Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30015320
Length (bp)1138
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30015320) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30015320) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015320

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30015320h1SMcG0005583 DN309904.1smed_ncbi_20240424PMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30015320h1SMcG0005583 HO005219.1smed_ncbi_20240424PMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30015320h1SMcG0005583 Contig4100_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 462.611 bits (1189), Expect = 1.175e-163
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++I++LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 462.611 bits (1189), Expect = 1.175e-163
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++I++LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 462.611 bits (1189), Expect = 1.175e-163
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++I++LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CA (protein phosphatase 1 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9281])

HSP 1 Score: 461.07 bits (1185), Expect = 6.184e-163
Identity = 212/298 (71.14%), Postives = 256/298 (85.91%), Query Frame = 3
Query:  126 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTK 1019
            S  +NL++II +LLE + S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D++G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K
Sbjct:    4 SEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 457.218 bits (1175), Expect = 1.282e-161
Identity = 209/296 (70.61%), Postives = 254/296 (85.81%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +N+++II +LLE + S   K V L E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D+ G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-2 (Serine/threonine-protein phosphatase PP1-beta [Source:UniProtKB/Swiss-Prot;Acc:P48727])

HSP 1 Score: 461.07 bits (1185), Expect = 2.205e-163
Identity = 211/296 (71.28%), Postives = 255/296 (86.15%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +NL+ IIS+LLE + S   K V LTE EIKGLC KS+EIF+SQ  LLELEAPLKICGD+HGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D+ G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG+MM+VDE L+CSF +LKP  K+
Sbjct:    6 LNLDNIISRLLEVRGSKPGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVDETLMCSFQILKPADKK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-1 (Serine/threonine-protein phosphatase PP1-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q27497])

HSP 1 Score: 457.218 bits (1175), Expect = 7.626e-162
Identity = 208/301 (69.10%), Postives = 253/301 (84.05%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            +N++ +I++LLE +     K V ++E EI+ LC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYK+K+PENFFLLRGNHE +++NR+YGFYDE KRR+SIK+WK FTD FN LP AALIDEKI C HGGLSP L+  +Q+R + RPT+VPD GL CD+LW+DP++D+ G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    7 LNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLKICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDLQNMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-1 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EC18])

HSP 1 Score: 397.127 bits (1019), Expect = 7.776e-138
Identity = 183/295 (62.03%), Postives = 234/295 (79.32%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTK 1019
            +N++ +IS L+  K  +  K +++TE EI+ +C  +++IFM Q  LLELE PLKI GDIHGQ+ DLLRLF+  GYPP +NYLFLGDYVDRG +SIE + LLL YKIK+P NFFLLRGNHE + LNR+YGFYDE KRRYS+K+WK F D+FN +P AALID KI C HGGLSP+L+   QL+ + RP +V + GL CD+LW+DP+  + G+  N+RGVSYVFG D + +FL + D+D++ R HQVVEDGYEFF +R LVT+FSAPNYCGEFDNAGA+M+VDENLLCSF +LKPQ++
Sbjct:   14 LNIDQLISTLVSVKPWH--KTLDVTENEIRMVCVLARQIFMHQPMLLELEPPLKIGGDIHGQFADLLRLFNLAGYPPESNYLFLGDYVDRGPKSIETIVLLLCYKIKYPNNFFLLRGNHEVANLNRIYGFYDECKRRYSVKLWKCFQDVFNCMPVAALIDNKIFCCHGGLSPNLRSLDQLKRLSRPCDVQETGLLCDVLWSDPDATVVGWAPNERGVSYVFGVDVLAQFLQKMDLDIVVRGHQVVEDGYEFFGRRGLVTVFSAPNYCGEFDNAGAVMNVDENLLCSFQILKPQSQ 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-3 (Serine/threonine-protein phosphatase PP1-gamma [Source:UniProtKB/Swiss-Prot;Acc:O02658])

HSP 1 Score: 368.237 bits (944), Expect = 3.703e-127
Identity = 162/302 (53.64%), Postives = 224/302 (74.17%), Query Frame = 3
Query:  126 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRY-SIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 1028
            +  ++++ ++S+LL    S      ++ E E++  C+ +K +F SQ+SLLE+E P+ +CGDIHGQY DLLR+FD  G+PP  N+LFLGDYVDRG+Q+IE +CL+L +KIK+PENFF+LRGNHE  A+NRVYGFY+E  RRY S ++W +F D FN +P   LI  +I+C HGGLSP L+   QLR + RP + P+  +  D+LWADP++ +KG++ N RGVSYVFG+D V    +  DIDL+ RAHQVV+DGYEFF  +K+VTIFSAP+YCG+FDN+ A M VDEN++C+F + KP  K M+
Sbjct:    2 TAPMDVDNLMSRLLNVGMSGGRLTTSVNEQELQTCCAVAKSVFASQASLLEVEPPIIVCGDIHGQYSDLLRIFDKNGFPPDVNFLFLGDYVDRGRQNIETICLMLCFKIKYPENFFMLRGNHECPAINRVYGFYEECNRRYKSTRLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPHLQTLDQLRQLPRPQDPPNPSIGIDLLWADPDQWVKGWQANTRGVSYVFGQDVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPHYCGQFDNSAATMKVDENMVCTFVMYKPTPKSMR 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-4 (Serine/threonine-protein phosphatase PP1-delta [Source:UniProtKB/Swiss-Prot;Acc:P91420])

HSP 1 Score: 367.466 bits (942), Expect = 5.856e-127
Identity = 161/302 (53.31%), Postives = 224/302 (74.17%), Query Frame = 3
Query:  126 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRY-SIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 1028
            + T++++ ++S+LL    S      ++ E E++  C+ +K +F SQ+SLLE+E P+ +CGDIHGQY DLLR+FD  G+PP  N+LFLGDYVDRG+Q+IE +CL+  +KIK+PENFF+LRGNHE  A+NRVYGFY+E  RRY S ++W +F D FN +P   LI  +I+C HGGLSP L+   QLR + RP + P+  +  D+LWADP++ +KG++ N RGVSYVFG+D V    +  DIDL+ RAHQVV+DGYEFF  +K+VTIFSAP+YCG+FDN+ A M VDEN++C+F + KP  K ++
Sbjct:    2 TATIDVDNLMSRLLNVGMSGGRLTTSVNEQELQTCCAVAKSVFASQASLLEVEPPIIVCGDIHGQYSDLLRIFDKNGFPPDINFLFLGDYVDRGRQNIETICLMFCFKIKYPENFFMLRGNHECPAINRVYGFYEECNRRYKSTRLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPHLQTLDQLRQLPRPQDPPNPSIGIDLLWADPDQWVKGWQANTRGVSYVFGQDVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPHYCGQFDNSAATMKVDENMVCTFVMYKPTPKSLR 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1-13C (gene:FBgn0003132 transcript:FBtr0074017)

HSP 1 Score: 453.366 bits (1165), Expect = 1.070e-160
Identity = 210/299 (70.23%), Postives = 251/299 (83.95%), Query Frame = 3
Query:  132 TVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 1028
             +NLE+IIS+LLE + +   K V L+E EI+GLC KS+EI ++Q  LLELEAPLKICGDIHGQY DLLRLF+YGGYPP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+ ENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP  A++DEKI C HGGLSP L   +Q+R I RPT+VPD+GL CD+LW+DP++D  G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVD  L+CSF +LKP  KR K
Sbjct:    4 VLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1-87B (gene:FBgn0004103 transcript:FBtr0082595)

HSP 1 Score: 452.595 bits (1163), Expect = 2.352e-160
Identity = 209/299 (69.90%), Postives = 252/299 (84.28%), Query Frame = 3
Query:  132 TVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 1028
             +N+++IIS+LLE + +   K V L+E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+ ENFFLLRGNHE +++NR+YGFYDE KRRYSIK+WK FTD FN LP AA++DEKI C HGGLSP L   +Q+R I RPT+VPD+GL CD+LW+DP++D  G+ ENDRGVS+ FG + V +FL +++ DLICRAHQVVEDGYEFF KR LVT+FSAPNYCGEFDNAGAMMSVD+ L+CSF +LKP  KR K
Sbjct:    4 VMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0071447)

HSP 1 Score: 452.21 bits (1162), Expect = 9.080e-160
Identity = 202/303 (66.67%), Postives = 253/303 (83.50%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 1028
            M    +N++++I +LLE ++    K V +TE E++GLC KS+EIF+ Q  LLELEAPL ICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY++K+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R + RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +++DLICRAHQVVEDGYEFF +R+LVT+FSAPNYCGEFDNAG MM+VD+ L+CSF +LKP  K+ K
Sbjct:    1 MGDFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAK 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0333305)

HSP 1 Score: 452.21 bits (1162), Expect = 9.080e-160
Identity = 202/303 (66.67%), Postives = 253/303 (83.50%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 1028
            M    +N++++I +LLE ++    K V +TE E++GLC KS+EIF+ Q  LLELEAPL ICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY++K+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R + RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +++DLICRAHQVVEDGYEFF +R+LVT+FSAPNYCGEFDNAG MM+VD+ L+CSF +LKP  K+ K
Sbjct:    1 MGDFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAK 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0474146)

HSP 1 Score: 451.055 bits (1159), Expect = 3.611e-159
Identity = 202/303 (66.67%), Postives = 253/303 (83.50%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMK 1028
            M    +N++++I +LLE ++    K V +TE E++GLC KS+EIF+ Q  LLELEAPL ICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY++K+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R + RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +++DLICRAHQVVEDGYEFF +R+LVT+FSAPNYCGEFDNAG MM+VD+ L+CSF +LKP  K+ K
Sbjct:    1 MGDFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAK 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 465.692 bits (1197), Expect = 6.475e-165
Identity = 213/300 (71.00%), Postives = 257/300 (85.67%), Query Frame = 3
Query:  126 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRM 1025
            S  +N+++II +LLE K S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGD+HGQY DLLRLF+YGGYPP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R + RPT+VPD+GL CD+LWADP++D+ G+ ENDRGVS+ FG D V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K++
Sbjct:    4 SDKINIDSIIQRLLEVKGSRPGKNVQLTEQEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKV 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 464.922 bits (1195), Expect = 8.295e-165
Identity = 211/306 (68.95%), Postives = 259/306 (84.64%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE+L+CSF +LKP  K+ K Q+
Sbjct:    1 MAEGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 461.07 bits (1185), Expect = 3.498e-163
Identity = 210/297 (70.71%), Postives = 256/297 (86.20%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRM 1025
            +N+++II +LLE K S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGD+HGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYK+K+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R + RPT+VPD+GL CD+LWADP++D+ G+ ENDRGVS+ FG D V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K++
Sbjct:    7 LNIDSIIQRLLEVKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: CABZ01076667.1 (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:571753])

HSP 1 Score: 457.603 bits (1176), Expect = 5.621e-162
Identity = 209/296 (70.61%), Postives = 254/296 (85.81%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +N+++II +LLE + S   K V L E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGGYPP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE +RRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D+ G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECRRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 447.973 bits (1151), Expect = 5.434e-158
Identity = 205/291 (70.45%), Postives = 247/291 (84.88%), Query Frame = 3
Query:  153 ISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRM 1025
            +  L   K S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGD+HGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYK+K+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R + RPT+VPD+GL CD+LWADP++D+ G+ ENDRGVS+ FG D V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K++
Sbjct:    9 LKSLHNLKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKL 299          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 463.766 bits (1192), Expect = 4.640e-164
Identity = 210/306 (68.63%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 456.833 bits (1174), Expect = 1.685e-161
Identity = 209/296 (70.61%), Postives = 254/296 (85.81%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +N+++II +LLE + S   K V L E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D+ G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 451.44 bits (1160), Expect = 2.359e-159
Identity = 209/304 (68.75%), Postives = 252/304 (82.89%), Query Frame = 3
Query:  147 TIISKLLEF-------KNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            + ISKLL F       +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    2 SAISKLLYFFFFSPAVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 448.743 bits (1153), Expect = 3.793e-158
Identity = 203/282 (71.99%), Postives = 244/282 (86.52%), Query Frame = 3
Query:  192 KLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:   24 KIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 444.121 bits (1141), Expect = 2.139e-156
Identity = 204/284 (71.83%), Postives = 244/284 (85.92%), Query Frame = 3
Query:  171 FKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            F+ S   K V L E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D+ G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:   25 FRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 308          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cb (protein phosphatase 1 catalytic subunit beta [Source:MGI Symbol;Acc:MGI:104871])

HSP 1 Score: 462.611 bits (1189), Expect = 8.069e-164
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++I++LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cb (protein phosphatase 1 catalytic subunit beta [Source:MGI Symbol;Acc:MGI:104871])

HSP 1 Score: 462.611 bits (1189), Expect = 8.069e-164
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++I++LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 460.299 bits (1183), Expect = 9.031e-163
Identity = 211/298 (70.81%), Postives = 256/298 (85.91%), Query Frame = 3
Query:  126 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTK 1019
            S  +NL++II +LLE + S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKI++PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D++G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K
Sbjct:    4 SEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 460.299 bits (1183), Expect = 9.031e-163
Identity = 211/298 (70.81%), Postives = 256/298 (85.91%), Query Frame = 3
Query:  126 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTK 1019
            S  +NL++II +LLE + S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKI++PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D++G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K
Sbjct:    4 SEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 457.218 bits (1175), Expect = 1.026e-161
Identity = 209/296 (70.61%), Postives = 254/296 (85.81%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +N+++II +LLE + S   K V L E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D+ G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q5I085|PP1B_XENTR (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis OX=8364 GN=ppp1cb PE=2 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 2.458e-163
Identity = 210/306 (68.63%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q6GQL2|PP1B_XENLA (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis OX=8355 GN=ppp1cb PE=2 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 2.458e-163
Identity = 210/306 (68.63%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62142|PP1B_RAT (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp1cb PE=1 SV=3)

HSP 1 Score: 462.611 bits (1189), Expect = 5.644e-163
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++I++LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62143|PP1B_RABIT (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus OX=9986 GN=PPP1CB PE=1 SV=3)

HSP 1 Score: 462.611 bits (1189), Expect = 5.644e-163
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++I++LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q5R740|PP1B_PONAB (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii OX=9601 GN=PPP1CB PE=2 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 5.644e-163
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++I++LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A023FIW7 (Serine/threonine-protein phosphatase OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 5.702e-163
Identity = 216/311 (69.45%), Postives = 261/311 (83.92%), Query Frame = 3
Query:  114 LAMPSMTV---NLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            +A P+ T+   N+++IIS+LLE +     K V LTE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    4 MASPTGTIGDLNVDSIISRLLEVRGCRPGKTVQLTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 314          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1J4MQD5 (Serine/threonine-protein phosphatase OS=Cryptosporidium andersoni OX=117008 GN=cand_030810 PE=3 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 6.501e-163
Identity = 212/303 (69.97%), Postives = 260/303 (85.81%), Query Frame = 3
Query:  114 LAMPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            L  PS+ ++++++I+KLLE + S   K V LTE EI+G+C +S+EIFMSQ +LLEL+AP+KICGDIHGQY DLLRLF+YGG+PP  NYLFLGDYVDRGKQS+E +CLL AYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY++K+WK FTD FN LP AA+IDEKIIC HGGLSP L    Q+R I+RPT+VPD GL CD+LW+DPE+D++G+ ENDRGVS+ FG D VE+FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    9 LNGPSIDIDVDSVIAKLLEVRGSRPGKPVQLTEKEIRGICMRSREIFMSQPTLLELDAPIKICGDIHGQYYDLLRLFEYGGFPPDTNYLFLGDYVDRGKQSLETICLLFAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIICMHGGLSPELHKLDQIRKIERPTDVPDTGLLCDLLWSDPEKDVRGWGENDRGVSFTFGHDVVEKFLRDHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKK 311          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: B6AFU9 (Serine/threonine-protein phosphatase OS=Cryptosporidium muris (strain RN66) OX=441375 GN=CMU_034760 PE=3 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 7.916e-163
Identity = 212/303 (69.97%), Postives = 260/303 (85.81%), Query Frame = 3
Query:  114 LAMPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            L  PS+ ++++++I+KLLE + S   K V LTE EI+G+C +S+EIFMSQ +LLEL+AP+KICGDIHGQY DLLRLF+YGG+PP  NYLFLGDYVDRGKQS+E +CLL AYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY++K+WK FTD FN LP AA+IDEKIIC HGGLSP L    Q+R I+RPT+VPD GL CD+LW+DPE+D++G+ ENDRGVS+ FG D VE+FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    9 LNGPSIDIDVDSVIAKLLEVRGSRPGKPVQLTEKEIRGICMRSREIFMSQPTLLELDAPIKICGDIHGQYYDLLRLFEYGGFPPDTNYLFLGDYVDRGKQSLETICLLFAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIICMHGGLSPELHKLDQIRKIERPTDVPDTGLLCDLLWSDPEKDVRGWGENDRGVSFTFGHDVVEKFLRDHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKK 311          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A4U5UKV3 (Serine/threonine-protein phosphatase OS=Collichthys lucidus OX=240159 GN=D9C73_010332 PE=3 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 9.892e-163
Identity = 213/306 (69.61%), Postives = 259/306 (84.64%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N+++IIS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V RFL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE+L+CSF +LKP  K+ K Q+
Sbjct:    1 MAESELNVDSIISRLLEVRGCRPGKVVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSRFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A087UKD3 (Serine/threonine-protein phosphatase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_01264 PE=3 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 2.046e-162
Identity = 214/306 (69.93%), Postives = 257/306 (83.99%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N+++IIS+LLE +     K V LTE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MAESELNVDSIISRLLEVRGCRPGKTVQLTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 465.692 bits (1197), Expect = 4.690e-165
Identity = 211/306 (68.95%), Postives = 259/306 (84.64%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE+L+CSF +LKP  K+ K Q+
Sbjct:    1 MAESELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103028275])

HSP 1 Score: 464.537 bits (1194), Expect = 1.113e-164
Identity = 211/306 (68.95%), Postives = 259/306 (84.64%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE+L+CSF +LKP  K+ K Q+
Sbjct:    1 MAEGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:103034518])

HSP 1 Score: 464.922 bits (1195), Expect = 1.142e-164
Identity = 213/300 (71.00%), Postives = 257/300 (85.67%), Query Frame = 3
Query:  126 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRM 1025
            S  +N+++II +LLE K S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGD+HGQY DLLRLF+YGGYPP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R + RPT+VPD+GL CD+LWADP++D+ G+ ENDRGVS+ FG D V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K++
Sbjct:    4 SDKLNIDSIIQRLLEVKGSRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ENSAMXT00000056848.1 (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:103033313])

HSP 1 Score: 461.84 bits (1187), Expect = 1.290e-163
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    ++++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MAEGELDVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1caa (serine/threonine-protein phosphatase alpha-2 isoform-like [Source:NCBI gene;Acc:103034594])

HSP 1 Score: 461.455 bits (1186), Expect = 2.337e-163
Identity = 210/297 (70.71%), Postives = 256/297 (86.20%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRM 1025
            +N+++II +LLE K S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGD+HGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYK+K+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R + RPT+VPD+GL CD+LWADP++D+ G+ ENDRGVS+ FG D V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K++
Sbjct:    7 LNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 439.499 bits (1129), Expect = 9.540e-156
Identity = 205/283 (72.44%), Postives = 243/283 (85.87%), Query Frame = 3
Query:  174 KNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            + S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE+S +NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D  G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    2 RGSRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEAS-INRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 283          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 389.423 bits (999), Expect = 1.357e-136
Identity = 177/248 (71.37%), Postives = 212/248 (85.48%), Query Frame = 3
Query:  303 GDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDE---GLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            GDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD    GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGDAGLLCDLLWSDPDKDVQGWGENDRGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 248          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 330.102 bits (845), Expect = 6.261e-114
Identity = 149/221 (67.42%), Postives = 185/221 (83.71%), Query Frame = 3
Query:  159 KLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERF 821
            +L   +     K V++TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +F
Sbjct:    1 RLPTVRGCRPGKTVHMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 211.46 bits (537), Expect = 3.468e-64
Identity = 108/269 (40.15%), Postives = 156/269 (57.99%), Query Frame = 3
Query:  249 IFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFREND-------RGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRK------LVTIFSAPNYCGEFDNAGAMMSVDENLL------CSFH 998
            I   + +++++EAP+ +CGDIHGQ+ DL++LF+ GG P    YLFLGDYVDRG  SIEC+  L A KI +P   FLLRGNHE   L   + F  E K +Y+  V+    D F+ LP AAL++++ +C HGGLSP +   + +R + R  E P  G  CD+LW+DP  D    +  +       RG SY +   AV  FL  N++  + RAH+  + GY  + K +      L+TIFSAPNY   ++N  A++  + N++      CS H
Sbjct:   54 ILRREKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTETVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFKEPPAFGPMCDLLWSDPSEDFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPH 322          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005085.1 (pep scaffold:Pmarinus_7.0:GL481040:2845:3652:-1 gene:ENSPMAG00000004627.1 transcript:ENSPMAT00000005085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.43 bits (485), Expect = 7.660e-61
Identity = 87/119 (73.11%), Postives = 105/119 (88.24%), Query Frame = 3
Query:  174 KNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYD 530
            + S   K V+++E E++ LC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYD
Sbjct:   16 RGSRPGKTVHMSEAEVRALCIKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 134          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 451.825 bits (1161), Expect = 8.214e-161
Identity = 208/305 (68.20%), Postives = 253/305 (82.95%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQ 1034
            M S  V+++ II +LLE + S   + V+L E EI+ LCSK++ IF+ Q  LLELEAP+KICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFF+LRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA+IDEKI C HGGLSP L   +Q+R + RPT++PD GL CD+LW+DP++DI G+ ENDRGVS+ FG D V RFL + D++LICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE+LLCSF +LKP  K +  Q
Sbjct:    1 MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQKSLPRQ 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ1 (Serine/threonine protein phosphatase Z, isoform of Ppz2p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000004478])

HSP 1 Score: 366.696 bits (940), Expect = 4.612e-122
Identity = 174/293 (59.39%), Postives = 216/293 (73.72%), Query Frame = 3
Query:  135 VNLETIISKLLEFK-NSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKP 1010
            ++++  I KLL+    +   K V L   EI  +C K++EIF+SQ SLLEL  P+KI GD+HGQY DLLRLF   G+PP++NYLFLGDYVDRGKQS+E + LL  YKIK+PENFFLLRGNHE + + RVYGFYDE KRR +IK+WK F D FNTLP AA++  KI C HGGLSP L    ++R + RPT+VPD GL  D+LW+DP      + +N+RGVSY + + A+ +FL +   DL+CRAH VVEDGYEFF  R LVT+FSAPNYCGEFDN GA+MSV E LLCSF +L P
Sbjct:  361 IDIDETIQKLLDAGYAAKRTKNVCLKNNEILQICIKAREIFLSQPSLLELSPPVKIVGDVHGQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLFCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDEIRHVVRPTDVPDFGLINDLLWSDPTDSPNEWEDNERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSVSEGLLCSFELLDP 653          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ2 (Serine/threonine protein phosphatase Z, isoform of Ppz1p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000002844])

HSP 1 Score: 364.385 bits (934), Expect = 4.984e-121
Identity = 172/297 (57.91%), Postives = 217/297 (73.06%), Query Frame = 3
Query:  123 PSMTVNLETIISKLLEFK-NSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKP 1010
            P   V+++ II +LL+    +   K V L   EI  +C K++E+F++Q +LLEL   +KI GD+HGQY DLLRLF   G+PP ANYLFLGDYVDRGKQS+E + LLL YKIK+PENFFLLRGNHE + + RVYGFYDE KRR +IK+WK F D FNTLP AA++  KI C HGGLSP L    ++R + RPT+VPD GL  D+LW+DP      + +N+RGVS+ + + A+ +FL +   DL+CRAH VVEDGYEFF  R LVT+FSAPNYCGEFDN GA+M+V E LLCSF +L P
Sbjct:  392 PVRPVDIDEIIQRLLDAGYAAKRTKNVCLKNSEIIQICHKARELFLAQPALLELSPSVKIVGDVHGQYADLLRLFTKCGFPPMANYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTDSSNEWEDNERGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMTVSEGLLCSFELLDP 688          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPQ1 (Protein phosphatase that regulates the mating response; negatively regulates the MAP kinase signaling cascade during mating; member of the serine/threonine phosphatase PP1 family [Source:SGD;Acc:S000006100])

HSP 1 Score: 349.747 bits (896), Expect = 3.032e-117
Identity = 161/300 (53.67%), Postives = 213/300 (71.00%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVN------LTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQT 1016
            ++++  I KLL+   S  I   +         +EI+ +C  ++EIF++Q +LL L+AP+K+ GD+HGQ+ DLLR+    G P   NYLFLGDYVDRGK S+E + LLL YKIK+ +NFF+LRGNHES+ + ++YGFYDE KRR S KVWKMF D+FNTLP AA+I +KI C HGG+SP L   KQ+  + RPT++P+ GL  D+LW+DP+  +  + ENDRGVSY F +  V  F A+   DLI R H VVEDGYEFF ++K VTIFSAPNYCGEF N GA+MSV   ++CSF +LKP+ 
Sbjct:  238 LDIDVAIEKLLQVGESREITKTSKKKNFPFHSWEIQLICYHAREIFLNQPTLLRLQAPIKVVGDVHGQFNDLLRILKLSGVPSDTNYLFLGDYVDRGKNSLETILLLLCYKIKYKDNFFMLRGNHESANVTKMYGFYDECKRRLSSKVWKMFVDVFNTLPLAAIIQDKIFCVHGGISPDLHDMKQIEKVARPTDIPESGLVTDLLWSDPDPQVTDWSENDRGVSYTFSKRNVLDFCAKFKFDLILRGHMVVEDGYEFFARKKFVTIFSAPNYCGEFHNWGAVMSVTTGMMCSFELLKPRA 537          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 272.322 bits (695), Expect = 2.383e-89
Identity = 135/299 (45.15%), Postives = 186/299 (62.21%), Query Frame = 3
Query:  156 SKLLEFKNSNAIKLVN----------LTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRY-SIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTK 1019
            SK LE  N+N  +L            L+E ++  LC  + ++   + ++  +  P+ ICGD+HGQ+ DLL LF  GG  P  NYLF+GDYVDRG  S+E +  L+A K+++P    +LRGNHES  + +VYGFYDE  R+Y S  VWKMFTD+F+  P  AL+D KI C HGGLSP ++   Q+R++ R  EVP EG  CD+LW+DP+ D  G+  + RG  + FG+D  E+F   ND+ LI RAHQ+V +GY +  ++ +VTIFSAPNYC    N  A+M VDEN    F    P  +
Sbjct:   57 SKPLELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPD-DRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVR 354          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 461.84 bits (1187), Expect = 4.376e-164
Identity = 212/296 (71.62%), Postives = 257/296 (86.82%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +N+++IIS+LLE + S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    7 LNVDSIISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 283.108 bits (723), Expect = 4.947e-94
Identity = 140/296 (47.30%), Postives = 189/296 (63.85%), Query Frame = 3
Query:  138 NLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRY-SIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +LE  I +L+E K         LTE ++K LC K+KEI   +S++ E++ P+ +CGD+HGQ+ DL+ LF  GG  P  NYLF+GDYVDRG  S+E + LL+  K++FP    +LRGNHES  + +VYGFYDE  R+Y +  VWK FTD+F+ LP  AL+D +I C HGGLSPS+     +R + R  EVP EG  CD+LW+DP+ D  G+  + RG  Y FG+D  E F   N + LI RAHQ+V +GY +   R +VTIFSAPNYC    N  A+M +D+ L  SF    P  +R
Sbjct:   10 DLEVWIEQLMECKQ--------LTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDALKYSFLQFDPAPRR 296          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 280.411 bits (716), Expect = 7.461e-93
Identity = 131/276 (47.46%), Postives = 191/276 (69.20%), Query Frame = 3
Query:  204 LTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRY-SIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLK--PQTKR 1022
            +TE E+K LC+K++EI + +S++  +++P+ +CGDIHGQ+ DL  LF  GG  P  NYLF+GD+VDRG  S+E   LLLA K+++P+   L+RGNHES  + +VYGFYDE  ++Y SI VW+   ++F+ L  +A+ID ++ C HGGLSPS+    Q+R I R  EVP +G  CD+LW+DPE DI+G+  + RG  Y+FG D V ++ A NDIDLICRAHQ+V +GY++     ++T++SAPNYC    N  A++ +DE+L   F + +  PQ  R
Sbjct:   20 ITEKEVKQLCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDRKQEVPHDGPMCDLLWSDPE-DIQGWGVSPRGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLKREFTIFEAAPQDVR 294          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO40084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D8])

HSP 1 Score: 222.246 bits (565), Expect = 2.860e-72
Identity = 98/158 (62.03%), Postives = 127/158 (80.38%), Query Frame = 3
Query:  534 VKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLK 1007
            +KRRY+IK+WK+FTD FN LP AA++++ I C HGGLSP L+   ++R+++RP +VPD+GL CD+LW+DP+ DI G+ +NDRGVS+ FG D V  +L +    L+ RAHQVVEDGY FF KRKLVT+FSAPNYCGEFDNAG +MSV ENL+CSF +LK
Sbjct:    1 MKRRYNIKLWKIFTDCFNCLPIAAIVEQTIFCMHGGLSPDLQGLDEIRNLERPMDVPDKGLVCDLLWSDPDEDITGWGDNDRGVSWTFGGDVVREYLEKYGFSLVVRAHQVVEDGYRFFEKRKLVTLFSAPNYCGEFDNAGGVMSVGENLMCSFSILK 158          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 204.142 bits (518), Expect = 1.909e-61
Identity = 108/269 (40.15%), Postives = 154/269 (57.25%), Query Frame = 3
Query:  249 IFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADP------ERDIKGFREND-RGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRK------LVTIFSAPNYCGEFDNAGAMMSVDENLL------CSFH 998
            I   + ++LE++AP+ +CGDIHGQ+ DL++LF+ GG P T  YLFLGDYVDRG  SIEC+  L   K  +    FLLRGNHE   L   + F  E K +YS  V+    + F+ LP AAL++++ +C HGGLSP +     ++ + R  E P  G  CD+LW+DP      E+  + F  N  RG SY +   A   FL  N++  I RAH+  + GY  + K +      L+TIFSAPNY   ++N  A++  + N++      CS H
Sbjct:   49 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFKEPPAFGPMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPH 317          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101155811])

HSP 1 Score: 464.537 bits (1194), Expect = 1.106e-164
Identity = 211/306 (68.95%), Postives = 259/306 (84.64%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    +N++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE+L+CSF +LKP  K+ K Q+
Sbjct:    1 MAEGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000013925.2 (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101158483])

HSP 1 Score: 461.84 bits (1187), Expect = 1.561e-163
Identity = 209/306 (68.30%), Postives = 258/306 (84.31%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            M    ++++++IS+LLE +     K+V +TE E++GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP ANYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRR++IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD GL CD+LW+DP++D++G+ ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAG MMSVDE L+CSF +LKP  K+ K Q+
Sbjct:    1 MAEGELDVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:101171445])

HSP 1 Score: 461.455 bits (1186), Expect = 1.569e-163
Identity = 211/297 (71.04%), Postives = 256/297 (86.20%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRM 1025
            +N+++II +LLE K S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGD+HGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R + RPT+VPD+GL CD+LWADP++D+ G+ ENDRGVS+ FG D V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K++
Sbjct:    7 LNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVTKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1caa (serine/threonine-protein phosphatase alpha-2 isoform-like [Source:NCBI gene;Acc:101169945])

HSP 1 Score: 460.685 bits (1184), Expect = 3.862e-163
Identity = 211/297 (71.04%), Postives = 256/297 (86.20%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRM 1025
            +N+++II +LLE K S   K V LTE EI+GLC KS+EIF+SQ  LLELEAPLKICGD+HGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R + RPT+VPD+GL CD+LWADP++D+ G+ ENDRGVS+ FG D V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K++
Sbjct:    7 LNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKL 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000019964.2 (protein phosphatase 1 catalytic subunit gamma [Source:NCBI gene;Acc:101161814])

HSP 1 Score: 456.062 bits (1172), Expect = 1.941e-161
Identity = 208/296 (70.27%), Postives = 254/296 (85.81%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +N+++II +LLE + +   K V L E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA++DEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP++D+ G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    7 LNIDSIIQRLLEVRGAKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGSEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000024840.1 (SMESG000024840.1)

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQHD 1040
            MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQHD
Sbjct:    1 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQHD 307          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000024840.1 (SMESG000024840.1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 304/304 (100.00%), Postives = 304/304 (100.00%), Query Frame = 3
Query:  129 MTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQHD 1040
            MTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQHD
Sbjct:    1 MTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQHD 304          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000015282.1 (SMESG000015282.1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.107e-162
Identity = 209/306 (68.30%), Postives = 257/306 (83.99%), Query Frame = 3
Query:  120 MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKRMKIQH 1037
            MP   +N++++I++LLE +     K V++ E EI+ LC KSKEIF++Q+ LLELEAP+KICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGK S+E +CLLLAYKIK+PENFFLLRGNHES+A+NR+YGFYDE KRR++IK+WK FTD FN LP AA+IDEKI C HGGLSP L+   Q+R I RPTE+PD GL CDILW+DP+++++ + ENDRGVS+ FG D V +FL  +D+DLICRAHQVVEDGYEFF +R+LVT+FSAPNYCGEFDNAG MMSVDENLLCSF +LKP  K+ K Q+
Sbjct:    1 MPDSDLNVDSLITRLLEVRGCRPGKTVDMKEDEIRALCLKSKEIFLNQNILLELEAPIKICGDIHGQYTDLLRLFEYGGFPPDSNYLFLGDYVDRGKFSLETICLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRFTIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMDQIRRITRPTEIPDTGLLCDILWSDPDKEVEAWGENDRGVSFTFGSDIVSKFLNRHDLDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMSVDENLLCSFQILKPTEKKAKYQY 306          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000067423.1 (SMESG000067423.1)

HSP 1 Score: 457.218 bits (1175), Expect = 8.018e-162
Identity = 211/299 (70.57%), Postives = 256/299 (85.62%), Query Frame = 3
Query:  126 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            S  +NL++II++LLE + S   K V L+E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP+++  G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    4 SDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 302          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000075857.1 (SMESG000075857.1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.821e-161
Identity = 209/296 (70.61%), Postives = 255/296 (86.15%), Query Frame = 3
Query:  135 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 1022
            +N+++II++LLE + S   K V L+E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP+++  G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    7 LNIDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 302          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1CB1.175e-16368.30protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CB1.175e-16368.30protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CB1.175e-16368.30protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CA6.184e-16371.14protein phosphatase 1 catalytic subunit alpha [Sou... [more]
PPP1CC1.282e-16170.61protein phosphatase 1 catalytic subunit gamma [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsp-22.205e-16371.28Serine/threonine-protein phosphatase PP1-beta [So... [more]
gsp-17.626e-16269.10Serine/threonine-protein phosphatase PP1-alpha [S... [more]
pph-17.776e-13862.03Serine/threonine-protein phosphatase [Source:UniP... [more]
gsp-33.703e-12753.64Serine/threonine-protein phosphatase PP1-gamma [S... [more]
gsp-45.856e-12753.31Serine/threonine-protein phosphatase PP1-delta [S... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pp1-13C1.070e-16070.23gene:FBgn0003132 transcript:FBtr0074017[more]
Pp1-87B2.352e-16069.90gene:FBgn0004103 transcript:FBtr0082595[more]
flw9.080e-16066.67gene:FBgn0000711 transcript:FBtr0071447[more]
flw9.080e-16066.67gene:FBgn0000711 transcript:FBtr0333305[more]
flw3.611e-15966.67gene:FBgn0000711 transcript:FBtr0474146[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab6.475e-16571.00protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1cb8.295e-16568.95protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1caa3.498e-16370.71protein phosphatase 1, catalytic subunit, alpha is... [more]
CABZ01076667.15.621e-16270.61protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1caa5.434e-15870.45protein phosphatase 1, catalytic subunit, alpha is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cb4.640e-16468.63protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cc1.685e-16170.61protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cb2.359e-15968.75protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cb3.793e-15871.99protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cc2.139e-15671.83protein phosphatase 1, catalytic subunit, gamma is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1cb8.069e-16468.30protein phosphatase 1 catalytic subunit beta [Sour... [more]
Ppp1cb8.069e-16468.30protein phosphatase 1 catalytic subunit beta [Sour... [more]
Ppp1ca9.031e-16370.81protein phosphatase 1 catalytic subunit alpha [Sou... [more]
Ppp1ca9.031e-16370.81protein phosphatase 1 catalytic subunit alpha [Sou... [more]
Ppp1cc1.026e-16170.61protein phosphatase 1 catalytic subunit gamma [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5I085|PP1B_XENTR2.458e-16368.63Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|Q6GQL2|PP1B_XENLA2.458e-16368.63Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|P62142|PP1B_RAT5.644e-16368.30Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|P62143|PP1B_RABIT5.644e-16368.30Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|Q5R740|PP1B_PONAB5.644e-16368.30Serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023FIW75.702e-16369.45Serine/threonine-protein phosphatase OS=Amblyomma ... [more]
A0A1J4MQD56.501e-16369.97Serine/threonine-protein phosphatase OS=Cryptospor... [more]
B6AFU97.916e-16369.97Serine/threonine-protein phosphatase OS=Cryptospor... [more]
A0A4U5UKV39.892e-16369.61Serine/threonine-protein phosphatase OS=Collichthy... [more]
A0A087UKD32.046e-16269.93Serine/threonine-protein phosphatase (Fragment) OS... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cb4.690e-16568.95serine/threonine-protein phosphatase PP1-beta cata... [more]
PPP1CB1.113e-16468.95serine/threonine-protein phosphatase PP1-beta cata... [more]
ppp1cab1.142e-16471.00serine/threonine-protein phosphatase alpha-2 isofo... [more]
ENSAMXT00000056848.11.290e-16368.30serine/threonine-protein phosphatase PP1-beta cata... [more]
ppp1caa2.337e-16370.71serine/threonine-protein phosphatase alpha-2 isofo... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab9.540e-15672.44protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.11.357e-13671.37pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp1cb6.261e-11467.42protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp3cb3.468e-6440.15protein phosphatase 3, catalytic subunit, beta iso... [more]
ENSPMAT00000005085.17.660e-6173.11pep scaffold:Pmarinus_7.0:GL481040:2845:3652:-1 ge... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GLC78.214e-16168.20Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPZ14.612e-12259.39Serine/threonine protein phosphatase Z, isoform of... [more]
PPZ24.984e-12157.91Serine/threonine protein phosphatase Z, isoform of... [more]
PPQ13.032e-11753.67Protein phosphatase that regulates the mating resp... [more]
PPH212.383e-8945.15Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO446484.376e-16471.62Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297594.947e-9447.30Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499367.461e-9347.46Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO400842.860e-7262.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362721.909e-6140.15Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1CB1.106e-16468.95serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSORLT00000013925.21.561e-16368.30serine/threonine-protein phosphatase PP1-beta cata... [more]
ppp1cab1.569e-16371.04serine/threonine-protein phosphatase alpha-2 isofo... [more]
ppp1caa3.862e-16371.04serine/threonine-protein phosphatase alpha-2 isofo... [more]
ENSORLT00000019964.21.941e-16170.27protein phosphatase 1 catalytic subunit gamma [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024840.10.000e+0100.00SMESG000024840.1[more]
SMESG000024840.10.000e+0100.00SMESG000024840.1[more]
SMESG000015282.11.107e-16268.30SMESG000015282.1[more]
SMESG000067423.18.018e-16270.57SMESG000067423.1[more]
SMESG000075857.11.821e-16170.61SMESG000075857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015320 ID=SMED30015320|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1138bp
CAAATATAATAATCAAATGATTGATTAGTATAGAAATTCAATTCTGTCCA
TATTATAGAATCACAGAATTCTTTCCTGATCGTTCTTTTCCACGGAATTA
TGGGAATAACTAACTAGCGATGCCGTCTATGACCGTTAACCTCGAGACTA
TTATTTCTAAACTGTTGGAATTCAAAAATAGCAATGCAATAAAGCTTGTA
AATTTGACAGAATACGAGATCAAGGGTCTCTGTTCCAAATCTAAGGAAAT
TTTTATGTCCCAGTCTTCTTTACTTGAATTGGAGGCGCCTTTAAAAATAT
GCGGCGACATCCATGGGCAATACGTTGACTTGTTACGGCTCTTTGATTAT
GGAGGTTATCCGCCGACCGCCAACTATCTATTCCTCGGAGACTATGTTGA
CAGGGGCAAGCAATCCATTGAGTGCATGTGCTTACTTTTGGCATATAAAA
TAAAATTTCCAGAAAACTTTTTTCTCCTCCGAGGTAATCACGAAAGCTCA
GCTTTGAATAGAGTATACGGATTTTATGATGAAGTCAAACGACGATACAG
TATAAAAGTGTGGAAAATGTTCACTGATATGTTTAATACATTACCATTTG
CTGCCTTGATTGACGAGAAAATTATCTGCTTTCACGGTGGTTTGTCTCCG
AGCCTAAAGTTCGCCAAACAACTCCGAGACATCAAAAGACCAACAGAAGT
CCCGGATGAAGGGCTTGAATGTGACATTCTATGGGCAGATCCCGAAAGAG
ATATCAAAGGATTTCGAGAAAATGATAGAGGAGTTAGTTACGTCTTTGGA
GAAGACGCGGTTGAAAGGTTTCTTGCCGAGAACGATATCGATTTAATATG
CAGAGCTCATCAAGTTGTTGAAGATGGATACGAATTTTTTTGTAAACGAA
AACTTGTTACGATTTTCTCCGCGCCAAATTATTGCGGAGAATTTGACAAC
GCCGGAGCGATGATGTCGGTTGATGAGAATCTTTTGTGCTCTTTTCATGT
GCTTAAACCGCAAACAAAGAGAATGAAAATTCAACATGATAATTAAAACA
ATTAAAGCTCTAATTTAATTATAATTAATTTTTCAACAAATTATTTAATT
AAATTAATTTTTGTTGTAATTGATTAATTAATCCGCCA
back to top

protein sequence of SMED30015320-orf-1

>SMED30015320-orf-1 ID=SMED30015320-orf-1|Name=SMED30015320-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=309bp
MPSMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSS
LLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSI
ECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKM
FTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLE
CDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVV
EDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTK
RMKIQHDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006186Ser/Thr-sp_prot-phosphatase
IPR031675STPPase_N
IPR004843Calcineurin-like_PHP_ApaH
IPR029052Metallo-depent_PP-like
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 86..113
score: 67.01
coord: 57..84
score: 61.29
coord: 119..143
score: 63.88
coord: 153..179
score: 57.22
coord: 182..209
score: 46.96
coord: 261..277
score: 71.07
coord: 239..259
score: 56.93
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 29..299
e-value: 4.3E-156
score: 534.5
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 120..125
IPR031675Serine-threonine protein phosphatase, N-terminalPFAMPF16891STPPase_Ncoord: 9..55
e-value: 2.9E-16
score: 59.6
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 2..308
e-value: 9.4E-132
score: 440.2
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 59..248
e-value: 1.2E-35
score: 123.8
NoneNo IPR availablePANTHERPTHR11668:SF444SERINE/THREONINE-PROTEIN PHOSPHATASE PP1 ISOZYME 6coord: 7..307
NoneNo IPR availablePANTHERPTHR11668SERINE/THREONINE PROTEIN PHOSPHATASEcoord: 7..307
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 23..300