Venom allergen 5

Overview
NameVenom allergen 5
Smed IDSMED30015313
Uniprot Best hitPeptidase inhibitor 15-A OS=Danio rerio OX=7955 GN=pi15a PE=3 SV=2 (E=6.14656e-26)
Length (bp)614
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Venom allergen 5 (SMED30015313) t-SNE clustered cells

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30015313) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Venom allergen 5 (SMED30015313) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30015313) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Venom allergen 5 ( VAL-like ) is expressed during Stage 3, Stage 4 and Stage 5 in the embryonic digestive system and embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Definitive gut progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and gata456a (green). Definitive gut progenitors, coexpressing piwi-1 and gata456a, are dispersed in the embryonic wall. As definitive gut progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of gata456a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Muscle progenitors arise in the piwi-1+ blastomere population during S5. 

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and myoD (green). Muscle progenitors, coexpressing piwi-1 and myoD, are dispersed in the embryonic wall. As muscle progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of myoD. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

 

Neural progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and pax6a (green). Neural progenitors, coexpressing piwi-1 and pax6a, are dispersed in the embryonic wall. As neural progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of pax6a. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

Anatomical Expression

PAGE et. al., 2020




SMED30015313

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30015313SMESG000047165.1 dd_Smed_v4_14382_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
X1 cellSMED30015313SMESG000047165.1 SmedASXL_010175SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
embryonic pharynxSMED30015313SMESG000047165.1 SMED30015313smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
embryonic pharynxSMED30015313SMESG000047165.1 SMED30015313smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
embryonic pharynxSMED30015313SMESG000047165.1 SMED30015313smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
embryonic pharynxSMED30015313SMESG000047165.1 SMED30015313smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
headSMED30015313SMESG000047165.1 OX_Smed_1.0.20877ox_Smed_v2PMID:24238224whole organismasexual adultRNA-sequencing evidence
Homology
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 101.293 bits (251), Expect = 9.711e-26
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 101.293 bits (251), Expect = 9.711e-26
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 101.293 bits (251), Expect = 9.711e-26
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 98.9821 bits (245), Expect = 8.253e-24
Identity = 56/160 (35.00%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            + W+DE  + A   A +C++++  +          +GQN+ A+W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C +  +        +Y VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   80 MTWDDELEKSAAAWASQCIWEHGPT-----SLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLC 234          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 98.9821 bits (245), Expect = 1.114e-23
Identity = 56/160 (35.00%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSSNDVTD-GIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            + W+DE  + A   A +C++++  +          +GQN+ A+W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C +  +        +Y VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   80 MTWDDELEKSAAAWASQCIWEHGPT-----SLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLC 234          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 75.0998 bits (183), Expect = 1.370e-16
Identity = 52/170 (30.59%), Postives = 80/170 (47.06%), Query Frame = 1
Query:  145 PVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSSNDVTD-------GIKMWFDEVKDYTFNGDKCS----GFTCLHYTALIWAKTKEFGCGIADCSR--KGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRC--SNGLCS 606
            P  SD       + W+   A  AQ  A++C   +         G + +G+N+  YW+S  +T+       G   W  E +DY ++ +  S         H T + WAKT   GCG+ +C +   G   + +VC Y P GN+ N+  Y  G  CS+CP+GT C  + GLC+
Sbjct:   51 PAASD----MLKMKWDATVAASAQAYANKCPTGHS--------GAAGLGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLCA 208          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 73.559 bits (179), Expect = 4.873e-16
Identity = 53/167 (31.74%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  166 PTTTN---IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTD---------GIKMWFDEVKDYTFNGDKC------SGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIV-CNYGPGGNWNNEAPYKVGQACSRCPNGTRC--SNGLC 603
            P+ +N   ++W+      AQ  +  C   +  SR         +G+N+ +W+S  VT             +W  E + + +NG+        SG    H T + WA T + GCGI+ CS    G  Y+V C Y P GN+     YK G+ CS CP+GT C  S GLC
Sbjct:   54 PSASNMMKLIWDTTLETTAQDYSTGCPTGHSASRAN-------IGENMYWWTSPVVTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFNSGIG--HATQMAWATTNKIGCGISKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNCESSTGLC 211          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.606e-15
Identity = 50/150 (33.33%), Postives = 71/150 (47.33%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSR------KGLGNIYIVCNYGPGGNWNNEAPYKVGQ--ACSRCP-NGTRCSNGLC 603
            + W+DE A  AQ  AD C F++ + R         VG+NI     ++ +D I +WF+EV +     +      C HY  ++WAKT   GCG + C        +G  N++ VC+Y P GN      +  G    CS CP N   C  GLC
Sbjct:  103 LYWSDELAASAQRHADTCDFRHSRGRIN-------VGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVF-VCHYNPQGNTMPAFTWASGDNGKCSNCPANAPACYQGLC 244          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 70.8626 bits (172), Expect = 5.026e-15
Identity = 51/155 (32.90%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  187 WNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSSNDVTD-------GIKMWFDEVKDY--TFNGDKCSGFT--CLHYTALIWAKTKEFGCGIADCSR--KGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRC--SNGLC 603
            W    A  +Q+ A+RC            G    VG+N+  YW+S  +T+           W  E +DY  + N    S F     H T + WAKT   GCG+ +C     G+  + +VC+Y P GN+ N+  Y  G  CS+CP GT C  + GLC
Sbjct:   61 WLRSLATSSQIYANRC----PTGHSNMIG----VGENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSCEAATGLC 207          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.921e-14
Identity = 48/148 (32.43%), Postives = 68/148 (45.95%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSR------KGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCP-NGTRCSNGLC 603
            + W+DE A  AQ  AD C F++ + R         VG+NI     ++ +D I +WF+EV +     +      C HY  ++WAKT   GCG + C        +G  N++ VC+Y P G             CS CP N   C  GLC
Sbjct:  103 LYWSDELAASAQRHADTCDFRHSRGRIN-------VGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVF-VCHYNPQGK------------CSNCPANAPACYQGLC 230          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 88.1965 bits (217), Expect = 2.561e-20
Identity = 62/138 (44.93%), Postives = 79/138 (57.25%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRD-RRFGGYSWVGQNIAY-WSSN--DVTDG-----IKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQ-ACS 564
            IVW+DE A RAQ  AD C F++D  R   RF     +GQN+A  WS+   D  DG     I+ WF+EV+ Y+F GD  S  T  HY+ L+W +T   GCG A+       N   VCNYGPGGN     PY+VG+ +CS
Sbjct:   68 IVWDDELAARAQKWADNCQFRHDPHRTINRFT----MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF-GDAWSPKTG-HYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077754)

HSP 1 Score: 50.447 bits (119), Expect = 1.077e-7
Identity = 29/80 (36.25%), Postives = 42/80 (52.50%), Query Frame = 1
Query:  289 GQNIAYWSSNDVTD--GIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGN 522
            G+NI      DVT    ++MW+ E+  Y FN  +    T  H+T LIW  + E G G+A  + +     ++VCNY P GN
Sbjct:   83 GENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVP-TAGHFTQLIWKSSVEMGSGVARKADR----TWVVCNYNPPGN 157          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0333658)

HSP 1 Score: 50.8322 bits (120), Expect = 1.649e-7
Identity = 42/151 (27.81%), Postives = 63/151 (41.72%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA---YWSSNDVTD----GIKMWFDE--------VKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLG--NIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGT 582
            I WNDE A  A ++   C  ++D   +     + W GQN+A   Y++  +VT     G+ MW+DE        +  Y  N +   G    H+T L+  +  E GC  A  S  G       + CNY        +      +A S+C  GT
Sbjct:   90 IKWNDELAYLASLNVKSCQMKHDGCHNT--DAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0073937)

HSP 1 Score: 50.8322 bits (120), Expect = 1.649e-7
Identity = 42/151 (27.81%), Postives = 63/151 (41.72%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA---YWSSNDVTD----GIKMWFDE--------VKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLG--NIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGT 582
            I WNDE A  A ++   C  ++D   +     + W GQN+A   Y++  +VT     G+ MW+DE        +  Y  N +   G    H+T L+  +  E GC  A  S  G       + CNY        +      +A S+C  GT
Sbjct:   90 IKWNDELAYLASLNVKSCQMKHDGCHNT--DAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0305582)

HSP 1 Score: 50.8322 bits (120), Expect = 1.649e-7
Identity = 42/151 (27.81%), Postives = 63/151 (41.72%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA---YWSSNDVTD----GIKMWFDE--------VKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLG--NIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGT 582
            I WNDE A  A ++   C  ++D   +     + W GQN+A   Y++  +VT     G+ MW+DE        +  Y  N +   G    H+T L+  +  E GC  A  S  G       + CNY        +      +A S+C  GT
Sbjct:   90 IKWNDELAYLASLNVKSCQMKHDGCHNT--DAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 103.605 bits (257), Expect = 8.142e-27
Identity = 60/160 (37.50%), Postives = 84/160 (52.50%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNI-----YIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW+D  A+ A+  A  C++++      RF     +GQN++  +     +   +K W DEVKDY+F            KC G  C HYT ++WA + + GC I  C    + G++     Y+VCNY P GNW  EAPYKVG  CS CP   G  CSN +C
Sbjct:   93 MVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 101.679 bits (252), Expect = 9.789e-25
Identity = 60/168 (35.71%), Postives = 89/168 (52.98%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            PT +N+   +W+DE  + A   A++C +++   +D        +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT L+WA T   GC +  C R  +        +Y+VCNY P GNW  EAPY+ G+ CS+CP   G  C + LC
Sbjct:   81 PTASNMEYMIWDDELERSATSWAEQCQWEHG-PQDLLMS----IGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLC 243          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 97.4413 bits (241), Expect = 1.480e-24
Identity = 55/160 (34.38%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            ++W+D  A+ A+  A  C++++      R+     +GQN++  + N   +   +K W+DEV+DY F            +C G  C HYT ++WA +   GC I  C    +         Y+VCNY P GNW  EAPY+VG  CS CP   G  CSN +C
Sbjct:   75 MLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSNNMC 229          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 97.8265 bits (242), Expect = 1.613e-24
Identity = 55/160 (34.38%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            ++W+D  A+ A+  A  C++++      R+     +GQN++  + N   +   +K W+DEV+DY F            +C G  C HYT ++WA +   GC I  C    +         Y+VCNY P GNW  EAPY+VG  CS CP   G  CSN +C
Sbjct:   90 MLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSNNMC 244          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 92.8189 bits (229), Expect = 1.126e-22
Identity = 54/176 (30.68%), Postives = 94/176 (53.41%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSS--NDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNIY-----IVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            ++ Y+ R R   +P  ++       +VW++  A+ A+  A +C++++      +      +GQN++  S     + D +K W+DE   +++   +CSG  C HYT ++WA + + GC I  CS   + G+++     +VCNY   GNW  EAPYK+G+ CS CP+  G  C+   C
Sbjct:   69 LLDYHNRVRSQVFPPAAN----MEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH-----IGQNLSIISGRYKSIIDLVKSWYDERHSFSY-PSRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQC 234          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 103.605 bits (257), Expect = 2.508e-25
Identity = 59/168 (35.12%), Postives = 88/168 (52.38%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P+ +N+    W+DE  + A+  A+ C++++  +          +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C R  +        +Y+VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   73 PSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 103.605 bits (257), Expect = 2.672e-25
Identity = 59/168 (35.12%), Postives = 88/168 (52.38%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P+ +N+    W+DE  + A+  A+ C++++  +          +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C R  +        +Y+VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   73 PSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 103.219 bits (256), Expect = 2.832e-25
Identity = 59/168 (35.12%), Postives = 88/168 (52.38%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P+ +N+    W+DE  + A+  A+ C++++  +          +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C R  +        +Y+VCNY P GNW  EAPYK G+ CS CP   G  C N LC
Sbjct:   73 PSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: pi15 (peptidase inhibitor 15 [Source:NCBI gene;Acc:100489915])

HSP 1 Score: 97.0561 bits (240), Expect = 3.839e-24
Identity = 55/160 (34.38%), Postives = 79/160 (49.38%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSS--NDVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   +F     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA T   GC I  C    +        +Y+VCNY P GNW  EAPY +G  CS CP   G  CS+  C
Sbjct:   91 MVWDENLAKLAEAWAATCIWDHGPSYLLKF-----LGQNLSVRTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSACPPSYGGSCSDNQC 245          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 94.7449 bits (234), Expect = 2.932e-23
Identity = 53/160 (33.12%), Postives = 85/160 (53.12%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A++C + +  ++  R+     +GQN++  S     + D +K W+DE + Y+F           +KC+G  C HYT ++WA +   GC +  C+   +         Y+VCNY   GNW  EAPYK+G+ CS CP   G  CSN +C
Sbjct:   82 MVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 236          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi15 (peptidase inhibitor 15 [Source:MGI Symbol;Acc:MGI:1934659])

HSP 1 Score: 101.293 bits (251), Expect = 9.781e-26
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:  102 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGACTDNLC 256          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:MGI Symbol;Acc:MGI:1926142])

HSP 1 Score: 102.064 bits (253), Expect = 5.469e-25
Identity = 62/185 (33.51%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDG--IKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            I+  + + R   YP  S+      ++ W++E  + A   A RC++++  +     G    +GQN+A       + G  ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C    +        +Y+VCNY P GNW  EAPYK G+ CS CP+  G  C N LC
Sbjct:   59 ILMLHNKLRGQVYPPASN----MEHMTWDEELERSAAAWAHRCLWEHGPA-----GLLRSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLNNLC 234          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:MGI Symbol;Acc:MGI:1926142])

HSP 1 Score: 102.064 bits (253), Expect = 5.469e-25
Identity = 62/185 (33.51%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDG--IKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            I+  + + R   YP  S+      ++ W++E  + A   A RC++++  +     G    +GQN+A       + G  ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C    +        +Y+VCNY P GNW  EAPYK G+ CS CP+  G  C N LC
Sbjct:   59 ILMLHNKLRGQVYPPASN----MEHMTWDEELERSAAAWAHRCLWEHGPA-----GLLRSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLNNLC 234          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:MGI Symbol;Acc:MGI:1926142])

HSP 1 Score: 102.064 bits (253), Expect = 5.660e-25
Identity = 62/185 (33.51%), Postives = 94/185 (50.81%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDG--IKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            I+  + + R   YP  S+      ++ W++E  + A   A RC++++  +     G    +GQN+A       + G  ++ W+DEVKDYT+           ++CSG  C HYT ++WA T + GC +  C    +        +Y+VCNY P GNW  EAPYK G+ CS CP+  G  C N LC
Sbjct:   59 ILMLHNKLRGQVYPPASN----MEHMTWDEELERSAAAWAHRCLWEHGPA-----GLLRSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYTYPYPHECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLNNLC 234          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: R3hdml (R3H domain containing-like [Source:MGI Symbol;Acc:MGI:3650937])

HSP 1 Score: 97.8265 bits (242), Expect = 1.420e-24
Identity = 55/160 (34.38%), Postives = 86/160 (53.75%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGDK---------CSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GN-----IYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTR--CSNGLC 603
            +VW+++ A+ A+  A +C++ +  S+  ++     VGQN++  S     V D ++ W +E + Y+F   K         CSG  C HYT ++WA +   GC I  CS   + GN     +Y+VCNY   GNW  EAPYK G+ CS CP   +  C++ +C
Sbjct:   87 MVWDEQLARSAEAWATQCIWTHGPSQLMKY-----VGQNLSIHSGRFRSVVDLVRSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKPCSACPPSYQGNCNSNMC 241          
BLAST of Venom allergen 5 vs. UniProt
Match: sp|Q7T141|PI15A_DANRE (Peptidase inhibitor 15-A OS=Danio rerio OX=7955 GN=pi15a PE=3 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 6.147e-26
Identity = 60/160 (37.50%), Postives = 84/160 (52.50%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNI-----YIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW+D  A+ A+  A  C++++      RF     +GQN++  +     +   +K W DEVKDY+F            KC G  C HYT ++WA + + GC I  C    + G++     Y+VCNY P GNW  EAPYKVG  CS CP   G  CSN +C
Sbjct:   93 MVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of Venom allergen 5 vs. UniProt
Match: sp|P35782|VA52_VESCR (Venom allergen 5.02 OS=Vespa crabro OX=7445 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.264e-25
Identity = 59/131 (45.04%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  169 TTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN-----DVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYK 546
            +   +VWNDE AQ AQ+ A++C + +D  R+     YS VGQNIA  S++     +V++ +KMW DEVKDY +   K       HYT ++WAKTKE GCG  D    G    Y+VCNYGP GN  NE  Y+
Sbjct:   73 SMNTLVWNDELAQIAQVWANQCNYGHDNCRNS--AKYS-VGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQYGSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIEDGWHRHYLVCNYGPAGNVGNEPIYE 200          
BLAST of Venom allergen 5 vs. UniProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.288e-25
Identity = 59/154 (38.31%), Postives = 80/154 (51.95%), Query Frame = 1
Query:  166 PTTTN---IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSND-VTDGIKMWFDEVKDYT---FNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCS-NGLC 603
            P+  N   + WNDE A  AQ SA+ CVF++     R+   YS++G+NI   S  D +   +  W+DEVKD T          G    HYT ++WA T+  GCG+   S +   N Y+ C YGPGGN+ ++  YK G   S C NG      GLC
Sbjct:   59 PSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALGCGLVTASDR---NSYLFCQYGPGGNYRSQPIYKQGPPASDCKNGKSSKYPGLC 209          
BLAST of Venom allergen 5 vs. UniProt
Match: sp|O43692|PI15_HUMAN (Peptidase inhibitor 15 OS=Homo sapiens OX=9606 GN=PI15 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.663e-25
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDENLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of Venom allergen 5 vs. UniProt
Match: sp|Q98ST6|PI15_CHICK (Peptidase inhibitor 15 OS=Gallus gallus OX=9031 GN=PI15 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.968e-25
Identity = 57/160 (35.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +  S   RF     +GQN++  +     +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    +        +Y+VCNY P GNW  EAPYKVG  CS CP   G  C++ LC
Sbjct:   91 MVWDETLAKSAEAWAATCIWDHGPSYLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCYGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSACPPSYGGSCTDNLC 245          
BLAST of Venom allergen 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|20330030 (tr|A0A172RVP6|A0A172RVP6_SCHMD TPX-1 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=TPX-1 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.292e-36
Identity = 70/144 (48.61%), Postives = 91/144 (63.19%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCS-RKGLGNIY-IVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
            +VW+DE A  A+ SA+RCVFQ+D   DR    +   GQNI  ++  +  + IK+WFDE KDY++N D C+G  C HYT + WAK+   GC    C  R G    Y +VCNYGP GN+  E PYK G ACS CP G+ C++GLCS
Sbjct:    4 MVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNI--YAGWEPKEAIKLWFDENKDYSYNSDGCNG-VCGHYTQVAWAKSYAVGCASVHCEGRNGFQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCS 144          
BLAST of Venom allergen 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|19350479 (tr|A0A564YFQ7|A0A564YFQ7_HYMDI SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5585 PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 7.284e-36
Identity = 62/122 (50.82%), Postives = 83/122 (68.03%), Query Frame = 1
Query:  178 NIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPY 543
            ++ WN E    AQ  ADRC FQ+D S DR+   + WVGQNIAY SS  +   +KMWF+E KDY ++ + CSG  C HYT L+WA T + GCG++ C+  G   +++VCNYGPGGN+NN+ PY
Sbjct:   83 DLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAYSSS--IAQNVKMWFEEHKDYNYSHNYCSG-VCGHYTQLVWANTTDVGCGVSKCNFSGFNAVFVVCNYGPGGNFNNQKPY 201          
BLAST of Venom allergen 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|22848494 (tr|A0A3Q0KUA5|A0A3Q0KUA5_SCHMA Venom allergen-like (VAL) 1 protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 6.725e-32
Identity = 61/131 (46.56%), Postives = 85/131 (64.89%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCP 573
            + WN + A++AQ  A++C+ ++D+   R    +SWVGQNIA   +  +  G+  WF+E K Y +N + C    CLHYT + WAKT + GCG+A+C R GL    IVCNYGPGGNWNNE PY+V +  + CP
Sbjct:   63 LKWNHDLARQAQSLANKCILRHDK---RHSNQFSWVGQNIALHPT--IKSGVDAWFNEHKLYNYNTNNCP--QCLHYTQMAWAKTTDIGCGVANCPRYGLS---IVCNYGPGGNWNNEKPYEV-KPRNLCP 182          
BLAST of Venom allergen 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|22834172 (tr|G4VM60|G4VM60_SCHMA Venom allergen-like (VAL) 1 protein OS=Schistosoma mansoni OX=6183 GN=Smp_193680 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 7.096e-32
Identity = 59/123 (47.97%), Postives = 81/123 (65.85%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKV 549
            + WN + A++AQ  A++C+ ++D+    +F   SWVGQNIA   +  +  G+  WF+E K Y +N + C    CLHYT + WAKT + GCG+A+C R GL    IVCNYGPGGNWNNE PY+V
Sbjct:   63 LKWNHDLARQAQSLANKCILRHDKRHSNQF---SWVGQNIALHPT--IKSGVDAWFNEHKLYNYNTNNCP--QCLHYTQMAWAKTTDIGCGVANCPRYGLS---IVCNYGPGGNWNNEKPYEV 175          
BLAST of Venom allergen 5 vs. TrEMBL
Match: gnl|BL_ORD_ID|19615377 (tr|A0A1C9ZZV5|A0A1C9ZZV5_DUGJA SCP domain-containing protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 9.830e-32
Identity = 60/149 (40.27%), Postives = 91/149 (61.07%), Query Frame = 1
Query:  172 TTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNI----YIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
               +VW+D  A +A+  A +C+  +D   DR+   + +VGQN+  ++ ++  + ++ W+DE KDYT+ G  CS   C HYT + W+K+   GC   +C  K  G+       +CNYGP GN+N+EAPY+VG ACS+CP GT C N LC+
Sbjct:   59 MIEMVWDDALAGKAEEWAGKCIAGHDTYDDRQLDKFMFVGQNM--FAGSNYKEVVQGWYDEYKDYTYEGKGCSA-VCGHYTQVAWSKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCA 204          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 105.145 bits (261), Expect = 1.924e-27
Identity = 60/160 (37.50%), Postives = 85/160 (53.12%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNI-----YIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW+D  A+RA+  A  C++++      RF     +GQN++  +     +   +K W+DEVKDY+F            KC G  C HYT ++WA + + GC I  C    + G++     Y+VCNY P GNW  EAPYKVG  CS CP      CSN +C
Sbjct:   92 MVWDDSLAKRAEEWASTCLWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKIGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYAGSCSNNMC 246          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 105.145 bits (261), Expect = 2.196e-27
Identity = 65/185 (35.14%), Postives = 95/185 (51.35%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNI-----YIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            I+ Y+ + R   +P  S+       +VW+D  A+RA+  A  C++++      RF     +GQN++  +     +   +K W+DEVKDY+F            KC G  C HYT ++WA + + GC I  C    + G++     Y+VCNY P GNW  EAPYKVG  CS CP      CSN +C
Sbjct:   78 ILQYHNKVRGKVFPPASN----MEYMVWDDSLAKRAEEWASTCLWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKIGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYAGSCSNNMC 253          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 104.375 bits (259), Expect = 8.439e-26
Identity = 63/168 (37.50%), Postives = 89/168 (52.98%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            PT +N+   VW+DE  + A   A++C +++   +D        +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT L+WA T   GC +  CSR  +        IY+VCNY P GNW  EAPY  G+ CS+CP   G  C + LC
Sbjct:   77 PTASNMEYMVWDDELERSATHWAEQCQWEHG-PQDLLMS----IGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTSRVGCAVHTCSRMNVWGEIWENAIYLVCNYSPKGNWIGEAPYAHGRPCSQCPPSYGGGCRDNLC 239          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: pi15b (peptidase inhibitor 15 [Source:NCBI gene;Acc:103024870])

HSP 1 Score: 93.5893 bits (231), Expect = 5.552e-23
Identity = 58/160 (36.25%), Postives = 83/160 (51.88%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNI-----YIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            +VW++  A+ A+  A  C++ +      R+     +GQN++  + N   +   +K W+DEVKDY F            +C G  C HYT ++WA +   GC I  C    + G++     Y+VCNY P GNW  EAPYKVG  CS CP   G  CSN +C
Sbjct:   96 MVWDESLARSAEAWAAACIWDHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVKDYVFPYPRDCNPRCPMRCYGPMCTHYTQMVWATSNRVGCAINVCYNMVVWGSVWREATYLVCNYSPKGNWIGEAPYKVGAPCSACPPSYGGSCSNNMC 250          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: crispld1a (cysteine-rich secretory protein LCCL domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-090612-1])

HSP 1 Score: 95.5153 bits (236), Expect = 8.909e-23
Identity = 59/169 (34.91%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYW--SSNDVTDGIKMWFDEVKDYTFNGDK---------CSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P ++N+   VW+ E  + A+  A+ C++++  +     G    +GQN+  +W  S    T  ++ W+DEVKDY+F   +         C+G  C HYT L+WA +   GC I  C    +        +Y+VCNY P GNW   APYK G  CS CP   G  C N LC
Sbjct:   78 PPSSNMEYMVWDTELERSAEEWAETCLWEHGPA-----GLLPQIGQNLGVHWGRSVPAPTSHVQAWYDEVKDYSFPYPQECNPHCPFTCTGPVCTHYTQLVWATSSRIGCAINVCYDMNVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGSPCSACPPSYGGGCRNNLC 241          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 2.026e-22
Identity = 59/182 (32.42%), Postives = 88/182 (48.35%), Query Frame = 1
Query:  115 YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYW--SSNDVTDGIKMWFDEVKDYTFNGDK---------CSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGN------IYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            Y+ R R   +P  +D      ++ W+ E A  A+  A +C + +  S          +GQN+A +  S   +   ++ WFDE + Y +  +K         C G  C HYT L+WA+++  GC +  C    + +      +Y+VCNY P GNW  EAPY+ G  CSRCP   G  C  GLC
Sbjct:   12 YHNRLRASVHPQAAD----MEHMSWDWELAGMAEAWAKQCKWGHGPSDQ-----LDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 4.667e-21
Identity = 52/167 (31.14%), Postives = 74/167 (44.31%), Query Frame = 1
Query:  166 PTTTNI---VWNDEAAQRAQMSADRCV-FQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            P ++N+    W  +  + A     RC+      +     G   W+       S    +  ++ W+DE KDY +  +         +C+G  C HYT L+WA T   GC I  C    +        +Y+VCNY P GNW   +PYK G+ACS CP   G  C N LC
Sbjct:   12 PPSSNMEYMAWVKKLIKEAARYPGRCLRLMQPMAMIHFLGQPHWL-------SHRPPSFHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLC 171          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 64.6994 bits (156), Expect = 5.090e-13
Identity = 51/149 (34.23%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWV-GQNIAYWSSNDVT--DGIKMWFDEVKDYTFNGDKCSGFTCL--HYTALIWAKTKEFGCGIADCSR-KGLGNIYIVCNYGPGGNWNNEA--PYKVGQACSRCPNGTRCSNGLC 603
            ++W  EA   A   A+ C F +  S D R     W  G+NI + SS   T    I+ W++EV    F  D  S  T    HYT L+W  + + GC +  C +  G+     VC+Y P GN N     PY +G +C+ CP    C N LC
Sbjct:   68 MMWKKEAYLNALSWANNCTFGH--SPDARRKTTQWTCGENI-FMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASCPKN--CVNNLC 211          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 58.5362 bits (140), Expect = 4.532e-11
Identity = 37/98 (37.76%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  328 DGIKMWFDEVKDYTFN---GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEA--PYKVGQACSRCPNGTRCSNGLCS 606
            + IK+W DE     F+   G +  G    HYT +IW  T + GC I  C  +    +Y+ C Y P GNWNN    PY  G +C  CPN   C + LC+
Sbjct:   62 EAIKVWVDEANSPGFDYGKGPRNPGIV-GHYTQIIWYSTYQVGCTINYCPEEAYKYMYL-CAYCPVGNWNNRLTKPYDEGPSCQDCPND--CDDKLCT 155          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 51.2174 bits (121), Expect = 8.067e-9
Identity = 32/97 (32.99%), Postives = 44/97 (45.36%), Query Frame = 1
Query:  328 DGIKMWFDE--VKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEA--PYKVGQACSRCPNGTRCSNGLCS 606
            D +  W++E  V  + F     +     HYT ++W  + + GC +  C       +Y VC+Y P GN N     PY  G  C  CPN   C N LCS
Sbjct:   16 DAVLDWYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCPEAIYKYVY-VCHYCPAGNLNTRLSRPYNEGSPCRSCPND--CENDLCS 109          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 56.6102 bits (135), Expect = 4.228e-10
Identity = 42/123 (34.15%), Postives = 58/123 (47.15%), Query Frame = 1
Query:  172 TTNIVWNDEAAQRAQMSADRCVFQYDQS--RDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNE 534
            T  + W+D  A  AQ  AD    QYD S       G Y   G+N+A   ++  T  +  W+ E+  Y ++    S  T  H+T ++W  T E GCG   C      N YIVC+Y P GN+  E
Sbjct:   43 TAPLTWSDTLATYAQNYAD----QYDCSGVLTHSDGPY---GENLALGYTD--TGAVDAWYGEISKYNYSNPGFSESTG-HFTQVVWKSTAEIGCGYKYCGTT--WNNYIVCSYNPPGNYLGE 153          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 55.4546 bits (132), Expect = 6.125e-10
Identity = 39/121 (32.23%), Postives = 58/121 (47.93%), Query Frame = 1
Query:  172 TTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNE 534
            T  + W+D  A  AQ  AD     YD S      G  + G+N+A     D    +  W++E+ +Y F+    S  T  H+T ++W  T + GCGI  C   G    Y++C+Y P GN+  E
Sbjct:  180 TPALSWSDTLASYAQDYADN----YDCSGTLTHSGGPY-GENLAL--GYDGPAAVDAWYNEISNYDFSNPGFSSNTG-HFTQVVWKSTTQVGCGIKTCG--GAWGDYVICSYDPAGNYEGE 290          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 46.2098 bits (108), Expect = 9.566e-7
Identity = 38/123 (30.89%), Postives = 58/123 (47.15%), Query Frame = 1
Query:  172 TTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFT--CLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNE 534
            T ++ W+D  A  AQ  AD     YD S +    G  + G+N+A       T  +  W++E+  Y ++     GF+    H+T ++W  T E GCG+  C   G    YI+C+Y   GN   E
Sbjct:  210 TGSLTWSDTLATYAQNYADS----YDCSGNLVHSGGPY-GENLAL--GYGTTGSVDAWYNEITSYDYSNP---GFSESAGHFTQVVWKGTSEVGCGLKSCG--GEWGDYIICSYKAAGNVIGE 320          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO41919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S310])

HSP 1 Score: 62.003 bits (149), Expect = 1.736e-12
Identity = 36/98 (36.73%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  289 GQNIAYWS---SNDVT--DGIKMWFDEVKDYTFNGD-----KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVG 552
            G+N+ Y S   ++ VT  + +K W+DEV DY FN       + SG    H+T ++W  T+  G  IA   R    + YIV  Y P GN+N E   +VG
Sbjct:   52 GENLYYISKVSASPVTCVEAVKAWYDEVVDYPFNNPPESVFQVSGAPIGHFTQIVWKDTRRLGVAIARIKRGLWYSTYIVARYSPPGNYNGEFTQQVG 149          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO35380 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLN4])

HSP 1 Score: 55.4546 bits (132), Expect = 5.968e-10
Identity = 39/125 (31.20%), Postives = 56/125 (44.80%), Query Frame = 1
Query:  178 NIVWNDEAAQRAQMSADR----CVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNG-----DKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNW 525
             + W+ E A RAQ+ A++     V  ++          S  G+NIAY SS    + ++ W DE  DY   G             LH+T ++W  T+  G GI+       GN +IV  Y P GNW
Sbjct:   48 QVTWDPELASRAQIWANKLSSGAVLPWEIHES------SSDGENIAYLSSPTCKEAVEYWMDEKYDYHAKGYCLSPPDLPDSYLLHFTQVVWKATRRIGVGIS-------GN-WIVVRYSPAGNW 158          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO35287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLZ5])

HSP 1 Score: 57.3806 bits (137), Expect = 7.130e-10
Identity = 35/120 (29.17%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  172 TTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN-DVT--DGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGN 522
            T ++ W+D+ A++AQ  A       + + D  +      G+NIA +  + D+      + W++EV+ Y F G    G    H++ L+W  TK  G G+A  +R      Y+V  Y P GN
Sbjct:  718 TPSLKWSDKLAKKAQKLAQSMAADSNHTDDEAYSQNELPGENIAVFKHDYDIAAERATRKWYEEVEGYRF-GSPVLGEATKHFSQLVWKGTKSVGIGVARGARD---RTYVVALYDPPGN 833          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 53.5286 bits (127), Expect = 1.868e-9
Identity = 42/134 (31.34%), Postives = 58/134 (43.28%), Query Frame = 1
Query:  172 TTNIVWNDEAAQRAQM----SADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVT--DGIKMWFDEVKDYTFNGDKCSGFTCL--HYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKV 549
            T  + WN   A  AQ      A R   Q+  SR+         G++IAY S   +T      MW+ EV  Y F   +  GF+    H+T ++WA + E G G A  S    G  ++V  Y P GN   + P  V
Sbjct:   19 TKALKWNARLASEAQSWAENLAQRNAIQHSSSRE--------YGESIAYMSGAVLTGRKATDMWYGEVDKYRF---ENPGFSTSSGHFTQVVWAGSTEMGAGKATSSS---GAHFVVARYTPPGNVMGQFPENV 138          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO31682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX85])

HSP 1 Score: 51.6026 bits (122), Expect = 8.202e-9
Identity = 35/118 (29.66%), Postives = 51/118 (43.22%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDG----IKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGN 522
            + W+ E A  AQ  A+         RD    G    G+NI Y    +  +     ++ W+ EVK+Y F        T  H++ L+W  TK+ G G A       GN ++V  Y P GN
Sbjct:   23 LAWSGELASEAQKWANHLASIDQMERDPLTNG----GENIFYMYGGNPREACERAVRNWYQEVKNYDFKNPHSDPSTS-HFSQLVWKGTKKLGVGEAQSKS---GNFFLVARYHPKGN 132          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 103.219 bits (256), Expect = 1.254e-26
Identity = 64/185 (34.59%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  106 II*YNVRCRYLSYPVLSDS*PTTTNIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSN--DVTDGIKMWFDEVKDYTFNGDK---------CSGFTCLHYTALIWAKTKEFGCGIADCSRKGL-GNI-----YIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            I+ Y+ + R   +P  S+       +VW++  A+ A+  A  C++++  S   RF     +GQN++  +     +   +K W+DEVKDY+F   +         C G  C HYT ++WA + + GC I  C    + G++     Y+VCNY P GNW  EAPYKVG  CS CP   G  CSN +C
Sbjct:   69 ILDYHNKVRGKVFPPASN----MEYMVWDETLAKTAEDWAHACLWEHGPSHLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSNNMC 244          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 101.293 bits (251), Expect = 9.811e-25
Identity = 58/161 (36.02%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  178 NIVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIA-YWSS-NDVTDGIKMWFDEVKDYTFN---------GDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            ++VW+DE  + A   A+ C +++   +D        +GQN+A +W         ++ W+DEVKDYT+           ++CSG  C HYT L+WA T   GC +  C +  +        +Y+VCNY P GNW  EAPY+ G+ CS+CP   G  C N LC
Sbjct:   99 HMVWDDELERSATQWAEECRWEHG-PQDLLMS----IGQNLAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLC 254          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 92.4337 bits (228), Expect = 1.493e-21
Identity = 55/160 (34.38%), Postives = 80/160 (50.00%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSS-NDVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            ++W+ E  + A+  A+ C++++  +          +GQN+ A+W      T  ++ W+DEVKDY+F            +CSG  C HYT L+WA +   GC I  C    +        +Y+VCNY P GNW   APYK G  CS CP   G  C + LC
Sbjct:  113 MMWDTELERSAEEWAETCLWEHGPA-----SLLPQIGQNLGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 267          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 92.0485 bits (227), Expect = 1.785e-21
Identity = 55/160 (34.38%), Postives = 80/160 (50.00%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNI-AYWSS-NDVTDGIKMWFDEVKDYTFNGD---------KCSGFTCLHYTALIWAKTKEFGCGIADCSRKGL------GNIYIVCNYGPGGNWNNEAPYKVGQACSRCPN--GTRCSNGLC 603
            ++W+ E  + A+  A+ C++++  +          +GQN+ A+W      T  ++ W+DEVKDY+F            +CSG  C HYT L+WA +   GC I  C    +        +Y+VCNY P GNW   APYK G  CS CP   G  C + LC
Sbjct:   85 MMWDTELERSAEEWAETCLWEHGPA-----SLLPQIGQNLGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 239          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 81.2629 bits (199), Expect = 1.124e-18
Identity = 48/142 (33.80%), Postives = 72/142 (50.70%), Query Frame = 1
Query:  187 WNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDV-TDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIV-CNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
            +++E A  AQ   D+CV  +     R   GY  +G+N+ Y +S  +    I  W+ EV  + F     +G    HYT ++W  + + GCG+  CS     NIY+  C+Y   GN+    PYKVG  C+ CPN   C + LC+
Sbjct:   42 YSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCS----NNIYLYGCHYYRAGNFKRWPPYKVGTPCASCPND--CVDKLCT 176          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000047165.1 (SMESG000047165.1)

HSP 1 Score: 297.36 bits (760), Expect = 1.630e-103
Identity = 141/150 (94.00%), Postives = 144/150 (96.00%), Query Frame = 1
Query:  166 PTTTNIV---WNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
            P   N++   WNDEAAQRAQMSADRCVFQ+DQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS
Sbjct:   56 PAAANMLELKWNDEAAQRAQMSADRCVFQHDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 205          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000047165.1 (SMESG000047165.1)

HSP 1 Score: 295.049 bits (754), Expect = 2.371e-103
Identity = 141/150 (94.00%), Postives = 144/150 (96.00%), Query Frame = 1
Query:  166 PTTTNIV---WNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
            P   N++   WNDEAAQRAQMSADRCVFQ+DQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS
Sbjct:   10 PAAANMLELKWNDEAAQRAQMSADRCVFQHDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 159          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000047165.1 (SMESG000047165.1)

HSP 1 Score: 291.582 bits (745), Expect = 4.019e-102
Identity = 139/142 (97.89%), Postives = 141/142 (99.30%), Query Frame = 1
Query:  181 IVWNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
            + WNDEAAQRAQMSADRCVFQ+DQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS
Sbjct:    4 LKWNDEAAQRAQMSADRCVFQHDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 145          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000062609.1 (SMESG000062609.1)

HSP 1 Score: 241.891 bits (616), Expect = 1.052e-81
Identity = 108/150 (72.00%), Postives = 130/150 (86.67%), Query Frame = 1
Query:  166 PTTTNIV---WNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
            P   N++   WN+EAAQRAQ SA++CVF +DQ RDR+FG Y WVGQNIA+WSS+DVT+G+KMW+DEV  Y FN D+CSGFTCLHYTAL+WAKTKEFGCGIADCSR+ LG I++ CNYGPGGNWN E PY+VG+ACS+CP+GTRC+NGLCS
Sbjct:   50 PAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSDDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNGLCS 199          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000062601.1 (SMESG000062601.1)

HSP 1 Score: 214.542 bits (545), Expect = 5.157e-71
Identity = 93/150 (62.00%), Postives = 119/150 (79.33%), Query Frame = 1
Query:  166 PTTTNIV---WNDEAAQRAQMSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNGLCS 606
            P   N++   W+ EA  +AQ   ++CVF++D S +R+FG Y WVGQNIAYW S+DVT+GIKMW+DEVK Y F  +KCS  TCLHYT ++WAKTKEFGCG+ADCS+K LG I++ CNY PGGNWNNE  Y+VG+ACS+CP GT+C++GLCS
Sbjct:   49 PEAANMLELKWSSEAEAKAQKFVNKCVFKHDSSGERKFGSYQWVGQNIAYWHSDDVTEGIKMWYDEVKGYNFQSEKCSVSTCLHYTQVVWAKTKEFGCGVADCSKKKLGKIFLACNYAPGGNWNNEKAYEVGKACSKCPTGTKCNDGLCS 198          
The following BLAST results are available for this feature:
BLAST of Venom allergen 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI159.711e-2635.63peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
PI159.711e-2635.63peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
PI159.711e-2635.63peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
CRISPLD28.253e-2435.00cysteine rich secretory protein LCCL domain contai... [more]
CRISPLD21.114e-2335.00cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-51.370e-1630.59SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-104.873e-1631.74SCP-Like extracellular protein [Source:UniProtKB/... [more]
lon-12.606e-1533.33pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
scl-145.026e-1532.90SCP-Like extracellular protein [Source:UniProtKB/... [more]
lon-11.921e-1432.43pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84832.561e-2044.93gene:FBgn0038126 transcript:FBtr0082782[more]
CG42701.077e-736.25gene:FBgn0031407 transcript:FBtr0077754[more]
Ag5r1.649e-727.81gene:FBgn0015010 transcript:FBtr0333658[more]
Ag5r1.649e-727.81gene:FBgn0015010 transcript:FBtr0073937[more]
Ag5r1.649e-727.81gene:FBgn0015010 transcript:FBtr0305582[more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pi15a8.142e-2737.50peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
crispld29.789e-2535.71cysteine-rich secretory protein LCCL domain contai... [more]
pi15b1.480e-2434.38peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
pi15b1.613e-2434.38peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
r3hdml1.126e-2230.68R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld22.508e-2535.12cysteine-rich secretory protein LCCL domain contai... [more]
crispld22.672e-2535.12cysteine-rich secretory protein LCCL domain contai... [more]
crispld22.832e-2535.12cysteine-rich secretory protein LCCL domain contai... [more]
pi153.839e-2434.38peptidase inhibitor 15 [Source:NCBI gene;Acc:10048... [more]
R3HDML2.932e-2333.13R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi159.781e-2635.63peptidase inhibitor 15 [Source:MGI Symbol;Acc:MGI:... [more]
Crispld25.469e-2533.51cysteine-rich secretory protein LCCL domain contai... [more]
Crispld25.469e-2533.51cysteine-rich secretory protein LCCL domain contai... [more]
Crispld25.660e-2533.51cysteine-rich secretory protein LCCL domain contai... [more]
R3hdml1.420e-2434.38R3H domain containing-like [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Venom allergen 5 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T141|PI15A_DANRE6.147e-2637.50Peptidase inhibitor 15-A OS=Danio rerio OX=7955 GN... [more]
sp|P35782|VA52_VESCR1.264e-2545.04Venom allergen 5.02 OS=Vespa crabro OX=7445 PE=1 S... [more]
sp|P0DPU1|VA576_SCODE1.288e-2538.31Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|O43692|PI15_HUMAN4.663e-2535.63Peptidase inhibitor 15 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q98ST6|PI15_CHICK4.968e-2535.63Peptidase inhibitor 15 OS=Gallus gallus OX=9031 GN... [more]
back to top
BLAST of Venom allergen 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203300301.292e-3648.61tr|A0A172RVP6|A0A172RVP6_SCHMD TPX-1 protein (Frag... [more]
gnl|BL_ORD_ID|193504797.284e-3650.82tr|A0A564YFQ7|A0A564YFQ7_HYMDI SCP domain-containi... [more]
gnl|BL_ORD_ID|228484946.725e-3246.56tr|A0A3Q0KUA5|A0A3Q0KUA5_SCHMA Venom allergen-like... [more]
gnl|BL_ORD_ID|228341727.096e-3247.97tr|G4VM60|G4VM60_SCHMA Venom allergen-like (VAL) 1... [more]
gnl|BL_ORD_ID|196153779.830e-3240.27tr|A0A1C9ZZV5|A0A1C9ZZV5_DUGJA SCP domain-containi... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pi15a1.924e-2737.50peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
pi15a2.196e-2735.14peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
crispld28.439e-2637.50cysteine-rich secretory protein LCCL domain contai... [more]
pi15b5.552e-2336.25peptidase inhibitor 15 [Source:NCBI gene;Acc:10302... [more]
crispld1a8.909e-2334.91cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.12.026e-2232.42pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
ENSPMAT00000002250.14.667e-2131.14pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP35.090e-1334.23cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CRISP24.532e-1137.76cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP28.067e-932.99cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY34.228e-1034.15Cell wall-associated protein involved in export of... [more]
PRY16.125e-1032.23Sterol binding protein involved in the export of a... [more]
PRY29.566e-730.89Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO419191.736e-1236.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353805.968e-1031.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352877.130e-1029.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488811.868e-931.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316828.202e-929.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pi15a1.254e-2634.59peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
crispld29.811e-2536.02cysteine rich secretory protein LCCL domain contai... [more]
crispld1a1.493e-2134.38cysteine rich secretory protein LCCL domain contai... [more]
crispld1a1.785e-2134.38cysteine rich secretory protein LCCL domain contai... [more]
ENSORLT00000020676.21.124e-1833.80cysteine-rich venom protein pseudecin-like [Source... [more]
back to top
BLAST of Venom allergen 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047165.11.630e-10394.00SMESG000047165.1[more]
SMESG000047165.12.371e-10394.00SMESG000047165.1[more]
SMESG000047165.14.019e-10297.89SMESG000047165.1[more]
SMESG000062609.11.052e-8172.00SMESG000062609.1[more]
SMESG000062601.15.157e-7162.00SMESG000062601.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015313 ID=SMED30015313|Name=Venom allergen 5|organism=Schmidtea mediterranea sexual|type=transcript|length=614bp
GATTTACTTTACATAAGCGATTGTATCAATAAATTATCGTTTGAGATGAA
TTCGAAATCAGTAAATTAATCATCGTATTCATAGAAAGAAAATGAGAAAT
TCTCTATTATTTAGTATAATGTTAGGTGTCGTTATCTCAGTTATCCAGTG
TTATCTGACTCCTGACCAACAACAACAAATATTGTATGGAACGATGAAGC
TGCACAACGAGCTCAAATGTCGGCTGATCGTTGCGTTTTCCAATATGATC
AATCAAGAGATCGTCGATTTGGAGGTTATAGCTGGGTTGGTCAAAATATT
GCATACTGGTCAAGCAATGACGTGACAGACGGTATCAAGATGTGGTTCGA
CGAAGTCAAAGATTACACATTCAATGGAGATAAATGTAGTGGATTTACAT
GCTTGCATTACACAGCTTTAATCTGGGCAAAAACCAAGGAATTTGGATGT
GGAATAGCAGATTGTTCTCGAAAGGGTTTAGGAAATATTTACATCGTCTG
TAATTATGGACCCGGTGGAAATTGGAACAACGAAGCACCATATAAAGTTG
GACAAGCATGTTCCAGATGTCCAAATGGAACCAGATGCAGCAATGGACTA
TGCAGTTAGAAATA
back to top

protein sequence of SMED30015313-orf-1

>SMED30015313-orf-1 ID=SMED30015313-orf-1|Name=SMED30015313-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MSADRCVFQYDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDY
TFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPG
GNWNNEAPYKVGQACSRCPNGTRCSNGLCS*
back to top
Aliases
The feature 'Venom allergen 5' has the following synonyms
Synonym
VAL-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0000023embryonic pharynx
PLANA:0000058embryonic digestive system
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000003Stage 3
PLANA:0000005Stage 5
Vocabulary: INTERPRO
TermDefinition
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCDDcd05380CAP_eukcoord: 1..37
e-value: 1.25783E-4
score: 33.9671