DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30015310
Length (bp)769
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30015310) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30015310) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30015310) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30015310) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015310

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30015310SMESG000046710.1 SMESG000046697.1 PL020001000E05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30015310SMESG000046710.1 SMESG000046697.1 PL020001000E05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30015310SMESG000046710.1 SMESG000046697.1 PL020001000E05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015310SMESG000046710.1 SMESG000046697.1 Contig536GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v4_54_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v4_54_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v4_54_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v4_54_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v4_54_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v4_54_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v4_54_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015310SMESG000046710.1 SMESG000046697.1 Contig50840uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015310SMESG000046710.1 SMESG000046697.1 Contig50840newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v6_54_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015310SMESG000046710.1 SMESG000046697.1 OX_Smed_1.0.22892ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v6_54_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v6_54_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v6_54_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v6_54_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30015310SMESG000046710.1 SMESG000046697.1 dd_Smed_v6_54_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 95.5153 bits (236), Expect = 5.306e-23
Identity = 55/141 (39.01%), Postives = 73/141 (51.77%), Query Frame = 2
Query:   56 WQPGQYGQVPYNAIQ----ADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEV 466
            W P   G+VP NA++    +   LYI R R  GDL  GK    H   Y  + G E   + YEVLC        G   W  +  G++P NA+  G TA  EPL+I +A  +G + VGKV  SHGC ++PYGG E     +E+
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLC-------AGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEI 292          

HSP 2 Score: 61.6178 bits (148), Expect = 6.760e-11
Identity = 32/66 (48.48%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  275 WQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
            W   ANG VP NA+ GG  +S + LYIA+AR  G++  GK+  SHG  ++ +GG EH    YEVLC
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQ-LYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLC 223          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 80.8777 bits (198), Expect = 1.202e-17
Identity = 51/146 (34.93%), Postives = 67/146 (45.89%), Query Frame = 2
Query:   50 LSWQPGQYGQVPYNAIQADAG-----LYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
             SW P   G VP +AIQ         LY+ R    G LT GK    H   Y PY G+E  +  YEVL             W   +   +    VVGGH A  + +Y+ +A   G++   KV  + GCA++PYGG E   H YE+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQP--------ETWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 2 Score: 80.4925 bits (197), Expect = 1.707e-17
Identity = 48/139 (34.53%), Postives = 67/139 (48.20%), Query Frame = 2
Query:   71 YGQVPYNAIQA-----DAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
            YG +P  AI A        +++ R    G++   K   G    Y P+ G+E S  ++EVL        G    W   + GSVP +A+  G T   EPLY+ +    G +  GKV  SH C ++PYGG EH+   YEVL 
Sbjct:   12 YGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 3 Score: 78.9518 bits (193), Expect = 5.179e-17
Identity = 45/120 (37.50%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  113 LYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
            +Y+ R    GDL   K        Y PY G E    +YE+L   G       + W H ++G+VP NAV+ G T+  EPL+I +A  +G +  GK+ QSH C ++P+ G E +  HYEVL 
Sbjct:  172 IYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGYG-------YGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 80.8777 bits (198), Expect = 1.202e-17
Identity = 51/146 (34.93%), Postives = 67/146 (45.89%), Query Frame = 2
Query:   50 LSWQPGQYGQVPYNAIQADAG-----LYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
             SW P   G VP +AIQ         LY+ R    G LT GK    H   Y PY G+E  +  YEVL             W   +   +    VVGGH A  + +Y+ +A   G++   KV  + GCA++PYGG E   H YE+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQP--------ETWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 2 Score: 80.4925 bits (197), Expect = 1.707e-17
Identity = 48/139 (34.53%), Postives = 67/139 (48.20%), Query Frame = 2
Query:   71 YGQVPYNAIQA-----DAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
            YG +P  AI A        +++ R    G++   K   G    Y P+ G+E S  ++EVL        G    W   + GSVP +A+  G T   EPLY+ +    G +  GKV  SH C ++PYGG EH+   YEVL 
Sbjct:   12 YGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 3 Score: 78.9518 bits (193), Expect = 5.179e-17
Identity = 45/120 (37.50%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  113 LYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
            +Y+ R    GDL   K        Y PY G E    +YE+L   G       + W H ++G+VP NAV+ G T+  EPL+I +A  +G +  GK+ QSH C ++P+ G E +  HYEVL 
Sbjct:  172 IYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGYG-------YGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339104)

HSP 1 Score: 80.4925 bits (197), Expect = 1.576e-17
Identity = 50/145 (34.48%), Postives = 68/145 (46.90%), Query Frame = 2
Query:   50 LSWQPGQYGQVPYNAIQADAG-----LYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVL 469
             +W P   G VP NA+++        LY+ R    G LT+GK    H   Y P+ G+E  I+ YEVL      V      W   +    P  AV+ GH +   P+Y  +A   GEM   KV  S G A++ +GG E +   YEVL
Sbjct:   75 FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQHDV------WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 213          

HSP 2 Score: 72.7886 bits (177), Expect = 8.797e-15
Identity = 43/119 (36.13%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  113 LYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVL 469
            +Y+ R+   G+    K        Y  Y G E + ++YEVL   G         W   ++G VP NAV  G T + EPLY+ +    G + VGKV  SHGC ++P+GG E + + YEVL
Sbjct:   30 IYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQGFA-------WVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 141          

HSP 3 Score: 58.9214 bits (141), Expect = 6.269e-10
Identity = 30/69 (43.48%), Postives = 42/69 (60.87%), Query Frame = 2
Query:  266 EHHWQHMANGS-VPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVL 469
            ++ W H +  S +P  AV+GGH +   P+Y+ ++   GE    KV  S GCA++ YGGAEH   HYEVL
Sbjct:    2 DNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVL 70          

HSP 4 Score: 56.9954 bits (136), Expect = 2.467e-9
Identity = 41/150 (27.33%), Postives = 62/150 (41.33%), Query Frame = 2
Query:   38 RQASLSWQPGQYGQVPYNAIQA-----DAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
            +Q    W P      P  A+ A        +Y  R    G++   K      + Y  + G E    +YEVL   G       + W +  + S+P NAV  G   + E LY  +    G +  G +  S  C ++PYGG E + + YE+LC
Sbjct:  143 KQQHDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTGYG-------YVWMNCGH-SIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339105)

HSP 1 Score: 80.4925 bits (197), Expect = 1.837e-17
Identity = 50/145 (34.48%), Postives = 68/145 (46.90%), Query Frame = 2
Query:   50 LSWQPGQYGQVPYNAIQADAG-----LYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVL 469
             +W P   G VP NA+++        LY+ R    G LT+GK    H   Y P+ G+E  I+ YEVL      V      W   +    P  AV+ GH +   P+Y  +A   GEM   KV  S G A++ +GG E +   YEVL
Sbjct:   86 FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQHDV------WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 224          

HSP 2 Score: 72.7886 bits (177), Expect = 9.514e-15
Identity = 43/119 (36.13%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  113 LYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVL 469
            +Y+ R+   G+    K        Y  Y G E + ++YEVL   G         W   ++G VP NAV  G T + EPLY+ +    G + VGKV  SHGC ++P+GG E + + YEVL
Sbjct:   41 IYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQGFA-------WVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 152          

HSP 3 Score: 58.9214 bits (141), Expect = 6.363e-10
Identity = 30/69 (43.48%), Postives = 42/69 (60.87%), Query Frame = 2
Query:  266 EHHWQHMANGS-VPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVL 469
            ++ W H +  S +P  AV+GGH +   P+Y+ ++   GE    KV  S GCA++ YGGAEH   HYEVL
Sbjct:   13 DNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVL 81          

HSP 4 Score: 56.9954 bits (136), Expect = 2.896e-9
Identity = 41/150 (27.33%), Postives = 62/150 (41.33%), Query Frame = 2
Query:   38 RQASLSWQPGQYGQVPYNAIQA-----DAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLC 472
            +Q    W P      P  A+ A        +Y  R    G++   K      + Y  + G E    +YEVL   G       + W +  + S+P NAV  G   + E LY  +    G +  G +  S  C ++PYGG E + + YE+LC
Sbjct:  154 KQQHDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTGYG-------YVWMNCGH-SIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 295          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A4Z2D656 (DM9 domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_004219 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 5.370e-41
Identity = 74/149 (49.66%), Postives = 99/149 (66.44%), Query Frame = 2
Query:   38 RQASLSWQPGQYGQVPY-NAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 481
            RQA LSW PG  GQ+P  +AI+A  G+Y++R RT  D+  GK  + +  GY  Y GRE  +SN+EVLC+T L   G  + W   + G+VP  A+  G T+S+EPLY+A+  +NGE C+GKV  SHGCA+ P+GG EH    YEVLCF+D
Sbjct:  155 RQAHLSWLPGCAGQIPPPHAIEATPGIYVIRGRTCDDVIPGKWVINYGLGYISYDGREIELSNFEVLCNTSLQSTGNLYTWIPCSGGNVPDKALHAGETSSSEPLYVARGIVNGETCIGKVHPSHGCAYFPWGGDEHAVKCYEVLCFTD 303          

HSP 2 Score: 106.686 bits (265), Expect = 1.331e-23
Identity = 57/149 (38.26%), Postives = 85/149 (57.05%), Query Frame = 2
Query:   17 MSRAGSGRQASLSWQPGQYGQVP-YNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHY 460
            M+ A + R+A+LSW P   G  P  N +QA++G+ ++R + G +L  GK  + +  GY PY G+E  I+ YEVLC T +      ++W   + G VP  A++ G T   E LY+A+A I GEM +GK+  S   A + YGG E K   +
Sbjct:    1 MNVAHNAREANLSWIPYSTGSPPPSNIVQAESGICVIRGKKGTNLIPGKMLLKNGVGYIPYEGKEVQINEYEVLCQTNIFPHQTLYNWVPGSRGKVPVGALLAGITMHEELLYVARATIEGEMSIGKINCSQKFALLTYGGKELKMKMW 149          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A2H1CPU9 (DUF3421 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_03029 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.849e-40
Identity = 71/150 (47.33%), Postives = 94/150 (62.67%), Query Frame = 2
Query:   35 GRQASLSWQPG-QYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 481
             R+ SLSW P   + Q P NA+ A  GL+++R R   D+  GK      SG+ P+ GRE  +S++EVLC+T L+     + W     G VPHNAV GG T S EPLYIA+  +N E CVGKV  SHGCA+ P+GG EH +  YEVLC+++
Sbjct:    8 AREVSLSWLPVYPHTQPPPNAVAAQPGLFVIRGRENVDVLPGKWPAQVGSGFIPFDGREKPVSSFEVLCNTSLYQDSTPYTWIPSGRGDVPHNAVQGGITESMEPLYIARGLVNNEWCVGKVHPSHGCAYFPWGGGEHSSQQYEVLCYTN 157          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A4E0RKT4 (DM9 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_002121 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.448e-40
Identity = 71/150 (47.33%), Postives = 94/150 (62.67%), Query Frame = 2
Query:   35 GRQASLSWQPG-QYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 481
             R+ SLSW P   + Q P NA+ A  GL+++R R   D+  GK      SG+ P+ GRE  +S++EVLC+T L+     + W     G VPHNAV GG T S EPLYIA+  +N E CVGKV  SHGCA+ P+GG EH +  YEVLC+++
Sbjct:   59 AREVSLSWLPVYPHTQPPPNAVAAQPGLFVIRGRENVDVLPGKWPAQVGSGFIPFDGREKPVSSFEVLCNTSLYQDSTPYTWIPSGRGDVPHNAVQGGITESMEPLYIARGLVNNEWCVGKVHPSHGCAYFPWGGGEHSSQQYEVLCYTN 208          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A430QH41 (DUF3421 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0009192 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.681e-40
Identity = 71/151 (47.02%), Postives = 94/151 (62.25%), Query Frame = 2
Query:   32 SGRQASLSWQPGQYGQVPY-NAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 481
            SGRQA LSW P    Q P  +A++AD  +Y++R R   D+  GK  +    GY PY G+E  + ++EVLC+T L      + W     G+VP+NA+  G T S+EPLYIA+  +N EMCVGKV  SHGCA+ P+GG EH    YEVLC+ D
Sbjct:    5 SGRQAHLSWLPAYAKQTPPPHAVEADVNIYVIRGRVNDDVIPGKWPIYLGKGYVPYGGKEVELDSFEVLCNTSLKPTERFYEWVSYTGGNVPNNALHAGETQSSEPLYIARRLVNNEMCVGKVHPSHGCAYFPWGGEEHSEKSYEVLCYID 155          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A430PYP5 (DUF3421 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0005187 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.684e-40
Identity = 72/153 (47.06%), Postives = 93/153 (60.78%), Query Frame = 2
Query:   17 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCF 475
            M++ G G Q  LSW P + G VP NA+    G+Y+VR +  G    GK   GHN+ Y+PY G E +   YEVLCDT      G + W H + GSVP NA++ G + S +PLYIAK+ INGE  VGKV   H CA++P+GG EH    YEVL +
Sbjct:    1 MAKIGKGIQIPLSWVPAKDGNVPNNALSVTRGIYVVRCKHDGQWIPGKAATGHNAAYYPYGGEEKNTREYEVLCDTSFSGHQG-YEWLHASRGSVPKNAIIAGMSGS-DPLYIAKSSINGEPSVGKVHSGHECAYLPWGGEEHSVKEYEVLVW 151          
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055806.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:7684441:7697076:-1 gene:ENSAMXG00000043142.1 transcript:ENSAMXT00000055806.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 2.518e-6
Identity = 32/95 (33.68%), Postives = 46/95 (48.42%), Query Frame = 2
Query:  185 YFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVL 469
            Y+PYA  E   S +EVL +     F     W+  + GSVP N+V    T S   +Y+ K +      +GKV   H   F+P+ G E+    Y+VL
Sbjct:   98 YYPYADSEYPASKFEVLVNEDYFEF---LEWRSGSYGSVPPNSV---RTCSRGDIYVGKNKYG----LGKVVPRHEAFFLPWEGKEYWYKKYDVL 182          
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000045654.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:7684441:7697076:-1 gene:ENSAMXG00000043142.1 transcript:ENSAMXT00000045654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 2.801e-6
Identity = 32/98 (32.65%), Postives = 47/98 (47.96%), Query Frame = 2
Query:  185 YFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFS 478
            Y+PYA  E   S +EVL +     F     W+  + GSVP N+V    T S   +Y+ K +      +GKV   H   F+P+ G E+    Y+VL  +
Sbjct:  126 YYPYADSEYPASKFEVLVNEDYFEF---LEWRSGSYGSVPPNSV---RTCSRGDIYVGKNKYG----LGKVVPRHEAFFLPWEGKEYWYKKYDVLTIN 213          
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043153.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:7684441:7688885:-1 gene:ENSAMXG00000043142.1 transcript:ENSAMXT00000043153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 3.403e-6
Identity = 32/95 (33.68%), Postives = 46/95 (48.42%), Query Frame = 2
Query:  185 YFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVL 469
            Y+PYA  E   S +EVL +     F     W+  + GSVP N+V    T S   +Y+ K +      +GKV   H   F+P+ G E+    Y+VL
Sbjct:  135 YYPYADSEYPASKFEVLVNEDYFEF---LEWRSGSYGSVPPNSV---RTCSRGDIYVGKNKYG----LGKVVPRHEAFFLPWEGKEYWYKKYDVL 219          
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000247.2 (pep primary_assembly:ASM223467v1:2:4655465:4657929:1 gene:ENSORLG00000000205.2 transcript:ENSORLT00000000247.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 6.395e-6
Identity = 35/119 (29.41%), Postives = 53/119 (44.54%), Query Frame = 2
Query:  185 YFPYAGREDSISNYEVLCDTGLHVFGGEHH-----WQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD*MNIDLLLLIK*QIN 526
            Y+  +GRE        L D    +   E +     W   +NG VP NAV      S + +Y+ K     +  +GKV   H C F+P  G E     YEVL ++  +  D+L  ++ QI+
Sbjct:   75 YYTLSGRE--------LKDPSFLILVNEDNFEDLVWISDSNGGVPKNAV-----RSADAVYVGK----NQYGLGKVVPQHHCLFLPLKGRESWYRQYEVLTYNTDVKSDVLSCVEYQID 176          
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000030643.1 (pep primary_assembly:ASM223467v1:2:4655465:4661348:1 gene:ENSORLG00000000205.2 transcript:ENSORLT00000030643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 6.573e-6
Identity = 35/119 (29.41%), Postives = 53/119 (44.54%), Query Frame = 2
Query:  185 YFPYAGREDSISNYEVLCDTGLHVFGGEHH-----WQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD*MNIDLLLLIK*QIN 526
            Y+  +GRE        L D    +   E +     W   +NG VP NAV      S + +Y+ K     +  +GKV   H C F+P  G E     YEVL ++  +  D+L  ++ QI+
Sbjct:   75 YYTLSGRE--------LKDPSFLILVNEDNFEDLVWISDSNGGVPKNAV-----RSADAVYVGK----NQYGLGKVVPQHHCLFLPLKGRESWYRQYEVLTYNTDVKSDVLSCVEYQID 176          
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000248.2 (pep primary_assembly:ASM223467v1:2:4654950:4659855:1 gene:ENSORLG00000000205.2 transcript:ENSORLT00000000248.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 9.409e-6
Identity = 35/119 (29.41%), Postives = 53/119 (44.54%), Query Frame = 2
Query:  185 YFPYAGREDSISNYEVLCDTGLHVFGGEHH-----WQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD*MNIDLLLLIK*QIN 526
            Y+  +GRE        L D    +   E +     W   +NG VP NAV      S + +Y+ K     +  +GKV   H C F+P  G E     YEVL ++  +  D+L  ++ QI+
Sbjct:   89 YYTLSGRE--------LKDPSFLILVNEDNFEDLVWISDSNGGVPKNAV-----RSADAVYVGK----NQYGLGKVVPQHHCLFLPLKGRESWYRQYEVLTYNTDVKSDVLSCVEYQID 190          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046710.1 (SMESG000046710.1)

HSP 1 Score: 324.709 bits (831), Expect = 3.165e-114
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 2
Query:   17 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 481
            MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046697.1 (SMESG000046697.1)

HSP 1 Score: 324.709 bits (831), Expect = 3.165e-114
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 2
Query:   17 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 481
            MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000057816.1 (SMESG000057816.1)

HSP 1 Score: 255.373 bits (651), Expect = 6.708e-87
Identity = 117/155 (75.48%), Postives = 133/155 (85.81%), Query Frame = 2
Query:   17 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 481
            MSRAG+GRQ SLSW PG+YGQVP NA+QAD GLYIVR RT GD+T+GKTKVGH SG+FPYAGRED +  YEVLCDTGLHV+G E HWQ+M NG+VPHNAVVGGHT++ EPLYIA+ARI+GEMCVGKV  SH C FMPYGG EHK + YEVLC+ D
Sbjct:    1 MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVRARTDGDVTVGKTKVGHQSGFFPYAGREDMVPRYEVLCDTGLHVWGSEFHWQYMGNGAVPHNAVVGGHTSTYEPLYIARARIHGEMCVGKVANSHKCGFMPYGGKEHKVYKYEVLCYRD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046742.1 (SMESG000046742.1)

HSP 1 Score: 248.054 bits (632), Expect = 5.406e-84
Identity = 115/155 (74.19%), Postives = 134/155 (86.45%), Query Frame = 2
Query:   17 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 481
            M   GSGRQASLSWQPG  GQVPYNAIQAD GL+I R RTGGD+T GK KVG+N+GYF YAG+E+ ISNYEVLCDTGLHVFG E  W HM+NG VP NA+VGGHT+SNEPLYI +ARI+G+MCVGK+CQSHGCA+MPYGG EH+ ++YEVLC+S+
Sbjct:    1 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046732.1 (SMESG000046732.1)

HSP 1 Score: 217.238 bits (552), Expect = 7.239e-72
Identity = 103/154 (66.88%), Postives = 121/154 (78.57%), Query Frame = 2
Query:   17 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFS 478
            M   GSGRQASLSWQPG  GQVPYNAIQA AG+++ R+R G D+T GK   GHN G+FPY G+E+  SNYEVLCDTGLHVFG E  W    NGSVP NAVVGG+T+SNEPLYI +  +NG MCVGKV QSHGC+F+P+GG EH+  +YEVLC+S
Sbjct:    1 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYS 154          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG105275.306e-2339.01gene:FBgn0034583 transcript:FBtr0071541[more]
CG133211.202e-1734.93gene:FBgn0033787 transcript:FBtr0345371[more]
CG133211.202e-1734.93gene:FBgn0033787 transcript:FBtr0087792[more]
CG442501.576e-1734.48gene:FBgn0265185 transcript:FBtr0339104[more]
CG442501.837e-1734.48gene:FBgn0265185 transcript:FBtr0339105[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D6565.370e-4149.66DM9 domain-containing protein OS=Schistosoma japon... [more]
A0A2H1CPU91.849e-4047.33DUF3421 domain-containing protein OS=Fasciola hepa... [more]
A0A4E0RKT42.448e-4047.33DM9 domain-containing protein OS=Fasciola hepatica... [more]
A0A430QH412.681e-4047.02DUF3421 domain-containing protein OS=Schistosoma b... [more]
A0A430PYP53.684e-4047.06DUF3421 domain-containing protein OS=Schistosoma b... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000055806.12.518e-633.68pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045654.12.801e-632.65pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000043153.13.403e-633.68pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000000247.26.395e-629.41pep primary_assembly:ASM223467v1:2:4655465:4657929... [more]
ENSORLT00000030643.16.573e-629.41pep primary_assembly:ASM223467v1:2:4655465:4661348... [more]
ENSORLT00000000248.29.409e-629.41pep primary_assembly:ASM223467v1:2:4654950:4659855... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046710.13.165e-114100.00SMESG000046710.1[more]
SMESG000046697.13.165e-114100.00SMESG000046697.1[more]
SMESG000057816.16.708e-8775.48SMESG000057816.1[more]
SMESG000046742.15.406e-8474.19SMESG000046742.1[more]
SMESG000046732.17.239e-7266.88SMESG000046732.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015310 ID=SMED30015310|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=769bp
TTTTAATTGATAAATCATGTCAAGAGCAGGCAGTGGCAGACAAGCTTCTT
TATCATGGCAACCGGGACAATATGGACAAGTTCCCTACAATGCTATTCAA
GCCGATGCTGGATTGTACATTGTTCGAACAAGAACTGGCGGTGATTTAAC
AATTGGAAAAACAAAAGTTGGTCACAATTCTGGATACTTTCCATATGCTG
GCAGAGAAGACAGTATTTCCAATTATGAAGTGTTGTGTGATACTGGACTG
CATGTTTTCGGAGGAGAACATCATTGGCAACACATGGCAAATGGATCTGT
GCCTCATAATGCAGTTGTTGGAGGTCATACGGCAAGTAATGAACCCCTTT
ATATTGCAAAAGCCCGAATTAATGGCGAAATGTGTGTTGGAAAAGTTTGC
CAGTCCCATGGTTGCGCATTTATGCCATATGGTGGTGCCGAACACAAAGC
CCACCACTATGAAGTTCTATGTTTCAGTGATTAAATGAACATAGACTTAT
TGTTGTTGATTAAATGACAAATTAATTAAACTATTCATCGTGATAAGTAG
AATTTTATTTTTATATTACTATTGAAAAATGACATTTTTGTGAATAATTA
ATTTTATGTCTATTTTCGATCAAAGCACAGGAAAAATCAGATTATATATT
AAGTTCGCCATATCTAGACAGAGCCAATATTGGCGTCGCCCCACGTTCTA
CGACGAAGGGGCCCTAACTTTTGCTACTTAATAATAATTAAATTTTTTTC
AAATTTATCTGATCTCTTG
back to top

protein sequence of SMED30015310-orf-1

>SMED30015310-orf-1 ID=SMED30015310-orf-1|Name=SMED30015310-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTK
VGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAV
VGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEV
LCFSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0000421tail
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006616DM9 repeatSMARTSM00696dm9coord: 11..76
e-value: 1.2E-5
score: 27.0
coord: 84..154
e-value: 1.1E-23
score: 94.7
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 8..64
e-value: 2.0E-7
score: 31.0
coord: 32..144
e-value: 7.8E-32
score: 109.7
NoneNo IPR availablePANTHERPTHR31649FAMILY NOT NAMEDcoord: 85..153
coord: 9..75