Cysteine-rich secretory protein LCCL domain-containing 2

Overview
NameCysteine-rich secretory protein LCCL domain-containing 2
Smed IDSMED30015313
Uniprot Best hitPeptidase inhibitor 15-A OS=Danio rerio GN=pi15a PE=3 SV=2 (E=3.2634e-25)
Length (bp)614
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cysteine-rich secretory protein LCCL domain-containing 2 (SMED30015313) t-SNE clustered cells

Violin plots show distribution of expression levels for Cysteine-rich secretory protein LCCL domain-containing 2 (SMED30015313) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cysteine-rich secretory protein LCCL domain-containing 2 (SMED30015313) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cysteine-rich secretory protein LCCL domain-containing 2 (SMED30015313) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Cysteine-rich secretory protein LCCL domain-containing 2 ( VAL-like ) is expressed during Stage 3, Stage 4 and Stage 5 in the embryonic digestive system and temporary embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Definitive gut progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and gata456a (green). Definitive gut progenitors, coexpressing piwi-1 and gata456a, are dispersed in the embryonic wall. As definitive gut progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of gata456a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Muscle progenitors arise in the piwi-1+ blastomere population during S5. 

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and myoD (green). Muscle progenitors, coexpressing piwi-1 and myoD, are dispersed in the embryonic wall. As muscle progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of myoD. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Neural progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and pax6a (green). Neural progenitors, coexpressing piwi-1 and pax6a, are dispersed in the embryonic wall. As neural progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of pax6a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

Homology
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 101.293 bits (251), Expect = 4.464e-25
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 101.293 bits (251), Expect = 4.464e-25
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 98.9821 bits (245), Expect = 1.310e-23
Identity = 56/160 (35.00%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            + W+DE  + A   A +C++++  +          +GQN+ A+W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C +  +        +Y VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   80 MTWDDELEKSAAAWASQCIWEHGPT-----SLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLC 234          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 98.9821 bits (245), Expect = 2.213e-23
Identity = 56/160 (35.00%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSSNDVTD-GIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            + W+DE  + A   A +C++++  +          +GQN+ A+W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C +  +        +Y VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   80 MTWDDELEKSAAAWASQCIWEHGPT-----SLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLC 234          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 98.9821 bits (245), Expect = 2.441e-23
Identity = 56/160 (35.00%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSSNDVTD-GIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            + W+DE  + A   A +C++++  +          +GQN+ A+W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C +  +        +Y VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   80 MTWDDELEKSAAAWASQCIWEHGPT-----SLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLC 234          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:RefSeq peptide;Acc:NP_502506])

HSP 1 Score: 75.0998 bits (183), Expect = 2.133e-16
Identity = 52/170 (30.59%), Postives = 80/170 (47.06%), Query Frame = 1
Query:  145 PVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSSNDVTD-------GIKMWFDEVKDYTFNGDKCS----GFTCLHYTALIWAKTKEFGCGIADCSR--KGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRC--SNGLCS 606
            P  SD       + W+   A  AQ  A++C   +         G + +G+N+  YW+S  +T+       G   W  E +DY ++ +  S         H T + WAKT   GCG+ +C +   G   + +VC Y P GN+ N+  Y  G  CS+CP+GT C  + GLC+
Sbjct:   51 PAASD----MLKMKWDATVAASAQAYANKCPTGHS--------GAAGLGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLCA 208          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:RefSeq peptide;Acc:NP_502498])

HSP 1 Score: 73.559 bits (179), Expect = 6.588e-16
Identity = 53/167 (31.74%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  166 PTTTN---IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTD---------GIKMWFDEVKDYTFNGDKC------SGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIV-CNYGPGGNWNNEAPYKVGQACSRCPNGTRC--SNGLC 603
            P+ +N   ++W+      AQ  +  C   +  SR         +G+N+ +W+S  VT             +W  E + + +NG+        SG    H T + WA T + GCGI+ CS    G  Y+V C Y P GN+     YK G+ CS CP+GT C  S GLC
Sbjct:   54 PSASNMMKLIWDTTLETTAQDYSTGCPTGHSASRAN-------IGENMYWWTSPVVTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFNSGIG--HATQMAWATTNKIGCGISKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNCESSTGLC 211          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Celegans
Match: lon-1 (LONg [Source:RefSeq peptide;Acc:NP_498167])

HSP 1 Score: 72.7886 bits (177), Expect = 2.325e-15
Identity = 50/150 (33.33%), Postives = 71/150 (47.33%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSR------KGLGNIYIVCNYGPGGNWNNEAPYKVGQ--ACSRCP-NGTRCSNGLC 603
            + W+DE A  AQ  AD C F++ + R         VG+NI     ++ +D I +WF+EV +     +      C HY  ++WAKT   GCG + C        +G  N++ VC+Y P GN      +  G    CS CP N   C  GLC
Sbjct:  103 LYWSDELAASAQRHADTCDFRHSRGRIN-------VGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVF-VCHYNPQGNTMPAFTWASGDNGKCSNCPANAPACYQGLC 244          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:RefSeq peptide;Acc:NP_502532])

HSP 1 Score: 70.8626 bits (172), Expect = 5.732e-15
Identity = 51/155 (32.90%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  187 WNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSSNDVTD-------GIKMWFDEVKDY--TFNGDKCSGFT--CLHYTALIWAKTKEFGCGIADCSR--KGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRC--SNGLC 603
            W    A  +Q+ A+RC            G    VG+N+  YW+S  +T+           W  E +DY  + N    S F     H T + WAKT   GCG+ +C     G+  + +VC+Y P GN+ N+  Y  G  CS+CP GT C  + GLC
Sbjct:   61 WLRSLATSSQIYANRC----PTGHSNMIG----VGENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSCEAATGLC 207          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Celegans
Match: lon-1 (LONg [Source:RefSeq peptide;Acc:NP_498167])

HSP 1 Score: 70.4774 bits (171), Expect = 1.631e-14
Identity = 48/148 (32.43%), Postives = 68/148 (45.95%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSR------KGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCP-NGTRCSNGLC 603
            + W+DE A  AQ  AD C F++ + R         VG+NI     ++ +D I +WF+EV +     +      C HY  ++WAKT   GCG + C        +G  N++ VC+Y P G             CS CP N   C  GLC
Sbjct:  103 LYWSDELAASAQRHADTCDFRHSRGRIN-------VGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVF-VCHYNPQGK------------CSNCPANAPACYQGLC 230          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Fly
Match: CG8483 (pep:known chromosome:BDGP6:3R:13208754:13214465:-1 gene:FBgn0038126 transcript:FBtr0082782 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG8483)

HSP 1 Score: 88.1965 bits (217), Expect = 3.603e-20
Identity = 62/138 (44.93%), Postives = 79/138 (57.25%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRD-RRFGGYSWVGQNIAY-WSSN--DVTDG-----IKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQ-ACS 564
            IVW+DE A RAQ  AD C F++D  R   RF     +GQN+A  WS+   D  DG     I+ WF+EV+ Y+F GD  S  T  HY+ L+W +T   GCG A+       N   VCNYGPGGN     PY+VG+ +CS
Sbjct:   68 IVWDDELAARAQKWADNCQFRHDPHRTINRFT----MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF-GDAWSPKTG-HYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Fly
Match: CG4270 (pep:known chromosome:BDGP6:2L:2263442:2264241:1 gene:FBgn0031407 transcript:FBtr0077754 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG4270)

HSP 1 Score: 50.447 bits (119), Expect = 9.971e-8
Identity = 29/80 (36.25%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  289 GQNIAYWSSNDVTD--GIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGN 522
            G+NI      DVT    ++MW+ E+  Y FN  +    T  H+T LIW  + E G G+A  + +     ++VCNY P GN
Sbjct:   83 GENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVP-TAGHFTQLIWKSSVEMGSGVARKADR----TWVVCNYNPPGN 157          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Fly
Match: Ag5r (Antigen 5-related [Source:FlyBase gene name;Acc:FBgn0015010])

HSP 1 Score: 50.8322 bits (120), Expect = 1.797e-7
Identity = 42/151 (27.81%), Postives = 63/151 (41.72%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA---YWSSNDVTD----GIKMWFDE--------VKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLG--NIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGT 582
            I WNDE A  A ++   C  ++D   +     + W GQN+A   Y++  +VT     G+ MW+DE        +  Y  N +   G    H+T L+  +  E GC  A  S  G       + CNY        +      +A S+C  GT
Sbjct:   90 IKWNDELAYLASLNVKSCQMKHDGCHNT--DAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Fly
Match: Ag5r (Antigen 5-related [Source:FlyBase gene name;Acc:FBgn0015010])

HSP 1 Score: 50.8322 bits (120), Expect = 1.797e-7
Identity = 42/151 (27.81%), Postives = 63/151 (41.72%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA---YWSSNDVTD----GIKMWFDE--------VKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLG--NIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGT 582
            I WNDE A  A ++   C  ++D   +     + W GQN+A   Y++  +VT     G+ MW+DE        +  Y  N +   G    H+T L+  +  E GC  A  S  G       + CNY        +      +A S+C  GT
Sbjct:   90 IKWNDELAYLASLNVKSCQMKHDGCHNT--DAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Fly
Match: Ag5r (Antigen 5-related [Source:FlyBase gene name;Acc:FBgn0015010])

HSP 1 Score: 50.8322 bits (120), Expect = 1.797e-7
Identity = 42/151 (27.81%), Postives = 63/151 (41.72%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA---YWSSNDVTD----GIKMWFDE--------VKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLG--NIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGT 582
            I WNDE A  A ++   C  ++D   +     + W GQN+A   Y++  +VT     G+ MW+DE        +  Y  N +   G    H+T L+  +  E GC  A  S  G       + CNY        +      +A S+C  GT
Sbjct:   90 IKWNDELAYLASLNVKSCQMKHDGCHNT--DAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:ZFIN;Acc:ZDB-GENE-040724-135])

HSP 1 Score: 103.605 bits (257), Expect = 3.730e-26
Identity = 60/160 (37.50%), Postives = 84/160 (52.50%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNI-----YIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW+D  A+ A+  A  C++++      RF     +GQN++  +     +   +K W DEVKDY+F            KC G  C HYT ++WA + + GC I  C    + G++     Y+VCNY P GNW  EAPYKVG  CS CP   G  CSN +C
Sbjct:   93 MVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Zebrafish
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 101.679 bits (252), Expect = 1.948e-24
Identity = 60/168 (35.71%), Postives = 89/168 (52.98%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            PT +N+   +W+DE  + A   A++C +++   +D        +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT L+WA T   GC +  C R  +        +Y+VCNY P GNW  EAPY+ G+ CS+CP   G  C + LC
Sbjct:   81 PTASNMEYMIWDDELERSATSWAEQCQWEHG-PQDLLMS----IGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLC 243          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 97.4413 bits (241), Expect = 5.911e-24
Identity = 55/160 (34.38%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            ++W+D  A+ A+  A  C++++      R+     +GQN++  + N   +   +K W+DEV+DY F            +C G  C HYT ++WA +   GC I  C    +         Y+VCNY P GNW  EAPY+VG  CS CP   G  CSN +C
Sbjct:   75 MLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSNNMC 229          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 92.8189 bits (229), Expect = 3.374e-22
Identity = 54/176 (30.68%), Postives = 94/176 (53.41%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSS--NDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNIY-----IVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            ++ Y+ R R   +P  ++       +VW++  A+ A+  A +C++++      +      +GQN++  S     + D +K W+DE   +++   +CSG  C HYT ++WA + + GC I  CS   + G+++     +VCNY   GNW  EAPYK+G+ CS CP+  G  C+   C
Sbjct:   69 LLDYHNRVRSQVFPPAAN----MEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH-----IGQNLSIISGRYKSIIDLVKSWYDERHSFSY-PSRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQC 234          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Zebrafish
Match: crispld1a (cysteine-rich secretory protein LCCL domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-090612-1])

HSP 1 Score: 93.9745 bits (232), Expect = 6.314e-22
Identity = 56/160 (35.00%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSS-NDVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++E  + A+  A+ C++++  +     G    +GQN+  +W      T  ++ W+DEVKDY+F            +CSG  C HYT L+WA +   GC I  C    +        +Y+VCNY P GNW   APYK G +CS CP   G  C   LC
Sbjct:   91 MVWDNELERSAEEWAETCLWEHGPA-----GLLPQIGQNLGVHWGRYRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHYTQLVWATSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSCSACPPSYGGVCRENLC 245          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-985953])

HSP 1 Score: 103.605 bits (257), Expect = 1.696e-25
Identity = 59/168 (35.12%), Postives = 88/168 (52.38%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P+ +N+    W+DE  + A+  A+ C++++  +          +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C R  +        +Y+VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   73 PSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-985953])

HSP 1 Score: 103.219 bits (256), Expect = 2.891e-25
Identity = 59/168 (35.12%), Postives = 88/168 (52.38%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P+ +N+    W+DE  + A+  A+ C++++  +          +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C R  +        +Y+VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   73 PSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Xenopus
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 97.0561 bits (240), Expect = 5.132e-24
Identity = 55/160 (34.38%), Postives = 79/160 (49.38%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSS--NDVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   +F     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA T   GC I  C    +        +Y+VCNY P GNW  EAPY +G  CS CP   G  CS+  C
Sbjct:   91 MVWDENLAKLAEAWAATCIWDHGPSYLLKF-----LGQNLSVRTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSACPPSYGGSCSDNQC 245          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Xenopus
Match: r3hdml (R3H domain containing-like [Source:Xenbase;Acc:XB-GENE-1011048])

HSP 1 Score: 94.3597 bits (233), Expect = 4.010e-23
Identity = 53/160 (33.12%), Postives = 85/160 (53.12%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A++C + +  ++  R+     +GQN++  S     + D +K W+DE + Y+F           +KC+G  C HYT ++WA +   GC +  C+   +         Y+VCNY   GNW  EAPYK+G+ CS CP   G  CSN +C
Sbjct:   87 MVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 241          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Xenopus
Match: CRISPLD1 (cysteine rich secretory protein LCCL domain containing 1 [Source:HGNC Symbol;Acc:HGNC:18206])

HSP 1 Score: 93.5893 bits (231), Expect = 1.878e-22
Identity = 58/168 (34.52%), Postives = 83/168 (49.40%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSS-NDVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P  +N+   +W+ E  + A+  A+ C++++  +          +GQN+ A+W      T  ++ W+DEV+DYTF            +CSG  C HYT L+WA +   GC I  C    +        IY+VCNY P GNW   APYK G  CS CP   G  C + LC
Sbjct:   53 PPASNMEFMIWDVELERSAEAWAETCLWEHGPADLLPV-----IGQNLGAHWGRYRPPTYHVQAWYDEVRDYTFPYPQECDPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYLVCNYSPKGNWWGHAPYKHGHPCSACPPSYGGGCKDNLC 215          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Mouse
Match: Pi15 (peptidase inhibitor 15 [Source:MGI Symbol;Acc:MGI:1934659])

HSP 1 Score: 101.293 bits (251), Expect = 3.997e-25
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:  102 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGACTDNLC 256          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Mouse
Match: Crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:MGI Symbol;Acc:MGI:1926142])

HSP 1 Score: 102.064 bits (253), Expect = 1.005e-24
Identity = 62/185 (33.51%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDG--IKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            I+  + + R   YP  S+      ++ W++E  + A   A RC++++  +     G    +GQN+A       + G  ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C    +        +Y+VCNY P GNW  EAPYK G+ CS CP+  G  C N LC
Sbjct:   59 ILMLHNKLRGQVYPPASN----MEHMTWDEELERSAAAWAHRCLWEHGPA-----GLLRSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLNNLC 234          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Mouse
Match: Crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:MGI Symbol;Acc:MGI:1926142])

HSP 1 Score: 102.064 bits (253), Expect = 1.005e-24
Identity = 62/185 (33.51%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDG--IKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            I+  + + R   YP  S+      ++ W++E  + A   A RC++++  +     G    +GQN+A       + G  ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C    +        +Y+VCNY P GNW  EAPYK G+ CS CP+  G  C N LC
Sbjct:   59 ILMLHNKLRGQVYPPASN----MEHMTWDEELERSAAAWAHRCLWEHGPA-----GLLRSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLNNLC 234          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Mouse
Match: Crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:MGI Symbol;Acc:MGI:1926142])

HSP 1 Score: 102.064 bits (253), Expect = 1.045e-24
Identity = 62/185 (33.51%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDG--IKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            I+  + + R   YP  S+      ++ W++E  + A   A RC++++  +     G    +GQN+A       + G  ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C    +        +Y+VCNY P GNW  EAPYK G+ CS CP+  G  C N LC
Sbjct:   59 ILMLHNKLRGQVYPPASN----MEHMTWDEELERSAAAWAHRCLWEHGPA-----GLLRSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLNNLC 234          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Mouse
Match: R3hdml (R3H domain containing-like [Source:MGI Symbol;Acc:MGI:3650937])

HSP 1 Score: 97.8265 bits (242), Expect = 5.591e-24
Identity = 55/160 (34.38%), Postives = 86/160 (53.75%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGDK---------CSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GN-----IYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTR--CSNGLC 603
            +VW+++ A+ A+  A +C++ +  S+  ++     VGQN++  S     V D ++ W +E + Y+F   K         CSG  C HYT ++WA +   GC I  CS   + GN     +Y+VCNY   GNW  EAPYK G+ CS CP   +  C++ +C
Sbjct:   87 MVWDEQLARSAEAWATQCIWTHGPSQLMKY-----VGQNLSIHSGRFRSVVDLVRSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKPCSACPPSYQGNCNSNMC 241          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. UniProt
Match: sp|Q7T141|PI15A_DANRE (Peptidase inhibitor 15-A OS=Danio rerio GN=pi15a PE=3 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 3.263e-25
Identity = 60/160 (37.50%), Postives = 84/160 (52.50%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNI-----YIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW+D  A+ A+  A  C++++      RF     +GQN++  +     +   +K W DEVKDY+F            KC G  C HYT ++WA + + GC I  C    + G++     Y+VCNY P GNW  EAPYKVG  CS CP   G  CSN +C
Sbjct:   93 MVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. UniProt
Match: sp|P35782|VA52_VESCR (Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 8.287e-25
Identity = 59/131 (45.04%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  169 TTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN-----DVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYK 546
            +   +VWNDE AQ AQ+ A++C + +D  R+     YS VGQNIA  S++     +V++ +KMW DEVKDY +   K       HYT ++WAKTKE GCG  D    G    Y+VCNYGP GN  NE  Y+
Sbjct:   73 SMNTLVWNDELAQIAQVWANQCNYGHDNCRNS--AKYS-VGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQYGSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIEDGWHRHYLVCNYGPAGNVGNEPIYE 200          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. UniProt
Match: sp|O43692|PI15_HUMAN (Peptidase inhibitor 15 OS=Homo sapiens GN=PI15 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.294e-24
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. UniProt
Match: sp|Q98ST6|PI15_CHICK (Peptidase inhibitor 15 OS=Gallus gallus GN=PI15 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.437e-24
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDETLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCYGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSACPPSYGGSCTDNLC 245          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. UniProt
Match: sp|Q4V9Y5|CRLD2_XENTR (Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 2.760e-24
Identity = 59/168 (35.12%), Postives = 88/168 (52.38%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P+ +N+    W+DE  + A+  A+ C++++  +          +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C R  +        +Y+VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   73 PSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. TrEMBL
Match: tr|A0A172RVP6|A0A172RVP6_SCHMD (TPX-1 protein (Fragment) OS=Schmidtea mediterranea GN=TPX-1 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 7.821e-36
Identity = 70/144 (48.61%), Postives = 91/144 (63.19%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCS-RKGLGNIY-IVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
            +VW+DE A  A+ SA+RCVFQ+D   DR    +   GQNI  ++  +  + IK+WFDE KDY++N D C+G  C HYT + WAK+   GC    C  R G    Y +VCNYGP GN+  E PYK G ACS CP G+ C++GLCS
Sbjct:    4 MVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNI--YAGWEPKEAIKLWFDENKDYSYNSDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCS 144          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. TrEMBL
Match: tr|A0A068XSF2|A0A068XSF2_HYMMI (Venom allergen (Val) protein OS=Hymenolepis microstoma GN=HmN_000466600 PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 5.760e-34
Identity = 62/122 (50.82%), Postives = 80/122 (65.57%), Query Frame = 1
Query:  178 NIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPY 543
            ++ W+ E    AQ  AD C+F++D S DR+   + WVGQNIAY SS  V   +KMWFDE KDY +N + CSG  C HYT L+WA T   GCG++ C+  G   +Y+VCNYGPGGN N + PY
Sbjct:   83 DLEWSTELEASAQKHADSCIFEHDGSDDRKTAQWWWVGQNIAYSSS--VAQNVKMWFDEYKDYNYNSNYCSG-VCGHYTQLVWADTTHVGCGVSRCTFSGFNAVYVVCNYGPGGNLNRQKPY 201          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. TrEMBL
Match: tr|G4VM60|G4VM60_SCHMA (Venom allergen-like (VAL) 1 protein OS=Schistosoma mansoni GN=Smp_193680 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.042e-31
Identity = 59/123 (47.97%), Postives = 81/123 (65.85%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKV 549
            + WN + A++AQ  A++C+ ++D+    +F   SWVGQNIA   +  +  G+  WF+E K Y +N + C    CLHYT + WAKT + GCG+A+C R GL    IVCNYGPGGNWNNE PY+V
Sbjct:   63 LKWNHDLARQAQSLANKCILRHDKRHSNQF---SWVGQNIALHPT--IKSGVDAWFNEHKLYNYNTNNCP--QCLHYTQMAWAKTTDIGCGVANCPRYGLS---IVCNYGPGGNWNNEKPYEV 175          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. TrEMBL
Match: tr|A0A1C9ZZV5|A0A1C9ZZV5_DUGJA (Uncharacterized protein (Fragment) OS=Dugesia japonica PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.145e-31
Identity = 60/149 (40.27%), Postives = 91/149 (61.07%), Query Frame = 1
Query:  172 TTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNI----YIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
               +VW+D  A +A+  A +C+  +D   DR+   + +VGQN+  ++ ++  + ++ W+DE KDYT+ G  CS   C HYT + W+K+   GC   +C  K  G+       +CNYGP GN+N+EAPY+VG ACS+CP GT C N LC+
Sbjct:   59 MIEMVWDDALAGKAEEWAGKCIAGHDTYDDRQLDKFMFVGQNM--FAGSNYKEVVQGWYDEYKDYTYEGKGCSA-VCGHYTQVAWSKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCA 204          
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. TrEMBL
Match: tr|G4VM59|G4VM59_SCHMA (Venom allergen-like (VAL) 21 protein OS=Schistosoma mansoni GN=Smp_159290 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 8.971e-31
Identity = 59/123 (47.97%), Postives = 81/123 (65.85%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKV 549
            + WN + A++AQ  A++C+ ++D+   R    +SWVGQNIA   +  +  G+  WF+E K Y +N + C    CLHYT + WAKT + GCG+A+C R GL    IVCNYGPGGNWNNE PY+V
Sbjct:   63 LKWNHDLARQAQSLANKCILRHDK---RHSNQFSWVGQNIALHPT--IKSGVDAWFNEHKLYNYNMNNCP--QCLHYTQMAWAKTTDIGCGVANCPRYGLS---IVCNYGPGGNWNNEKPYEV 175          
The following BLAST results are available for this feature:
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
PI154.464e-2535.63peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
PI154.464e-2535.63peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
CRISPLD21.310e-2335.00cysteine rich secretory protein LCCL domain contai... [more]
CRISPLD22.213e-2335.00cysteine rich secretory protein LCCL domain contai... [more]
CRISPLD22.441e-2335.00cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
scl-52.133e-1630.59SCP-Like extracellular protein [Source:RefSeq pep... [more]
scl-106.588e-1631.74SCP-Like extracellular protein [Source:RefSeq pep... [more]
lon-12.325e-1533.33LONg [Source:RefSeq peptide;Acc:NP_498167][more]
scl-145.732e-1532.90SCP-Like extracellular protein [Source:RefSeq pep... [more]
lon-11.631e-1432.43LONg [Source:RefSeq peptide;Acc:NP_498167][more]
back to top
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
CG84833.603e-2044.93pep:known chromosome:BDGP6:3R:13208754:13214465:-1... [more]
CG42709.971e-836.25pep:known chromosome:BDGP6:2L:2263442:2264241:1 ge... [more]
Ag5r1.797e-727.81Antigen 5-related [Source:FlyBase gene name;Acc:FB... [more]
Ag5r1.797e-727.81Antigen 5-related [Source:FlyBase gene name;Acc:FB... [more]
Ag5r1.797e-727.81Antigen 5-related [Source:FlyBase gene name;Acc:FB... [more]
back to top
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
pi15a3.730e-2637.50peptidase inhibitor 15a [Source:ZFIN;Acc:ZDB-GENE-... [more]
CRISPLD21.948e-2435.71cysteine rich secretory protein LCCL domain contai... [more]
pi15b5.911e-2434.38peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
r3hdml3.374e-2230.68R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
crispld1a6.314e-2235.00cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
crispld21.696e-2535.12cysteine-rich secretory protein LCCL domain contai... [more]
crispld22.891e-2535.12cysteine-rich secretory protein LCCL domain contai... [more]
PI155.132e-2434.38peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
r3hdml4.010e-2333.13R3H domain containing-like [Source:Xenbase;Acc:XB-... [more]
CRISPLD11.878e-2234.52cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Pi153.997e-2535.63peptidase inhibitor 15 [Source:MGI Symbol;Acc:MGI:... [more]
Crispld21.005e-2433.51cysteine-rich secretory protein LCCL domain contai... [more]
Crispld21.005e-2433.51cysteine-rich secretory protein LCCL domain contai... [more]
Crispld21.045e-2433.51cysteine-rich secretory protein LCCL domain contai... [more]
R3hdml5.591e-2434.38R3H domain containing-like [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T141|PI15A_DANRE3.263e-2537.50Peptidase inhibitor 15-A OS=Danio rerio GN=pi15a P... [more]
sp|P35782|VA52_VESCR8.287e-2545.04Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1[more]
sp|O43692|PI15_HUMAN2.294e-2435.63Peptidase inhibitor 15 OS=Homo sapiens GN=PI15 PE=... [more]
sp|Q98ST6|PI15_CHICK2.437e-2435.63Peptidase inhibitor 15 OS=Gallus gallus GN=PI15 PE... [more]
sp|Q4V9Y5|CRLD2_XENTR2.760e-2435.12Cysteine-rich secretory protein LCCL domain-contai... [more]
back to top
BLAST of Cysteine-rich secretory protein LCCL domain-containing 2 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A172RVP6|A0A172RVP6_SCHMD7.821e-3648.61TPX-1 protein (Fragment) OS=Schmidtea mediterranea... [more]
tr|A0A068XSF2|A0A068XSF2_HYMMI5.760e-3450.82Venom allergen (Val) protein OS=Hymenolepis micros... [more]
tr|G4VM60|G4VM60_SCHMA3.042e-3147.97Venom allergen-like (VAL) 1 protein OS=Schistosoma... [more]
tr|A0A1C9ZZV5|A0A1C9ZZV5_DUGJA4.145e-3140.27Uncharacterized protein (Fragment) OS=Dugesia japo... [more]
tr|G4VM59|G4VM59_SCHMA8.971e-3147.97Venom allergen-like (VAL) 21 protein OS=Schistosom... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.492
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 13..32
IPR001283Cysteine-rich secretory protein, allergen V5/Tpx-1-relatedPRINTSPR00837V5TPXLIKEcoord: 79..95
score: 44.27
coord: 56..69
score: 34.89
coord: 6..24
score: 33.46
coord: 109..122
score: 52.41
IPR002413Ves allergenPRINTSPR00838V5ALLERGENcoord: 6..24
score: 49.34
coord: 54..69
score: 48.83
coord: 78..97
score: 55.94
IPR014044CAP domainSMARTSM00198SCP_3coord: 2..122
e-value: 5.7E-24
score: 95.6
IPR014044CAP domainGENE3DG3DSA:3.40.33.10coord: 5..146
e-value: 1.2E-44
score: 152.0
IPR014044CAP domainPFAMPF00188CAPcoord: 6..114
e-value: 3.8E-18
score: 66.4
IPR014044CAP domainSUPERFAMILYSSF55797PR-1-likecoord: 6..129
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01010CRISP_2coord: 109..120

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001283Allrgn_V5/Tpx1
IPR002413V5_allergen
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000004Stage 4
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000058embryonic digestive system
PLANA:0000023temporary embryonic pharynx
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015313 ID=SMED30015313|Name=Cysteine-rich secretory protein LCCL domain-containing 2|organism=Schmidtea mediterranea sexual|type=transcript|length=614bp
GATTTACTTTACATAAGCGATTGTATCAATAAATTATCGTTTGAGATGAA
TTCGAAATCAGTAAATTAATCATCGTATTCATAGAAAGAAAATGAGAAAT
TCTCTATTATTTAGTATAATGTTAGGTGTCGTTATCTCAGTTATCCAGTG
TTATCTGACTCCTGACCAACAACAACAAATATTGTATGGAACGATGAAGC
TGCACAACGAGCTCAAATGTCGGCTGATCGTTGCGTTTTCCAATATGATC
AATCAAGAGATCGTCGATTTGGAGGTTATAGCTGGGTTGGTCAAAATATT
GCATACTGGTCAAGCAATGACGTGACAGACGGTATCAAGATGTGGTTCGA
CGAAGTCAAAGATTACACATTCAATGGAGATAAATGTAGTGGATTTACAT
GCTTGCATTACACAGCTTTAATCTGGGCAAAAACCAAGGAATTTGGATGT
GGAATAGCAGATTGTTCTCGAAAGGGTTTAGGAAATATTTACATCGTCTG
TAATTATGGACCCGGTGGAAATTGGAACAACGAAGCACCATATAAAGTTG
GACAAGCATGTTCCAGATGTCCAAATGGAACCAGATGCAGCAATGGACTA
TGCAGTTAGAAATA
back to top

protein sequence of SMED30015313-orf-1

>SMED30015313-orf-1 ID=SMED30015313-orf-1|Name=SMED30015313-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDY
TFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPG
GNWNNEAPYKVGQACSRCPNGTRCSNGLCS*
back to top
Aliases
The feature 'Cysteine-rich secretory protein LCCL domain-containing 2' has the following synonyms
Synonym
VAL-like