frame = 2
Query:  146 ASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIM-SKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKL-----------IEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNRFIYGASSQL 1165
            AS +A+ FI  I   DL+   F D L+T ++  +E+G +  +V +  Y  + C ++ A S G ++ VPC T ++AY++  L+ L +  HE V+L +     ++ I   D  +   R+  E ++G + + +    F  + + G++SE +N +L RI+   K +P+    +S DAD+ L  + YK L   K  +G   +  +  +GIER +        TW  +F  DGHL SRVQ+GSP  MK+  +P L           +E D+   +P   +  L W +D++L   F DRKEEL A    Y+R HPEL+ L+ADFLQ LL  KP++   FA DFFA F+++   G S + 
Sbjct:   16 ASVSAVEFIH-IAQRDLEQCLFADSLVTVSDSGRELGDFSVSVTKASYNEELCYLLHANSHGTIDDVPCGTSIVAYISRKLEILEENHHEYVKLEKKTVDRKIHIVRQDDQLVVDRVISE-REGVKTQTLK---FPLSSLDGFVSEASNFLLLRIMARQKIVPENMTFLSLDADSGLSKSVYKALGWQKQMVG---EDLVDIFGIERTIYSANLSSATWHCFFMPDGHLASRVQLGSPAVMKLLHLPFLLDGVIKTFFFLVEKDK---IPVMEKKPLIWEEDMELYSKFLDRKEELKADYSSYLRQHPELKALLADFLQFLLLRKPQDVFSFARDFFAPFASQSPPGKSQEF 356          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. UniProt/SwissProt
Match: sp|Q7Z7H3|CATIP_HUMAN (Ciliogenesis-associated TTC17-interacting protein OS=Homo sapiens OX=9606 GN=CATIP PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 3.023e-45
Identity = 102/338 (30.18%), Postives = 173/338 (51.18%), Query Frame = 2
Query:  137 IPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGD-----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNE-KREVTERTFAHAVMHGYISEGANIVLQRIIMSKGL-PDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATF 1129
            +P A+  A+ F+  +   +L+  FF + L   ++  +  G     V+ G Y+        C+ V A S G ++ + C   +L YL+  L+ + Q   + ++        ++++ + D  +    + + IK+G E K  VT  +F  + + G+ISE AN+VL R++  + + P     ++ D +  LC  +Y++L    IQ+      Q   + +E+ +     +P++ Q Y  SDGHL  R+Q+GSP    +  +P L E DE  P P F +  L W +D++L   F DRKEEL   +  Y+R HPE   LI+DFL  LL  +PE+ + FA +FF  F
Sbjct:   25 LPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLA---VTRSIKEGEEVKTGVT--SFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQV---DHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPF 354          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. UniProt/SwissProt
Match: sp|M0RAU5|CATIP_RAT (Ciliogenesis-associated TTC17-interacting protein OS=Rattus norvegicus OX=10116 GN=Catip PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.549e-41
Identity = 98/315 (31.11%), Postives = 165/315 (52.38%), Query Frame = 2
Query:  206 FFIDDLMTFTEDDKEIGFYRANVKEGCYKGD-----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFS 1132
            FF + L   ++  +  G     V++G YK D      C++V A S G ++   C + +L YLN  L+ + Q   E ++ P      ++++ + D  +    + + +K+G E +      F    + G++S  AN+VL R++   + +P     ++ D++  LC  +YK L    IQ+G+ QQ ++  + +E+ +     +P + Q Y  SDGHL  RVQ+GSP    +  +P + E D   P P F R  L W +DL+L   F DRKE+L  ++  Y+R HPE Q L++DFL  LL  +PE+ + FA + F  F+
Sbjct:   34 FFPETLAILSDTGEPQGELTIEVQKGKYKDDLGILTHCLLVHASSRGFLDKSVCGSSLLGYLNEHLELMEQHSQEFIKFPIIPMERKMSVLKQDDQL---VVSRSVKEGEETKTGVS-VFPCKSLKGFVSSAANVVLLRVMAWRQSVPSGARFLALDSEGKLCYCTYKSLGFQTIQVGN-QQAEM--FIVEQTIHSEDGIPFSCQFYLLSDGHLAKRVQVGSPGCCIITKMPLIREEDVIEPPPTFDRKPLVWEEDLELYSKFLDRKEQLRLSHTRYLRQHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFGPFA 341          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. UniProt/SwissProt
Match: sp|B9EKE5|CATIP_MOUSE (Ciliogenesis-associated TTC17-interacting protein OS=Mus musculus OX=10090 GN=Catip PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.268e-40
Identity = 99/335 (29.55%), Postives = 168/335 (50.15%), Query Frame = 2
Query:  146 ASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGD-----ECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFS 1132
            A P     +    L D+   FF + L   ++  +  G     V+ G YK D      C++V A S G ++   C + +L YLN +L+ + Q   E ++ P      ++++ + DG    + + + +K+G E +      F +    G++S  AN+VL R++   + +P     ++ D++  LC  +YK L    IQ+G+    Q + + +E+ +     +P + Q Y   DGHL  RVQ+GSP    +  +P + E D     P F +  L W +DL+L   F DRKE+L  ++  Y+R HPE Q L++DFL  LL  +PE+ + FA + F  F+
Sbjct:   16 AGPGETASLHHPGLEDM-LLFFPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQ---FVVTRSVKEGEETKTGVS-VFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGN---QQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHLAKRVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFRPFA 342          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. TrEMBL
Match: A0A1I8I1U5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.925e-96
Identity = 155/372 (41.67%), Postives = 231/372 (62.10%), Query Frame = 2
Query:   41 MSIPRAITGISKADSVLSHLSQPPVTLTVPNDIPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNRFIYGAS 1156
            M+  RA+TG S   ++ S  +Q P  L +P + P +S +AL F+ ++   D  Y  F D L++ +E  K++G Y+ +V++    GD C++V A S G+++ VPC T +  Y+  +L+T+ QR HE V+L       R+ I   D   EG R+ K + QG E++E   +   +  M G+ISEGAN++LQR++++K  P +FDV+SFD+D+NLC ASY  L      IG      ++  G++R +Q +TDVP +WQTYF  D HLI+R Q+GSP+ MKV  +P+LIE DE +P P FP+  L W DDL+L   + +RKE + A +  YMR HPEL  +++DFLQ LL  KP N +Q A ++FA+FS R    AS
Sbjct:    1 MASARAVTGTSAVSNLPSEPTQLP-ELEIPENPPVSSDSALAFLRELQEDDFTYLLFEDSLVSVSEQGKQLGEYKMSVEKAIKFGDPCLLVTASSHGLIDNVPCGTSISCYVTFNLETIEQRQHEYVKLENHPLDRRVDIVRCD---EGLRVTKNVVQG-ERKETASKVMPYGAMEGFISEGANLLLQRLLITKIFPSFFDVLSFDSDSNLCQASYTFLGEKSQLIGG---QPVQVLGVQRVIQSMTDVPTSWQTYFLKDSHLITRAQVGSPVIMKVLQIPELIEPDERIPKPDFPKRELQWEDDLELYSRYSERKEAIKADHLSYMRDHPELSAMMSDFLQHLLLRKPANPVQSAAEYFASFSTRLPPQAS 364          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. TrEMBL
Match: K1PAC7 (Uncharacterized protein C2orf62-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10005459 PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 2.225e-90
Identity = 156/366 (42.62%), Postives = 228/366 (62.30%), Query Frame = 2
Query:   41 MSIPRAITGISKAD-SVLSHLSQPPVTLTVPNDIPTASPNALGFIEKITLTD-LKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFS 1132
            MS     T +S +D   ++   QPP    VP +IPT S  AL FI+ I   D  KY  F D L+T ++  KE+G +  +V+   YK  +C ++ A S G ++GVPC T + AY+  +L+T+ Q+ HE V+L +   LDR T        + + I + I QG E  + + +T   A M G+ISEG+N++L R+++ KG+PD    +SFD+DTNLC   Y+ L      +GS   T++R +G+ER +   +D+P TWQ+YF  D H+ +RVQ+GSP+ MK+ SVP+LIE DE  P P F +  L+W DD+QL   F DRKEEL   +  YMRSHPEL++L+ADFLQ LL  KP++ +QFA ++F++FS
Sbjct:    1 MSAVTTATSVSTSDPGSVTTGRQPPDQ--VPEEIPTVSDEALRFIDSIVAEDDYKYLMFDDHLVTVSDTGKELGEFTISVEPTRYKQTDCFLIHANSHGSIDGVPCGTSITAYVAQNLETIEQQHHEYVKL-ENCPLDRKTF--IVKQPDNFIINRVITQG-EDVQRSSKTVELAKMKGFISEGSNLLLHRLLIEKGIPDNLQFLSFDSDTNLCSVIYRPLEDRTQTVGS---TEIRVFGVERTINSYSDLPTTWQSYFMQDCHMTNRVQVGSPVTMKLTSVPQLIERDEEPPKPVFEKKALSWEDDMQLYSKFLDRKEELKGDHTTYMRSHPELKNLLADFLQFLLLRKPDDVVQFAAEYFSSFS 357          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. TrEMBL
Match: A0A2T7PAS9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09785 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 7.596e-88
Identity = 149/344 (43.31%), Postives = 212/344 (61.63%), Query Frame = 2
Query:  104 QPPVTLTVPNDIPTASPNALGFI-EKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFS 1132
            QPPVT     D+P  SP AL F+   +   D KY  F D L+T ++  KE+G +   V+   ++G EC +V A S G ++GVPC T ++ ++  ++ TL Q  HE V+L +   LDR TI     + E Y I + I QG E  + T R+     M G+ISEG+N++L R+ M KGL +    VSFD++TNLC A Y+   AL+ +  S +  ++  YG+ER +    D+P TWQ+YF +DGHL +RVQIGSP+ MK+  +P +IE DE  P P F +  LNW +D+Q+   F DRKEEL   + +YMR HPEL+ L+ADFLQ LL  KP++ I FA ++F+ FS
Sbjct:   23 QPPVT----TDVPKTSPEALNFLLSLVPEEDFKYLMFDDALVTVSDTGKELGEFTVTVEPAKHRGQECFLVHANSHGAIDGVPCGTSIVCHVAKNMDTLEQHHHEYVKL-ENCPLDRKTI--ITKTNESYVINRVITQG-EDVQRTSRSVPVEAMRGFISEGSNLLLHRLFMEKGLQEELQFVSFDSETNLCPAIYR---ALEERTQSVEGVEIHVYGVERTINSTVDLPTTWQSYFMTDGHLTNRVQIGSPVTMKLIHLPAMIERDEETPKPVFEKKPLNWEEDVQMYSKFLDRKEELKGDHAVYMRHHPELKALLADFLQFLLLRKPQDVIAFAAEYFSAFS 355          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. TrEMBL
Match: A0A267FSF4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032198g1 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.118e-85
Identity = 137/317 (43.22%), Postives = 201/317 (63.41%), Query Frame = 2
Query:  206 FFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNRFIYGAS 1156
             F D L++ +E  K++G Y+ +V++    GD C++V A S G+++ VPC T +  Y+  +L+T+ QR HE V+L       R+ I   D   EG R+ K + QG E++E   +   +  M G+ISEGAN++LQR++++K  P +FDV+SFD+D+NLC ASY  L      IG      ++  G++R +Q +TDVP +WQTYF  D HLI+R Q+GSP+ MKV  +P+LIE DE +P P FP+  L W DDL+L   + +RKE + A +  YMR HPEL  +++DFLQ LL  KP N +Q A ++FA+FS R    AS
Sbjct:    2 LFEDSLVSVSEQGKQLGEYKMSVEKAIKFGDPCLLVTASSHGLIDNVPCGTSISCYVTFNLETIEQRQHEYVKLENHPLDRRVDIVRCD---EGLRVTKNVVQG-ERKETASKVMPYGAMEGFISEGANLLLQRLLITKIFPSFFDVLSFDSDSNLCQASYTFLGEKSQLIGG---QPVQVLGVQRVIQSMTDVPTSWQTYFLKDSHLITRAQVGSPVIMKVLQIPELIEPDERIPKPDFPKRELQWEDDLELYSRYSERKEAIKADHLSYMRDHPELSAMMSDFLQHLLLRKPANPVQSAAEYFASFSTRLPPQAS 311          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. TrEMBL
Match: A0A3S1ABE8 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_004742 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.510e-83
Identity = 144/345 (41.74%), Postives = 206/345 (59.71%), Query Frame = 2
Query:  104 QPPVTLTVPNDIPTASPNALGFIEKITLT-DLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSN 1135
            +P V      +IP  SP AL ++++I    D KY  F D L+T ++  KE+G +   V+   YKG EC ++ A S G ++GVPC T ++ Y++  L TL Q+ HE V+L     LDR T        + Y I + I QG + +  T+       M G+ISEG+N++L R+++ K + D    +SFD+DTNLC   YK   +L  +  + +  +LR YG+ER +    D+P TWQ+YF +DGHL +RVQ+GSP+ MK+  VP  IE DE  P P F +  LNW +D+Q+   F DRKEEL   +  YMR HPEL+ L+ADFLQ LL  KP++ I FA D+F+ FS 
Sbjct:   19 EPTVQPAQTTEIPKTSPQALKYLDEIVPEEDFKYVMFDDQLVTVSDAGKELGEFTVTVEPTRYKGLECFLIHANSHGSIDGVPCGTSIVCYVSKCLDTLEQQHHEYVKL-DNCPLDRKTF--LVRQSDHYTISRVITQGEDVQRTTKNVPVEQ-MRGFISEGSNLLLHRLLIEKRMDDDLQFISFDSDTNLCPVIYK---SLDERTQTVEDVELRVYGVERTINSTVDLPTTWQSYFMNDGHLTNRVQVGSPVTMKLAKVPVRIERDEETPKPVFEKKRLNWEEDMQMHSKFVDRKEELKGDHASYMRHHPELRALLADFLQFLLLRKPDDVIAFAADYFSAFST 356          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Cavefish
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:103037303])

HSP 1 Score: 229.565 bits (584), Expect = 7.427e-70
Identity = 123/337 (36.50%), Postives = 195/337 (57.86%), Query Frame = 2
Query:  134 DIPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDR-LTITEFDGSVEGYRIRKEIKQGNEKREVTERTFA---HAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATF 1129
            D P ASP AL F+  I   ++    F D L+T ++  +E+G +  ++++  Y+ + C +V A S G ++ +PC T + AY+++SL+TL Q  HE +++ Q   LDR + +   DG +   R+        EK EV ++TF    H++  G++SE  N ++ RI+   K +P+    +SF+ADT L +A+Y++L   K  +G   +  +  +GIE  +    D+  +W  YF  DGHL SRVQ+GSP+ M +  +P +   +E    P F +  L W +D++L   F DRKEEL A +  Y+R HPEL+ L+ADF+Q LL  KP++   FA DFFA F
Sbjct:   12 DQPKASPEALAFLSSIGHREVDQCLFADSLVTISDSGRELGEFSVSIQKASYENEPCYMVHANSHGAIDNIPCGTSITAYVSSSLETLEQNHHEYMKV-QEHMLDRKVNMVRRDGCLVVNRVT------TEKEEVKKQTFTLPLHSI-QGFVSEATNFIILRILAQQKKIPEKIMFLSFNADTQLSVATYRELGTKKQVVG---KEMVDVFGIEMTISSGDDIQASWHCYFLPDGHLASRVQLGSPVTMNLLQLPPIANKEERDQKPVFEKKPLVWEEDMELHSKFLDRKEELKAGHSSYVRDHPELKTLLADFMQFLLLRKPQDVFSFAQDFFAPF 337          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Cavefish
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:103037303])

HSP 1 Score: 218.394 bits (555), Expect = 1.774e-65
Identity = 123/356 (34.55%), Postives = 196/356 (55.06%), Query Frame = 2
Query:  134 DIPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDV-------------------LAYLNASLQTLYQRLHEVVRLPQGGALDR-LTITEFDGSVEGYRIRKEIKQGNEKREVTERTFA---HAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATF 1129
            D P ASP AL F+  I   ++    F D L+T ++  +E+G +  ++++  Y+ + C +V A S G ++ +PC T +                   +AY+++SL+TL Q  HE +++ Q   LDR + +   DG +   R+        EK EV ++TF    H++  G++SE  N ++ RI+   K +P+    +SF+ADT L +A+Y++L   K  +G   +  +  +GIE  +    D+  +W  YF  DGHL SRVQ+GSP+ M +  +P +   +E    P F +  L W +D++L   F DRKEEL A +  Y+R HPEL+ L+ADF+Q LL  KP++   FA DFFA F
Sbjct:   12 DQPKASPEALAFLSSIGHREVDQCLFADSLVTISDSGRELGEFSVSIQKASYENEPCYMVHANSHGAIDNIPCGTSITEKRYNLEDTTGPIPGDAFIAYVSSSLETLEQNHHEYMKV-QEHMLDRKVNMVRRDGCLVVNRVT------TEKEEVKKQTFTLPLHSI-QGFVSEATNFIILRILAQQKKIPEKIMFLSFNADTQLSVATYRELGTKKQVVG---KEMVDVFGIEMTISSGDDIQASWHCYFLPDGHLASRVQLGSPVTMNLLQLPPIANKEERDQKPVFEKKPLVWEEDMELHSKFLDRKEELKAGHSSYVRDHPELKTLLADFMQFLLLRKPQDVFSFAQDFFAPF 356          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Cavefish
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:103037303])

HSP 1 Score: 212.231 bits (539), Expect = 1.239e-63
Identity = 117/336 (34.82%), Postives = 186/336 (55.36%), Query Frame = 2
Query:  134 DIPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFA---HAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATF 1129
            D P ASP AL F+  I   ++    F D L+T ++  +E+G +  ++++  Y+ + C +V A S G ++ +PC T + AY+++SL+TL Q  HE ++                G V  Y ++          EV ++TF    H++  G++SE  N ++ RI+   K +P+    +SF+ADT L +A+Y++L   K  +G   +  +  +GIE  +    D+  +W  YF  DGHL SRVQ+GSP+ M +  +P +   D+    P F +  L W +D++L   F DRKEEL A +  Y+R HPEL+ L+ADF+Q LL  KP++   FA DFFA F
Sbjct:   12 DQPKASPEALAFLSSI---EVDQCLFADSLVTISDSGRELGEFSVSIQKASYENEPCYMVHANSHGAIDNIPCGTSITAYVSSSLETLEQNHHEYMKC-------------LYGKVHVYLLQ----------EVKKQTFTLPLHSI-QGFVSEATNFIILRILAQQKKIPEKIMFLSFNADTQLSVATYRELGTKKQVVG---KEMVDVFGIEMTISSGDDIQASWHCYFLPDGHLASRVQLGSPVTMNLLQLPPIANKDQ---KPVFEKKPLVWEEDMELHSKFLDRKEELKAGHSSYVRDHPELKTLLADFMQFLLLRKPQDVFSFAQDFFAPF 314          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Sea Lamprey
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:767803])

HSP 1 Score: 167.548 bits (423), Expect = 4.961e-47
Identity = 111/342 (32.46%), Postives = 174/342 (50.88%), Query Frame = 2
Query:  146 ASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYK------GDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEK-REVTERTFAHAVMHGYISEGANIVLQRIIMSKG-LPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPV-----PAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFS 1132
            AS  A+ F+  I   +L +  F D+LMT + D   +G +R  V    Y+      G    +V A S+G +  +PC T V AY+  +L TL Q  HE + L +  ALDR    E     E   + K + +G E  RE      +H  + G++SE + ++L R++  +  +P     +  D+++ L   +++ L   ++ IG   + ++  +GIER L   T  P TW +Y+  DGHL+ R Q+GSP  M +  +P      E             +  LNW +D+Q+   F DRKEEL + +  Y R+HPEL+ L+ DFLQ LL  KP + +  A  +FA+FS
Sbjct:    1 ASEEAINFLASIDPQELSHCLFGDELMTMSRDGTHLGEFRMRVYSAPYREHPDSGGGTRFLVHATSKGAINDIPCGTTVCAYVTTNLATLEQHHHEYLELNEQ-ALDR--KVELVWQEESLLVNKVVTEGEEVLRESVRLEMSH--LAGFLSEASCLLLTRLLTRRAHVPHDLTFLCLDSESCLATCTFRSLGTEELSIG---EKKVEVFGIERTLYSQTAPPTTWHSYYLLDGHLVRREQVGSPTTMMIVRLPAQTPAAEEAEEEGDTDSGVEQQTLNWEEDMQMYSRFLDRKEELLSEHAEYARAHPELRALLGDFLQYLLLRKPADPVACAAPYFASFS 334          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Nematostella
Match: EDO33354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE5])

HSP 1 Score: 117.472 bits (293), Expect = 8.013e-31
Identity = 65/160 (40.62%), Postives = 99/160 (61.88%), Query Frame = 2
Query:  209 FIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASY 688
            F D L+T +   +EIG     V++  +K + C++V A S G+V+ VP  T V AY+N SL T+ Q  +E V++P+   LD+ T    D +  GY IRK I QG E R+ TE  F+     G+ISEG+N+++QRI++ KG+P     ++FD++TNL  +SY
Sbjct:    3 FPDTLVTTSTTGREIGEMSVTVEKVVWKDESCLLVHANSHGVVDQVPIGTSVTAYINRSLATIEQTHYEYVKIPE-KPLDKRTYLTLDET--GYTIRKTISQGEEVRK-TESHFSPEDFQGFISEGSNLLIQRIMILKGVPPDMTFLAFDSETNLSTSSY 158          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Medaka
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:101159136])

HSP 1 Score: 172.17 bits (435), Expect = 1.939e-48
Identity = 95/332 (28.61%), Postives = 177/332 (53.31%), Query Frame = 2
Query:  140 PTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLR-CYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATF 1129
            P AS +A+  +      +L+   F + L+  +E  +E+G +   V+        C+++ A+S G ++G PC T V A+++  L+ L +  HE ++L      +R  + + DG++    + +++    E+      ++  + + G I+EG++++L R+I + K +P+    V+ D   N+   ++ DL   ++++      Q+R  +GI+R + C    P TW+ YF ++GHL+SR Q+GSP+ M++   P   E  E + +    R           T  F +R++EL     LY+R HPE++ LI+DF+Q LL  KPEN  +FA ++F+ F
Sbjct:   25 PEASDDAVALMSSFEPEELQRCVFTESLVVLSESGRELGTFNVTVQYAQKVQQPCLLLHAQSHGTIDGAPCGTTVTAFISCELEVLEEEYHEYIKLEGHSVDNRCHMVQKDGNI----LIEKVTTIEEEVTKESASYPMSSLRGLITEGSSLLLMRLITLRKTVPENMQFVTLDKQLNIIHITFSDLGEKQMEVSG----QVREVFGIQRMVHCGKGRPDTWENYFLTNGHLVSRHQVGSPVTMRLLQQPPRTEGPEKVSLTQVER-----------TVDFLERQKELKEEYALYLRQHPEIRALISDFMQFLLLRKPENVYKFAKEYFSPF 337          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Medaka
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:101159136])

HSP 1 Score: 172.17 bits (435), Expect = 1.939e-48
Identity = 95/332 (28.61%), Postives = 177/332 (53.31%), Query Frame = 2
Query:  140 PTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRII-MSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLR-CYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATF 1129
            P AS +A+  +      +L+   F + L+  +E  +E+G +   V+        C+++ A+S G ++G PC T V A+++  L+ L +  HE ++L      +R  + + DG++    + +++    E+      ++  + + G I+EG++++L R+I + K +P+    V+ D   N+   ++ DL   ++++      Q+R  +GI+R + C    P TW+ YF ++GHL+SR Q+GSP+ M++   P   E  E + +    R           T  F +R++EL     LY+R HPE++ LI+DF+Q LL  KPEN  +FA ++F+ F
Sbjct:   25 PEASDDAVALMSSFEPEELQRCVFTESLVVLSESGRELGTFNVTVQYAQKVQQPCLLLHAQSHGTIDGAPCGTTVTAFISCELEVLEEEYHEYIKLEGHSVDNRCHMVQKDGNI----LIEKVTTIEEEVTKESASYPMSSLRGLITEGSSLLLMRLITLRKTVPENMQFVTLDKQLNIIHITFSDLGEKQMEVSG----QVREVFGIQRMVHCGKGRPDTWENYFLTNGHLVSRHQVGSPVTMRLLQQPPRTEGPEKVSLTQVER-----------TVDFLERQKELKEEYALYLRQHPEIRALISDFMQFLLLRKPENVYKFAKEYFSPF 337          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Medaka
Match: ENSORLT00000033757.1 (regulatory subunit of type II PKA R-subunit domain containing 1 [Source:NCBI gene;Acc:101173333])

HSP 1 Score: 47.3654 bits (111), Expect = 1.342e-6
Identity = 18/42 (42.86%), Postives = 30/42 (71.43%), Query Frame = 2
Query: 1007 NRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFS 1132
            N  Y+R+HPE++ LI DFL+ +L  +P +  +FAGD+F+  +
Sbjct:   34 NEKYIRAHPEVEVLIGDFLREILLKRPADIREFAGDYFSRLN 75          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Planmine SMEST
Match: SMESG000009424.1 (SMESG000009424.1)

HSP 1 Score: 813.527 bits (2100), Expect = 0.000e+0
Identity = 390/390 (100.00%), Postives = 390/390 (100.00%), Query Frame = 2
Query:   41 MSIPRAITGISKADSVLSHLSQPPVTLTVPNDIPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNRFIYGASSQLHSQHPGMLLSDHTPM 1210
            MSIPRAITGISKADSVLSHLSQPPVTLTVPNDIPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNRFIYGASSQLHSQHPGMLLSDHTPM
Sbjct:    1 MSIPRAITGISKADSVLSHLSQPPVTLTVPNDIPTASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNRFIYGASSQLHSQHPGMLLSDHTPM 390          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Planmine SMEST
Match: SMESG000029479.1 (SMESG000029479.1)

HSP 1 Score: 233.032 bits (593), Expect = 2.957e-71
Identity = 115/331 (34.74%), Postives = 189/331 (57.10%), Query Frame = 2
Query:  146 ASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNR 1138
            A+P+AL F+  I + DL+Y  + D L  FT    ++G Y   +K+ CY    CI V+ R+E  + G+ C T + +++   L+TLYQ   E+++        ++ +   +   +GY I KE+ + N+  E   + F+  +M GY+SEGA+++L R+++++ +PD F ++ F+    L  A++K L  +K+ I   +   +   GIER +    D    WQ YF  DGHL+S+ Q+GSP+ MKV  +   +E D FL  P F    LNW DD+QL   F D KE   + +  Y++ H E+++L+  F+QA+L  KP N ++FA  +F TFS+R
Sbjct:   17 ATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSME---KGYEISKEMIE-NDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKTLETIKLPISDEK---VAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSR 340          
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Planmine SMEST
Match: SMESG000005270.1 (SMESG000005270.1)

HSP 1 Score: 52.373 bits (124), Expect = 9.553e-7
Identity = 24/43 (55.81%), Postives = 31/43 (72.09%), Query Frame = 2
Query: 1394 ISIEKIADMLDDDGRPITTFVLNKYYRTGSKSYRVNICAEERS 1522
            I++     MLDD+G+ + TFVL KYYRTG   YR+NI AE+RS
Sbjct: 2325 ITLTTQGGMLDDEGKLLDTFVLTKYYRTGPNRYRINIHAEKRS 2367          
The following BLAST results are available for this feature:
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CATIP6.295e-4630.18ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
catip7.770e-5633.81ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000050581.12.664e-6637.20ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Catip1.813e-4129.55ciliogenesis associated TTC17 interacting protein ... [more]
Catip3.238e-4130.16ciliogenesis associated TTC17 interacting protein ... [more]
Catip1.368e-1925.70ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IHI3|CATIP_XENLA9.078e-6336.97Ciliogenesis-associated TTC17-interacting protein ... [more]
sp|Q08CH6|CATIP_DANRE5.866e-5533.81Ciliogenesis-associated TTC17-interacting protein ... [more]
sp|Q7Z7H3|CATIP_HUMAN3.023e-4530.18Ciliogenesis-associated TTC17-interacting protein ... [more]
sp|M0RAU5|CATIP_RAT1.549e-4131.11Ciliogenesis-associated TTC17-interacting protein ... [more]
sp|B9EKE5|CATIP_MOUSE1.268e-4029.55Ciliogenesis-associated TTC17-interacting protein ... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I1U51.925e-9641.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1PAC72.225e-9042.62Uncharacterized protein C2orf62-like protein OS=Cr... [more]
A0A2T7PAS97.596e-8843.31Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A267FSF41.118e-8543.22Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3S1ABE81.510e-8341.74Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
catip7.427e-7036.50ciliogenesis associated TTC17 interacting protein ... [more]
catip1.774e-6534.55ciliogenesis associated TTC17 interacting protein ... [more]
catip1.239e-6334.82ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
catip4.961e-4732.46ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO333548.013e-3140.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
catip1.939e-4828.61ciliogenesis associated TTC17 interacting protein ... [more]
catip1.939e-4828.61ciliogenesis associated TTC17 interacting protein ... [more]
ENSORLT00000033757.11.342e-642.86regulatory subunit of type II PKA R-subunit domain... [more]
back to top
BLAST of Ciliogenesis-associated TTC17-interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000009424.10.000e+0100.00SMESG000009424.1[more]
SMESG000029479.12.957e-7134.74SMESG000029479.1[more]
SMESG000005270.19.553e-755.81SMESG000005270.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015332 ID=SMED30015332|Name=Ciliogenesis-associated TTC17-interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1699bp
ATGACGGTTTCTATGGCAAAATAAATTTTATTATTTAAAAATGAGTATTC
CTAGAGCAATTACAGGAATCAGTAAAGCAGATTCTGTTTTGTCACATTTA
TCGCAGCCACCAGTAACATTAACAGTTCCTAATGATATCCCAACTGCAAG
TCCAAATGCATTAGGTTTCATTGAAAAGATTACATTGACAGATTTGAAGT
ATACGTTTTTCATTGATGATTTAATGACATTTACTGAAGATGATAAAGAA
ATTGGATTTTATCGGGCAAATGTCAAGGAAGGATGTTATAAAGGTGACGA
ATGCATAATCGTCGAGGCTCGTAGTGAAGGTATTGTAGAAGGGGTTCCTT
GCTTCACAGACGTTTTAGCATATTTGAATGCATCATTACAAACACTTTAT
CAGCGACTCCATGAAGTAGTTCGGTTACCACAAGGGGGGGCCTTAGACCG
CTTGACTATTACCGAGTTTGATGGCAGCGTTGAAGGCTATCGAATACGAA
AGGAAATCAAACAAGGTAATGAAAAACGTGAGGTAACAGAGCGAACATTT
GCGCATGCTGTGATGCACGGCTACATTTCCGAGGGGGCTAATATCGTCCT
TCAACGGATTATTATGTCAAAAGGCTTACCTGACTATTTTGATGTCGTAA
GTTTCGATGCTGACACAAATTTATGCCTGGCAAGTTATAAAGACCTCGCC
GCTTTGAAAATTCAAATCGGATCACCGCAACAAACCCAGTTGCGTTGCTA
TGGCATTGAGCGCAGATTGCAGTGCCTCACGGATGTGCCGGTCACCTGGC
AAACGTATTTTCAATCGGATGGCCATCTGATTAGTCGAGTGCAAATTGGC
AGTCCTCTGCAAATGAAAGTCCGCTCTGTGCCGAAATTAATCGAACACGA
TGAATTCCTTCCGGTTCCGGCATTCCCTCGTGCCCATCTCAACTGGCGTG
ATGATTTGCAACTGACGAGGATTTTCCAGGACCGCAAGGAAGAGCTGGCA
GCTGCCAATCGTCTCTATATGCGATCGCATCCGGAACTGCAGCATTTGAT
CGCCGATTTCCTTCAGGCCTTGCTCGCTCACAAACCGGAAAATACAATTC
AATTCGCTGGGGATTTTTTCGCAACGTTTTCCAACAGATTTATCTACGGA
GCGAGTTCTCAGTTGCATTCACAACATCCAGGAATGCTCCTGTCGGATCA
TACTCCAATGTGACTCTGGCAATAAATGATATTTCTTACCTTGTTGTTAT
TTCTTTATTATTTTCATTACAACAATTTGCAATCAATAGTCTACATTGTA
TCCGCATTTCACTAGTTACGCTATAATGCAGTGGTACACAATGTGCCGTA
CAACGGGGCTTTTGTGACATTTGAGAGCTATTTTGTTTTATATATTTCCA
TTGAAAAAATAGCAGATATGTTGGATGATGATGGTAGGCCCATCACCACA
TTTGTGTTAAACAAGTATTACAGAACGGGGTCAAAGAGCTACAGGGTAAA
TATATGCGCAGAAGAGCGATCGAATCCCAACAATTCGGACAATCCAAATC
AAATCAAGAAATACAAATCCCAATGCAAACCCTAAAGAACTTTGAATATT
TCGATTGATATCATCTGACTGATTTTAAATACGATGTGACTATGACTATC
TTATCAATTTCATTCTGAACTTTTAATTCATTATTTTATTGTATTGCAG
back to top

protein sequence of SMED30015332-orf-1

>SMED30015332-orf-1 ID=SMED30015332-orf-1|Name=SMED30015332-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=391bp
MSIPRAITGISKADSVLSHLSQPPVTLTVPNDIPTASPNALGFIEKITLT
DLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVE
GVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGY
RIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYF
DVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVP
VTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHL
NWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPE
NTIQFAGDFFATFSNRFIYGASSQLHSQHPGMLLSDHTPM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0015629actin cytoskeleton
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0030041actin filament polymerization
GO:0044782cilium organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR15505:SF3CILIOGENESIS-ASSOCIATED TTC17-INTERACTING PROTEINcoord: 45..378
NoneNo IPR availablePANTHERPTHR15505FAMILY NOT NAMEDcoord: 45..378
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 342..376