Neur_chan_LBD domain-containing protein

Overview
NameNeur_chan_LBD domain-containing protein
Smed IDSMED30015290
Length (bp)2595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neur_chan_LBD domain-containing protein (SMED30015290) t-SNE clustered cells

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30015290) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neur_chan_LBD domain-containing protein (SMED30015290) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30015290) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015290

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30015290SMESG000012532.1 dd_Smed_v4_13861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015290SMESG000012532.1 dd_Smed_v4_13861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015290SMESG000012532.1 dd_Smed_v4_13861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015290SMESG000012532.1 dd_Smed_v4_13861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30015290SMESG000012532.1 dd_Smed_v4_13861_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRG3 (gamma-aminobutyric acid type A receptor gamma3 subunit [Source:HGNC Symbol;Acc:HGNC:4088])

HSP 1 Score: 69.707 bits (169), Expect = 1.190e-11
Identity = 61/252 (24.21%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNIL---NETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMV----PDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG + ++   Y  D F    W +S+L  + N  +K + L+     L++I + +   ++T + +W+T           G+     R  +       L+L++FP+D     +  SS     E +M+     ++VE +        DQ+ W+L++   +  R  T+  T+S+  +  +++    SRR GYF    ++       LS+ +F +       R  L  T  LT      +  +SLPR+SY+T MD +V
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRL--RFNSTMKILTLNSNMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAEC--QLQLHNFPMDEHSCPLIFSSYGYPKE-EMIYRWRKNSVEAA--------DQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 320          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRG2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:HGNC Symbol;Acc:HGNC:4087])

HSP 1 Score: 67.781 bits (164), Expect = 1.680e-11
Identity = 68/271 (25.09%), Postives = 114/271 (42.07%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVV 1730
             IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   ++S  +  +SV    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ ++V
Sbjct:    5 SIGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAE--CQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVG--------DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVS-----VCFIFVFSALV 256          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRG2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:HGNC Symbol;Acc:HGNC:4087])

HSP 1 Score: 68.9366 bits (167), Expect = 1.940e-11
Identity = 68/272 (25.00%), Postives = 115/272 (42.28%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMF 1736
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   ++S  +  +SV    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ ++V +
Sbjct:   72 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVG--------DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-----SVCFIFVFSALVEY 324          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRG2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:HGNC Symbol;Acc:HGNC:4087])

HSP 1 Score: 68.1662 bits (165), Expect = 2.128e-11
Identity = 68/270 (25.19%), Postives = 114/270 (42.22%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVV 1730
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   ++S  +  +SV    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ ++V
Sbjct:  101 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVG--------DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-----SVCFIFVFSALV 351          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Match: GABRG2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:HGNC Symbol;Acc:HGNC:4087])

HSP 1 Score: 68.1662 bits (165), Expect = 2.482e-11
Identity = 68/271 (25.09%), Postives = 114/271 (42.07%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVV 1730
             IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   ++S  +  +SV    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ ++V
Sbjct:   76 SIGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVG--------DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-----SVCFIFVFSALV 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: lgc-46 (Probable ligand-gated ion channel 46 [Source:UniProtKB/Swiss-Prot;Acc:Q95Y52])

HSP 1 Score: 55.8398 bits (133), Expect = 9.463e-8
Identity = 65/264 (24.62%), Postives = 122/264 (46.21%), Query Frame = 3
Query:  960 IGEIDTLKEI---YHADAFIQSKWRESKLD------NKPNDELKAVDLDRCWNP-LLFID----NILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFV-INQSLPRISYLTYMDKYVLMSLA-ILC 1703
            + EI T+ +I   +  D +I   W +  L+       K N  L +V L++ W P   FI+    +I        +L    N  G  +   R KL+G  +  ++L  FP D  ++T +++ E  +   D V     ++G+  Q   D+ E   +E V++ K   T+EY +       L+++    RR G++    +L  +    +S+ +FA+ +     R  L     L ++ F+F  I ++LPR+SY+  +D ++L  +  + C
Sbjct:   95 VQEITTISDITSDFQLDIYIYETWYDPALNYAFMNPCKYNLSLNSVLLEKLWTPNSCFINSKTADIHKSPFPNIFLMIYAN--GTVWTNYRLKLQGPCI--MDLTKFPFD--NVTCSLTFESFNYNTDEVKMDWSVNGV--QKMRDKMELADYELVDIHKIRTTEEYPAGYWHE--LTMSFEFKRRAGWYILQAYLPTYLTICISWISFALGSKAIPARTMLGVNSLL-AMTFQFGNIIRNLPRVSYVKAIDVWMLSCMTFVFC 347          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: gab-1 (Gamma-aminobutyric acid receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:O18276])

HSP 1 Score: 54.299 bits (129), Expect = 3.282e-7
Identity = 63/270 (23.33%), Postives = 109/270 (40.37%), Query Frame = 3
Query:  960 IGEIDTLKEI---YHADAFIQSKWRESKL---DNKPNDE--LKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIE-------RRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEIDMVPD-TVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYT------SSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAIL 1700
            I   D++ E+   Y    ++   W + +L   +  P DE  L        W P  F+ N      D++    E  E+ +   I          +L      ++ L +FPLD Q+ T+ I S     SE+ M  +  + + G+              E  +V +  +T  +T      +++  +  LS+  +  R  GYF +  +L    I  LS+ +F +       R+ L  T  LT       + QSLPRISY+  +D Y++M    +
Sbjct:   86 IASFDSISEVDMDYTLTMYLHQYWTDERLRWSNEIPIDEMTLSGEFSQNIWVPDTFLAN------DKHSYLHEVTERNKMLRINVDGKVAYGMRLTSTLSCSMNLRNFPLDSQNCTVEIESYGYTTSEVLMKWNYPLAVHGV--------------EQADVPQFTITGFHTEDSIVSTATGSYQRLSLVFQLRRSVGYFIFQTYLPCVLIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRQSLPRISYVKSIDIYLVMCFVFV 335          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: deg-3 (Acetylcholine receptor subunit alpha-type deg-3 [Source:UniProtKB/Swiss-Prot;Acc:P54244])

HSP 1 Score: 53.9138 bits (128), Expect = 4.388e-7
Identity = 59/261 (22.61%), Postives = 102/261 (39.08%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPND----ELKAVDLDRCWNPLLFIDNILNETKDQ------------YWLTAEQNEKGETYIIERRKLKGVFLETLELND--FPLDVQDLTITISS-ERPDSEIDMVPDTVELSGINIQTFVDQQEW-----KLHEHVEVTKRVVTQEYTSSSRCHP--CLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENR---LQLSFTLFLTSVAFKFVINQSLPRIS 1652
            +I E+D   +    + ++  KWR+  LD  PN+        +     W P  ++ N +  ++D+            YW   +  E    Y         ++  T  LN   FP D Q+ T+TISS     S +D   DT     +++Q+F+  +EW     K+H H          EY  +    P   L  +    R+P Y+  N+ +    IT ++   F  P    ++R   + L  T  L       +++  +P  S
Sbjct:   88 QIIEVDEPSQNIKLNVWMIQKWRDEYLDWNPNEYGMINSTIIPFHHLWIPDTYLYNSVKMSRDETERYMNIQATSNYWKGEKGAELSFLY-------PAIYTITCRLNIRFFPYDRQNCTLTISSWTNSKSALDYYADT----EVSMQSFIPNEEWQVKSFKIHRH----------EYKYACCAEPWVILQASLVIQRKPLYYLVNLIIPTSIITLVAITGFFTPASTDDDRTEKINLGITTLLAMSILMLMVSDQMPTTS 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Match: deg-3 (Acetylcholine receptor subunit alpha-type deg-3 [Source:UniProtKB/Swiss-Prot;Acc:P54244])

HSP 1 Score: 53.9138 bits (128), Expect = 4.388e-7
Identity = 59/261 (22.61%), Postives = 102/261 (39.08%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPND----ELKAVDLDRCWNPLLFIDNILNETKDQ------------YWLTAEQNEKGETYIIERRKLKGVFLETLELND--FPLDVQDLTITISS-ERPDSEIDMVPDTVELSGINIQTFVDQQEW-----KLHEHVEVTKRVVTQEYTSSSRCHP--CLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENR---LQLSFTLFLTSVAFKFVINQSLPRIS 1652
            +I E+D   +    + ++  KWR+  LD  PN+        +     W P  ++ N +  ++D+            YW   +  E    Y         ++  T  LN   FP D Q+ T+TISS     S +D   DT     +++Q+F+  +EW     K+H H          EY  +    P   L  +    R+P Y+  N+ +    IT ++   F  P    ++R   + L  T  L       +++  +P  S
Sbjct:   88 QIIEVDEPSQNIKLNVWMIQKWRDEYLDWNPNEYGMINSTIIPFHHLWIPDTYLYNSVKMSRDETERYMNIQATSNYWKGEKGAELSFLY-------PAIYTITCRLNIRFFPYDRQNCTLTISSWTNSKSALDYYADT----EVSMQSFIPNEEWQVKSFKIHRH----------EYKYACCAEPWVILQASLVIQRKPLYYLVNLIIPTSIITLVAITGFFTPASTDDDRTEKINLGITTLLAMSILMLMVSDQMPTTS 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: Lcch3 (gene:FBgn0010240 transcript:FBtr0074129)

HSP 1 Score: 51.9878 bits (123), Expect = 1.884e-6
Identity = 61/272 (22.43%), Postives = 110/272 (40.44%), Query Frame = 3
Query:  954 LKIGEIDTLKEI---YHADAFIQSKWRESKL---------DNKPNDELKAVD------LDRCWNPLLFIDN----ILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAIL 1700
            L I   D + E+   Y    ++   WR+ +L         D++ +D +  V        ++ W P  F  N     L++  ++  L     +   TY +   +        ++L+ +PLD Q+ T+ I S     S++ M      + G+     + Q     +E  +  +R+ T  Y         LS++ +  R  GYF +  +L    I  LS+ +F +       R+ L  T  LT       +  SLPRISY+  +D Y++M    +
Sbjct:   70 LTIASFDAISEVNMDYTITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGAVTYGM---RFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKPTPVRGVE-DAELPQFTIIGYETNDRKERLATGVYQR-------LSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFV 330          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301233)

HSP 1 Score: 50.447 bits (119), Expect = 5.395e-6
Identity = 64/276 (23.19%), Postives = 101/276 (36.59%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKP---NDELKAVDLDRCWNPLLFIDN-----ILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQ---EWKLHE-HVEVTKRVVTQEYTSSSRCH------------PCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISI 1715
            +G +  L   Y  D + +  WR+ +L  K    +  L    LD+ W P  +  N     I   T     L  +QN  G      R  +K      +EL +FP+D Q   + I S                       +++QQ   EWK  +  V     +   ++   S  H              L V     R  GYF   V++    I  LS+ +F +      +R+ L  T  LT           LP++ Y T +D ++LMS  + CI ++
Sbjct:   42 MGPVSELDMDYSMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQN--GGILYSMRLTIKATC--PMELQNFPMDRQSCPLVIGS---------------------YGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSF-LYCIATL 291          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301232)

HSP 1 Score: 50.8322 bits (120), Expect = 5.648e-6
Identity = 64/276 (23.19%), Postives = 101/276 (36.59%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKP---NDELKAVDLDRCWNPLLFIDN-----ILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQ---EWKLHE-HVEVTKRVVTQEYTSSSRCH------------PCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISI 1715
            +G +  L   Y  D + +  WR+ +L  K    +  L    LD+ W P  +  N     I   T     L  +QN  G      R  +K      +EL +FP+D Q   + I S                       +++QQ   EWK  +  V     +   ++   S  H              L V     R  GYF   V++    I  LS+ +F +      +R+ L  T  LT           LP++ Y T +D ++LMS  + CI ++
Sbjct:  144 MGPVSELDMDYSMDCYFRQYWRDKRLSFKGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQN--GGILYSMRLTIKATC--PMELQNFPMDRQSCPLVIGS---------------------YGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSF-LYCIATL 393          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:ZFIN;Acc:ZDB-GENE-141215-66])

HSP 1 Score: 67.781 bits (164), Expect = 2.888e-11
Identity = 65/253 (25.69%), Postives = 107/253 (42.29%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEIDMVPD--TVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG +D +   Y  D F    W +S+L  K N  +K + L+     + W P  F  N  +   D +W+T           G      R  +       L+L++FP+D     +  SS   P +EI       +VE++        DQ+ W+L++   V  R  +    + S  +  +++    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   95 IGPVDPINMEYTIDIFFAQTWYDSRL--KFNSSMKLLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECY--LKLHNFPMDEHSCPLEFSSYGYPKNEIQYRWQRRSVEVA--------DQRYWRLYQFAFVGLRNSSDVANTQSGEYVVMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFV 333          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:ZFIN;Acc:ZDB-GENE-141215-66])

HSP 1 Score: 67.3958 bits (163), Expect = 3.821e-11
Identity = 65/253 (25.69%), Postives = 107/253 (42.29%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEIDMVPD--TVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG +D +   Y  D F    W +S+L  K N  +K + L+     + W P  F  N  +   D +W+T           G      R  +       L+L++FP+D     +  SS   P +EI       +VE++        DQ+ W+L++   V  R  +    + S  +  +++    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   95 IGPVDPINMEYTIDIFFAQTWYDSRL--KFNSSMKLLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECY--LKLHNFPMDEHSCPLEFSSYGYPKNEIQYRWQRRSVEVA--------DQRYWRLYQFAFVGLRNSSDVANTQSGEYVVMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFV 333          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-091118-65])

HSP 1 Score: 66.6254 bits (161), Expect = 4.556e-11
Identity = 65/251 (25.90%), Postives = 107/251 (42.63%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+LN+FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  ++   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:  101 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPKEEIVYKWKRSSVEVG--------DIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 339          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-091118-65])

HSP 1 Score: 66.2402 bits (160), Expect = 9.587e-11
Identity = 65/251 (25.90%), Postives = 107/251 (42.63%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+LN+FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  ++   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:  101 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPKEEIVYKWKRSSVEVG--------DIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 339          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Match: gabrg2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-091118-65])

HSP 1 Score: 65.855 bits (159), Expect = 1.088e-10
Identity = 65/251 (25.90%), Postives = 107/251 (42.63%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+LN+FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  ++   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:  101 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPKEEIVYKWKRSSVEVG--------DIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 339          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 69.707 bits (169), Expect = 9.672e-12
Identity = 65/253 (25.69%), Postives = 107/253 (42.29%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+E  ++S  +  ++V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:  131 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPKEEIIYQWKRSSVEVG--------DVRSWRLYQFSFVGLRNTTEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 369          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 69.707 bits (169), Expect = 9.724e-12
Identity = 65/253 (25.69%), Postives = 107/253 (42.29%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+E  ++S  +  ++V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:  131 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPKEEIIYQWKRSSVEVG--------DVRSWRLYQFSFVGLRNTTEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 369          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: ccdc134 (coiled-coil domain containing 134 [Source:Xenbase;Acc:XB-GENE-951215])

HSP 1 Score: 65.4698 bits (158), Expect = 2.100e-10
Identity = 61/252 (24.21%), Postives = 112/252 (44.44%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNIL---NETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMV----PDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG + ++   Y  D F    W +S+L  + N  +K + L+     L++I + +   ++T + +W+T           G+     R  +       L+L++FP+D     +  SS     E +MV     ++VE +        +Q+ W+L++   +  R  T+   +S+  +  ++V    SRR GYF    ++       LS+ +F +       R  L  T  LT      +  +SLPR+SY+T MD +V
Sbjct:   85 IGPVSSINMEYQIDIFFAQTWTDSRL--RFNSTMKILTLNSNMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAEC--QLQLHNFPMDEHSCPLIFSSYGYPRE-EMVYRWRKNSVETA--------NQKSWRLYQFDFMGLRNTTEIVKTSAGDYIVMTVYFDLSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 323          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 65.0846 bits (157), Expect = 2.997e-10
Identity = 63/243 (25.93%), Postives = 102/243 (41.98%), Query Frame = 3
Query:  990 YHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+E  ++S  +  ++V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   99 YTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAE--CQLQLHNFPMDEHSCPLEFSSYGYPKEEIIYQWKRSSVEVG--------DVRSWRLYQFSFVGLRNTTEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 64.6994 bits (156), Expect = 3.749e-10
Identity = 63/243 (25.93%), Postives = 102/243 (41.98%), Query Frame = 3
Query:  990 YHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+E  ++S  +  ++V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   83 YTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAE--CQLQLHNFPMDEHSCPLEFSSYGYPKEEIIYQWKRSSVEVG--------DVRSWRLYQFSFVGLRNTTEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 311          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg3 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 3 [Source:MGI Symbol;Acc:MGI:95624])

HSP 1 Score: 72.7886 bits (177), Expect = 8.310e-13
Identity = 62/252 (24.60%), Postives = 114/252 (45.24%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNIL---NETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMV----PDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG + ++   Y  D F    W +S+L  + N  +K + L+     L++I + +   ++T + +W+T           G+     R  +       L+L++FP+D     +T SS     E +M+     ++VE +        DQ+ W+L++   +  R  T+  T+S+  +  +++    SRR GYF    ++       LS+ +F +       R  L  T  LT      +  +SLPR+SY+T MD +V
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRL--RFNSTMKILTLNSNMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAEC--QLQLHNFPMDAHACPLTFSSYGYPKE-EMIYRWRKNSVEAA--------DQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 320          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg2 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2 [Source:MGI Symbol;Acc:MGI:95623])

HSP 1 Score: 68.5514 bits (166), Expect = 1.205e-11
Identity = 68/273 (24.91%), Postives = 115/273 (42.12%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMF 1736
             IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   ++S  +  +SV    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ ++V +
Sbjct:   99 SIGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVG--------DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVS-----VCFIFVFSALVEY 352          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg2 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2 [Source:MGI Symbol;Acc:MGI:95623])

HSP 1 Score: 68.5514 bits (166), Expect = 1.802e-11
Identity = 68/272 (25.00%), Postives = 115/272 (42.28%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMF 1736
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   ++S  +  +SV    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ ++V +
Sbjct:  100 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVG--------DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-----SVCFIFVFSALVEY 352          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg2 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2 [Source:MGI Symbol;Acc:MGI:95623])

HSP 1 Score: 68.1662 bits (165), Expect = 2.022e-11
Identity = 68/272 (25.00%), Postives = 115/272 (42.28%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMF 1736
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   ++S  +  +SV    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ ++V +
Sbjct:  100 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVG--------DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVS-----VCFIFVFSALVEY 352          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Match: Gabrg1 (gamma-aminobutyric acid (GABA) A receptor, subunit gamma 1 [Source:MGI Symbol;Acc:MGI:103156])

HSP 1 Score: 63.5438 bits (153), Expect = 5.951e-10
Identity = 63/253 (24.90%), Postives = 106/253 (41.90%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEID--MVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG +D +   Y  D      W +S+L  K N  +K + L+     + W P  F  N  +   D +W+T           G      R  +       L+L++FP+D     +  SS   P +EI+      +VE++        D + W+L++   V  R  T+   + S  +  +++    SRR GYF    ++       LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   99 IGPVDPINMEYTIDIIFAQTWFDSRL--KFNSTMKVLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITTPNRLLRIWSDGRVLYTLRLTINAECY--LQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVA--------DPKYWRLYQFAFVGLRNSTEISHTISGDYIIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 337          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P27681|GBRG3_MOUSE (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Mus musculus OX=10090 GN=Gabrg3 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 5.813e-12
Identity = 62/252 (24.60%), Postives = 114/252 (45.24%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNIL---NETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMV----PDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG + ++   Y  D F    W +S+L  + N  +K + L+     L++I + +   ++T + +W+T           G+     R  +       L+L++FP+D     +T SS     E +M+     ++VE +        DQ+ W+L++   +  R  T+  T+S+  +  +++    SRR GYF    ++       LS+ +F +       R  L  T  LT      +  +SLPR+SY+T MD +V
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRL--RFNSTMKILTLNSNMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAEC--QLQLHNFPMDAHACPLTFSSYGYPKE-EMIYRWRKNSVEAA--------DQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 320          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P28473|GBRG3_RAT (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Rattus norvegicus OX=10116 GN=Gabrg3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 5.916e-12
Identity = 62/252 (24.60%), Postives = 114/252 (45.24%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNIL---NETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMV----PDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG + ++   Y  D F    W +S+L  + N  +K + L+     L++I + +   ++T + +W+T           G+     R  +       L+L++FP+D     +T SS     E +M+     ++VE +        DQ+ W+L++   +  R  T+  T+S+  +  +++    SRR GYF    ++       LS+ +F +       R  L  T  LT      +  +SLPR+SY+T MD +V
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRL--RFNSTMKILTLNSNMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAEC--QLQLHNFPMDAHACPLTFSSYGYPKE-EMIYRWRKNSVEAA--------DQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 320          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99928|GBRG3_HUMAN (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Homo sapiens OX=9606 GN=GABRG3 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 5.716e-11
Identity = 61/252 (24.21%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNIL---NETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMV----PDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG + ++   Y  D F    W +S+L  + N  +K + L+     L++I + +   ++T + +W+T           G+     R  +       L+L++FP+D     +  SS     E +M+     ++VE +        DQ+ W+L++   +  R  T+  T+S+  +  +++    SRR GYF    ++       LS+ +F +       R  L  T  LT      +  +SLPR+SY+T MD +V
Sbjct:   82 IGPVSSINMEYQIDIFFAQTWTDSRL--RFNSTMKILTLNSNMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAEC--QLQLHNFPMDEHSCPLIFSSYGYPKE-EMIYRWRKNSVEAA--------DQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARKSLPRVSYVTAMDLFV 320          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P34904|GBRG4_CHICK (Gamma-aminobutyric acid receptor subunit gamma-4 OS=Gallus gallus OX=9031 GN=GABRG4 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.269e-11
Identity = 64/253 (25.30%), Postives = 108/253 (42.69%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG +  ++  Y  D F    W + +L  + N  LKA+ L+     R W P  F  N  ++  D +W+T           G+     R  ++   L  L+L +FP+D     +  SS   P  EI       ++E+S        DQ+ W+L++      R  ++   + +  +  ++V+   SRR GYF    ++       LS+ +F +       R  L  T  LT      +  + LPR+SY+T MD +V
Sbjct:   84 IGPVSVIQMEYTIDIFFAQTWYDRRL--RFNSTLKALTLNTNMVSRIWIPDTFFRN--SKRADSHWITTPNQLLRIWNDGKVLYTLRLTIEAECL--LQLQNFPMDTHSCPLVFSSYGYPREEIVYRWRRYSIEVS--------DQRTWRLYQFDFTGLRNTSEVLRTGAGEYMVMTVSFDLSRRMGYFAIQTYIPCILTVVLSWVSFWIKRDSTPARTSLGITTVLTMTTLSTISRKHLPRVSYITAMDLFV 322          
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Match: sp|P22300|GBRG2_BOVIN (Gamma-aminobutyric acid receptor subunit gamma-2 OS=Bos taurus OX=9913 GN=GABRG2 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.080e-10
Identity = 68/272 (25.00%), Postives = 116/272 (42.65%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMF 1736
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T           G      R  +       L+L++FP+D     +  SS   P  EI       +VE+S        D + W+L++   V  R  T+   ++S  +  ++V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ ++V +
Sbjct:  101 IGPVNAINMEYTIDIFFGQTWYDRRL--KFNSTIKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAEC--QLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVS--------DTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV-----SVCFIFVFSALVEY 353          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4S2LIX3 (Neur_chan_LBD domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007218 PE=3 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 4.461e-168
Identity = 257/435 (59.08%), Postives = 308/435 (70.80%), Query Frame = 3
Query:  951 FLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFI-----KPPNMGITITTIKPITVQTPVNSDNNTSYKKLFEPXXXXXXXXXXXXSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEK------NRLALELRITAKFQK----KVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYKEWVKRNKE 2210
            FLKIGEIDTLKEIYHADAFIQ+KWRE +LD K  +EL+ +DL RCWNPL+ IDNILNE+KDQ+W+     +  E YI+ERR+L+G+FLETLELNDFPLDVQDLTIT++SERPD+E+ +VPD  EL  IN+QT VDQQEW+LHEH+EVT+R  TQEYT+SS+ HPC+SVTCRA+RRPGYFYWNVFL+MFFITGLSFATFAVP  R ENRLQLSFTLFLTSVAFKFVINQSLP+ISYLTYMDKYVLMSLAILC++SIWH+VV  I     KP ++    TT   I  Q P +     +    F P         +      P   K+  D  N   +T      I     +    IS+ K        LA +    AK Q+    ++E+++F SF +LY  AH  FI WLYFDAS RRREM+E DRQYK W+  NKE
Sbjct:  215 FLKIGEIDTLKEIYHADAFIQAKWREPRLDGKSEEELRKIDLQRCWNPLILIDNILNESKDQHWINTHTGDNNEIYIVERRRLRGIFLETLELNDFPLDVQDLTITLTSERPDTEVALVPDKNELCAINVQTLVDQQEWRLHEHIEVTRRSATQEYTNSSQHHPCISVTCRAARRPGYFYWNVFLIMFFITGLSFATFAVPPERPENRLQLSFTLFLTSVAFKFVINQSLPKISYLTYMDKYVLMSLAILCVVSIWHAVVTLIPTDEWKPVSVRSETTT--AIGEQNPSDITAGLANPLTFTPLLLIRQSMNMSD---KPMEGKKVRDTIN---VTRLNRTHIADEFGAINTTISKFKLGPIDWQALAKQTTQDAKTQRRLKLRIEQEVFASFCVLYILAHLTFIFWLYFDASARRREMVELDRQYKRWLHANKE 641          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4S2LQ23 (Neur_chan_LBD domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007218 PE=3 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 5.419e-168
Identity = 255/429 (59.44%), Postives = 308/429 (71.79%), Query Frame = 3
Query:  951 FLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFI-----KPPNMGITITTIKPITVQTPVNSDNNTSYKKLFEPXXXXXXXXXXXXSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEKNRLALELRITAKFQK----KVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYKEWVKRNKE 2210
            FLKIGEIDTLKEIYHADAFIQ+KWRE +LD K  +EL+ +DL RCWNPL+ IDNILNE+KDQ+W+     +  E YI+ERR+L+G+FLETLELNDFPLDVQDLTIT++SERPD+E+ +VPD  EL  IN+QT VDQQEW+LHEH+EVT+R  TQEYT+SS+ HPC+SVTCRA+RRPGYFYWNVFL+MFFITGLSFATFAVP  R ENRLQLSFTLFLTSVAFKFVINQSLP+ISYLTYMDKYVLMSLAILC++SIWH+VV  I     KP ++    TT   I  Q P +     +    F P         +    M     K +  + N+  + +         SK    PI  +   LA +    AK Q+    ++E+++F SF +LY  AH  FI WLYFDAS RRREM+E DRQYK W+  NKE
Sbjct:  215 FLKIGEIDTLKEIYHADAFIQAKWREPRLDGKSEEELRKIDLQRCWNPLILIDNILNESKDQHWINTHTGDNNEIYIVERRRLRGIFLETLELNDFPLDVQDLTITLTSERPDTEVALVPDKNELCAINVQTLVDQQEWRLHEHIEVTRRSATQEYTNSSQHHPCISVTCRAARRPGYFYWNVFLIMFFITGLSFATFAVPPERPENRLQLSFTLFLTSVAFKFVINQSLPKISYLTYMDKYVLMSLAILCVVSIWHAVVTLIPTDEWKPVSVRSETTT--AIGEQNPSDITAGLANPLTFTPLLLIRQSMNMSDKPMEG--KKINVTRLNRTHIADEFGAINTTISKFKLGPIDWQA--LAKQTTQDAKTQRRLKLRIEQEVFASFCVLYILAHLTFIFWLYFDASARRREMVELDRQYKRWLHANKE 637          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A5K4FB25 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 3.279e-165
Identity = 256/438 (58.45%), Postives = 322/438 (73.52%), Query Frame = 3
Query:  951 FLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIKPPNMGITITTIKPITVQTPVNSDNNTSYKKLFEPXXXXXXXXXXXXSRMNPSFNKRSTDKSNKLLLTEAKHI----------PIVARSKSTELPISEEKNR---LALELRITAKFQKK------VERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYKEWVKRNK 2207
            FLKIGEIDTLKEIYHADAFIQ+KWRE +LD K ++ L+ +DL RCWNPL+ IDNIL+E+K+Q+W+  E+NE  E +I+ERR+L+GVFLETLELNDFPLDVQDLTIT++SERP+SE++++PD  E   IN+QT VDQQEW+LHEH+E+T+R  TQEYT+SS+ HPC+SVTCRA+RRPGYFYWNVFL+MFFITGLSFATFAVP  R ENRLQLSFTLFLTSVAFKFVINQSLP+ISYLTYMDKYVLMSLAILC++S+WH+VV  I P +      T K +   T         YK L  P  +T+  T    +  + S +     K+N  L+   K             IV R  S +L  S++ N+   +AL L+  ++ Q K      +ERD+F+SF +LY  AH  FI WLYFDASKRRREM+E+DR YK+ ++ +K
Sbjct:  249 FLKIGEIDTLKEIYHADAFIQAKWREPRLDGKTDECLRKIDLQRCWNPLILIDNILSESKEQHWIITERNENDEIFIVERRRLRGVFLETLELNDFPLDVQDLTITLTSERPESEVELIPDKYEPCRINLQTLVDQQEWRLHEHIEITRRSATQEYTNSSQSHPCISVTCRAARRPGYFYWNVFLIMFFITGLSFATFAVPPERPENRLQLSFTLFLTSVAFKFVINQSLPKISYLTYMDKYVLMSLAILCVVSVWHAVVTLI-PSDAEFEQLTTKNLLKTTNPQFSFMKRYKGLTFPYSSTVNVTSRQIN--DASIDDHVDVKNNTSLIQIEKSTNGDITSNDDKQIVDRQNSQKL--SQQLNQQTWIALALQSKSREQHKRRLMMRIERDVFVSFCILYVLAHLTFIFWLYFDASKRRREMVERDRLYKKSMQASK 681          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A5J4NW13 (Neur_chan_LBD domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007322 PE=3 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 6.168e-165
Identity = 255/444 (57.43%), Postives = 321/444 (72.30%), Query Frame = 3
Query:  951 FLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIKPPNM---------GITITTIKPITVQT---PVNSDNNTS-YKKLFEPXXXXXXXXXXXXSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTEL-----PISEEKNRL--------------ALELRITAKFQKKVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYK 2186
            FLKIGEIDTLKE YHADAFIQ KWRE +LD K ++EL+ +DL RCWNPL+ IDNIL+E+KDQ+W   +++E+ E YI+ERR+L+GVFLETLELNDFPLDVQDLTIT++SERPDSE+ +VPD  EL GIN+QT VDQQEWKLHEH+EVT+R  TQEYT+SS+ HPCLSVTCRA+RRPGYFYWNVFL+MFFITGLSFATFAVP  R ENRLQLSFTLFLTSVAFKFVINQSLP+ISYLTYMDKYVLMSLAILC++SIWH+VV  I P +            T++ ++  T  T   P++ ++  S   ++F+          L +S       +   +++ +  LT +  IP  + + +T+L     P +E K  +               ++ R   + +  +ERD+F SF +LY  AH  FI WLYFDASKRRREM+E+D+QYK
Sbjct:  222 FLKIGEIDTLKETYHADAFIQVKWREPRLDGKTDEELRRIDLQRCWNPLILIDNILSESKDQHWSLTQKSEQNEVYIVERRRLRGVFLETLELNDFPLDVQDLTITLTSERPDSEVILVPDRNELCGINLQTLVDQQEWKLHEHIEVTRRSATQEYTNSSQHHPCLSVTCRAARRPGYFYWNVFLIMFFITGLSFATFAVPPERPENRLQLSFTLFLTSVAFKFVINQSLPKISYLTYMDKYVLMSLAILCVVSIWHAVVTLI-PTDAEFEQSAYESAQTLSLLRSPTFNTYSGPLHDESGESDNTRMFQ----NDSGQNLDESLQMHYLYRAQENQTGQSALTPSTAIP--SNTLTTQLVGEFSPFTEPKPSVDWETKQWQDLARHHTIQEREKRRLKMMIERDVFTSFCVLYVLAHLTFIFWLYFDASKRRREMVERDKQYK 658          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: G7Y830 (Gamma-aminobutyric acid receptor subunit gamma-3 OS=Clonorchis sinensis OX=79923 GN=CLF_102521 PE=3 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 1.768e-159
Identity = 261/459 (56.86%), Postives = 319/459 (69.50%), Query Frame = 3
Query:  951 FLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFI-----KPPNMGITITTIKPITVQTPVNSDNNTSYKKLFEPXXXXXXXXXXXXSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEK------NRLALELRITAKFQK----KVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYK--EWVKRNKEWVDNHNQQHSHGHRNSNILMNR 2276
            FLKIGEIDTLKEIYHADAFIQ+KWRE +LD K  +EL+ +DL RCWNPL+ IDNILNE+KDQ+W+     +  E YI+ERR+L+G+FLETLELNDFPLDVQDLTIT++SERPD+E+ +VPD  EL  IN+QT VDQQEW+LHEH+EVT+R  TQEYT+SS+ HPC+SVTCRA+RRPGYFYWNVFL+MFFITGLSFATFAVP  R ENRLQLSFTLFLTSVAFKFVINQSLP+ISYLTYMDKYVLMSLAILC++SIWH+VV  I     KP ++    TT   I  Q P N+    +    F P         +      P+  K+  D  N   +T      I     +    IS+ K        LA +    AK Q+    ++E+++F SF +LY  AH  FI WLYFDAS RRREM+E DRQYK  + + ++     NH Q+ S   +NS    +R
Sbjct:  213 FLKIGEIDTLKEIYHADAFIQAKWREPRLDGKTEEELRKIDLQRCWNPLILIDNILNESKDQHWINTHTGDNNEIYIVERRRLRGIFLETLELNDFPLDVQDLTITLTSERPDTEVALVPDKNELCAINVQTLVDQQEWRLHEHIEVTRRSATQEYTNSSQHHPCISVTCRAARRPGYFYWNVFLIMFFITGLSFATFAVPPERPENRLQLSFTLFLTSVAFKFVINQSLPKISYLTYMDKYVLMSLAILCVVSIWHAVVTLIPTDEWKPASVRSETTTA--IGEQNPSNTTAGLASPLTFTPLLLIRQSVNMSD---KPTEGKKVWDAIN---VTRLNRTQIADEFSAINTTISKFKLGPIDWQALAKQTTQDAKTQRRLKLRIEQEVFASFCVLYILAHLTFIFWLYFDASARRREMVELDRQYKMSQRISQSGHSSQNH-QRFSFNKKNSYSFPDR 662          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:NCBI gene;Acc:103030074])

HSP 1 Score: 68.9366 bits (167), Expect = 1.018e-11
Identity = 64/251 (25.50%), Postives = 106/251 (42.23%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG +D +   Y  D F    W +S+L  + N  +K + L+     + W P  F  N  +   D +W+T           G      R  +       L+L++FP+D     +  SS   P +EI+      +     +Q   DQ+ W+L++   V  +  T    + S  +  +S+    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   89 IGPVDPINMEYTIDIFFAQSWYDSRL--QFNSSMKVLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECY--LKLHNFPMDEHSCPLEFSSYGYPKNEIEY-----KWHSRAVQV-ADQRYWRLYQFAFVGLQNTTGIAHTQSGDYVVMSILFTLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFV 327          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:103027255])

HSP 1 Score: 65.0846 bits (157), Expect = 1.506e-10
Identity = 65/252 (25.79%), Postives = 107/252 (42.46%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
             IG ++ +   Y  D F    W +S+L  + N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+L +FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   93 SIGPVNAINMEYTIDIFFAQTWYDSRL--RFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLYNFPMDEHSCPLEFSSYGYPKEEIVYRWKRSSVEVG--------DIRSWRLYQFSFVGLRNSTEVVRTVSGDYVVLTVFFELSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 332          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:103027255])

HSP 1 Score: 65.0846 bits (157), Expect = 1.550e-10
Identity = 67/269 (24.91%), Postives = 115/269 (42.75%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVV 1730
             IG ++ +   Y  D F    W +S+L  + N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+L +FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V      +C I ++ +++
Sbjct:   94 SIGPVNAINMEYTIDIFFAQTWYDSRL--RFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLYNFPMDEHSCPLEFSSYGYPKEEIVYRWKRSSVEVG--------DIRSWRLYQFSFVGLRNSTEVVRTVSGDYVVLTVFFELSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVS-----VCFIFVFAALI 345          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:103027255])

HSP 1 Score: 65.0846 bits (157), Expect = 1.724e-10
Identity = 65/252 (25.79%), Postives = 107/252 (42.46%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
             IG ++ +   Y  D F    W +S+L  + N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+L +FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  T+   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   93 SIGPVNAINMEYTIDIFFAQTWYDSRL--RFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLYNFPMDEHSCPLEFSSYGYPKEEIVYRWKRSSVEVG--------DIRSWRLYQFSFVGLRNSTEVVRTVSGDYVVLTVFFELSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 332          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Match: GABRG3 (gamma-aminobutyric acid type A receptor gamma3 subunit [Source:NCBI gene;Acc:103040847])

HSP 1 Score: 63.5438 bits (153), Expect = 5.284e-10
Identity = 61/251 (24.30%), Postives = 106/251 (42.23%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFI-DNILNETK--DQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS---ERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG + ++   Y  D      W +S+L  + N  +K + L+     L+++ D I   +K  D +W+T           G+     R  +       L+L++FP+D     +  SS    R +       ++VE +        DQ+ W+L++   +  R  T    +++  +  ++V    SRR GYF    ++       LS+ +F +       R  L  T  LT      V   SLPR+SY+T MD +V
Sbjct:  147 IGPVSSINMEYQIDIIFAQTWTDSRL--RYNSTMKILTLNSNMVGLIWVPDTIFRNSKNADSHWITTPNQLLRIWNDGKILYTLRLTINAEC--QLQLHNFPMDEHSCPLIFSSYGYPRDEMIYKWRKNSVEAA--------DQKSWRLYQFDFMGLRNTTDVIKTTAGDYVVMTVYFDLSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTVARTSLPRVSYVTAMDLFV 385          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 51.9878 bits (123), Expect = 3.995e-7
Identity = 61/273 (22.34%), Postives = 114/273 (41.76%), Query Frame = 3
Query:  963 GEIDTLKEIYHADAFIQSKWRESKL--DNKPND--ELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETY----IIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMV-----PDTVELS-GINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFI 1739
            G I      Y  + F++ +W + +L     P+D  +L    LD  W P LF  N   E    +      N+    +    ++   +L       ++L +FP+DVQ   + + S       D++        V+++ G+ +  FV + E    + V  TK   T ++T       C+ V     R+ GY+   +++    I  LS+ +F +    A  R+ L  T  LT          SLP++SY+  +D ++ + L  +    + ++ V F+
Sbjct:   18 GSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFAN---EKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMN-DLIFEWKQEGAVQVAEGLTLPQFVLKDE---KDLVYCTKHYNTGKFT-------CIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFV 276          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002305.1 (pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 gene:ENSPMAG00000002075.1 transcript:ENSPMAT00000002305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 3.305e-6
Identity = 53/251 (21.12%), Postives = 104/251 (41.43%), Query Frame = 3
Query:  963 GEIDTLKEIYHADAFIQSKWRESKLDN--------KPNDELKAVDLDRCWNPLLFIDN----ILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            G I+     Y    ++Q  W +S++++        K   +L    +D  W P LF +N      +E   ++ +          + +    L       + L  +PLD Q+  I + S    ++ D++    E   + + T +   ++KL  H E+     ++EY + +  H C++ T    R  GY+   V+     +  +S+ +F +       R+ L  T  LT        N +LP++SY+  MD ++
Sbjct:   69 GPIEENTMDYMMLIYLQQSWIDSRIESIYSAGHYQKDFLDLANNYIDTVWTPDLFFENEKSAAFHEIHCRFSIIVHATNNKTCFSL---VLSLTLACPMNLEYYPLDTQECRINLESFGYTTQ-DLIFQWDENEPLVVATNLYTPKFKLSNHTELGD--CSKEYLTGT--HSCINATFYLHRDMGYYLIQVYFPSCLLVIISWLSFWLSVESTPARVSLGITTILTVTTQMTSANAALPKMSYIKAMDVWM 311          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 140.198 bits (352), Expect = 6.619e-36
Identity = 87/266 (32.71%), Postives = 145/266 (54.51%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDN--ILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQE---YTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIK 1742
            +G+ID +++ +  + ++ + WRE KL  K N+E+K    D  W+P +   N  +L+       L  E+N        E  K++G F E   L  FP+D+Q+L+I ISS+  D  +    D  +   +  QTF   ++W L+ HV       TQE      + R +P   +T    RR  +++WN  +VM  +T LSFA+FA+P  +  +RL ++  L L SVA+KFV +  LPR SYLT++DKY L +L  +  I++ +++ + ++
Sbjct:   27 LGDIDVIRQQFTCELWMTASWREPKLAGKKNEEVK---WDNEWSPKISFSNSLLLDRVYKGRRLYYEENST-VPLAQEVYKIRGTFKEQFSLEQFPVDLQELSIIISSDWSDRTVTFEKDMAKPDYLRQQTFSSPRDWVLYPHVHTD--TATQEGEGLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLNTIAVAVE 286          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO26859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV8])

HSP 1 Score: 87.0409 bits (214), Expect = 9.831e-20
Identity = 50/137 (36.50%), Postives = 81/137 (59.12%), Query Frame = 3
Query: 1341 QTFVDQQEWKLHEHVEVTKRVVTQE---YTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIK 1742
            QTF   ++W L+ HV       TQE      + R +P   +T    RR  +++WN  +VM  +T LSFA+FA+P  +  +RL ++  L L SVA+KFV +  LPR SYLT++DKY L +L  +  I++ +++ + ++
Sbjct:   10 QTFSSPRDWVLYPHVH--TDTATQEGEGLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAIPPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAVLNTIAVAVE 144          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO40746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6G8])

HSP 1 Score: 61.6178 bits (148), Expect = 1.835e-10
Identity = 58/246 (23.58%), Postives = 111/246 (45.12%), Query Frame = 3
Query:  990 YHADAFIQSKWRESKLDNKPND--ELKAVDLDRCWNP-LLFIDNILNETKD------QYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAIL 1700
            +  D ++   W++ +     N    L  + +DR W P   F++++  E         + WL  +Q      +I+   +LK      ++L  +P+D+Q   + + S   D E D++ +  +  G ++  F+   E      V V +++    Y   SR    ++VT +  RR  Y+ + +++    I  LS+ +F V       R+ LS T  LT       +N +LPR+SYL  +D ++L+S   +
Sbjct:    1 FTMDIYLGQFWQDPRFAFGLNKTVSLGGLFVDRFWIPDTFFVNSVDTEIHKMISPNKKVWLNLDQG-----HIMLSTRLKSRATCKMDLRKYPMDLQTCHLALESFSFDEE-DLMYEWKKPVGSDV--FIYDAEMAQFTVVNVKRKLKHPLY--HSRRFSGMTVTFKFQRRTMYYIFQMYIPCVCIVALSWVSFWVDADAVPARVGLSITTVLTICYMLGSVNSNLPRVSYLKAIDYFLLLSFGFI 236          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 63.1586 bits (152), Expect = 2.160e-10
Identity = 62/272 (22.79%), Postives = 120/272 (44.12%), Query Frame = 3
Query:  954 LKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVD--LDRCWNPLLFIDNILNETKDQYWLTAEQNEK------GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSE-IDMVPDTVELSGINIQTFV-DQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFI 1739
            L I  I+ +   Y  D F++  WR+ +L ++ +D L   +  LD+ W P  +    +N    ++      N+       G  +   R  +K      L +  FP DVQ+  I I S    ++ +    +    +GI +   + D  ++ L + + V++        + S     L+ T R  RR GYF  +++     I  LS+ +F +P      R+ L  T  LT      ++N S+P++SY+  +D Y++     +  + + ++ V++I
Sbjct:   39 LSIDAINVIDMDYRMDFFLRQLWRDPRLKHRFDDTLALSNTMLDKIWVPDTYF---VNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRM--FPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKKIRDMPQYNLSD-INVSRHFTMYVAGNWSG----LTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLIGCFLFVFAVLLEYTFVLYI 300          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW63])

HSP 1 Score: 60.8474 bits (146), Expect = 6.970e-10
Identity = 60/262 (22.90%), Postives = 116/262 (44.27%), Query Frame = 3
Query:  984 EIYHADAFIQSKWRESKLDNKPND--ELKAVDL--DRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLET--------LELNDFPLDVQDLTITISSERPDS-EIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKY-------VLMSLAILCII 1709
            +I   + +I+  W++  L   P+D   +K++++  DR W P + +    N T  ++      N K +T +I        +L          +++  FP DVQ   +T  S   D  +ID+     + SGI+ + F D +EW L      + R   + Y      +P ++ T    RR  ++ +N+ L    I  LS  +F +P    E R+    T+ L    +  ++ +++PR + +  + K+       + +SLA  C++
Sbjct:   45 QILTINVWIRQYWKDHLLKWNPDDFGGIKSINIAPDRVWKPDVLL---YNRTDLRF---GSLNNKIDTNVIVNHDGSTTWLAPAIIKSECKIDVRFFPFDVQSCELTFGSWTHDGLKIDI--HLKQESGIDTENFSDNREWFLK---GTSGRRDVKMYICCPEPYPTVTYTIILRRRAMFYVFNMVLPTGVIALLSLFSFYLPPNSGE-RVSFVITVLLAMSVYLIMVTENIPRSTDIPLVSKFFMASMIQIALSLAATCVV 294          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:NCBI gene;Acc:101155813])

HSP 1 Score: 66.6254 bits (161), Expect = 4.660e-11
Identity = 65/253 (25.69%), Postives = 106/253 (41.90%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG +D +   Y  D F    W +S+L  K N  +K + L+     + W P  F  N  +   D +W+T           G      R  +       L+L++FP+D     +  SS   P +EI        VE++        DQ+ W+L++   V  R  +    + S  +  +++    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   88 IGPVDPINMEYTIDIFFAQTWYDSRL--KFNSSMKLLMLNSNMVGKIWIPDTFFRN--SRKSDAHWITTPNRLLRLWSNGRVMYTLRLTINAECY--LKLHNFPMDEHSCPLEFSSYGYPRNEIMYRWQRRAVEVA--------DQRYWRLYQFAFVGMRNTSDVAHTQSGEYVIMTIFFDLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYITAMDLFV 326          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:101168976])

HSP 1 Score: 66.2402 bits (160), Expect = 7.029e-11
Identity = 65/251 (25.90%), Postives = 107/251 (42.63%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+LN+FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  ++   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:   66 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPREEIVYRWKRSSVEVG--------DIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 304          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:101168976])

HSP 1 Score: 65.855 bits (159), Expect = 8.994e-11
Identity = 65/251 (25.90%), Postives = 107/251 (42.63%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+LN+FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  ++   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:  100 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPREEIVYRWKRSSVEVG--------DIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 338          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:101168976])

HSP 1 Score: 65.855 bits (159), Expect = 9.601e-11
Identity = 65/251 (25.90%), Postives = 107/251 (42.63%), Query Frame = 3
Query:  960 IGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLD-----RCWNPLLFIDNILNETKDQYWLTAEQNEK---GETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYV 1679
            IG ++ +   Y  D F    W + +L  K N  +K + L+     + W P  F  N  ++  D +W+T          +  I+   +L       L+LN+FP+D     +  SS   P  EI       +VE+         D + W+L++   V  R  ++   + S  +  L+V    SRR GYF    ++    I  LS+ +F +       R  L  T  LT      +  +SLP++SY+T MD +V
Sbjct:  100 IGPVNAINMEYTIDIFFAQTWYDRRL--KFNSTMKVLRLNSNMVGKIWIPDTFFRN--SKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPREEIVYRWKRSSVEVG--------DIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV 338          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Match: GABRG3 (gamma-aminobutyric acid receptor subunit gamma-3 [Source:NCBI gene;Acc:101170160])

HSP 1 Score: 65.0846 bits (157), Expect = 1.818e-10
Identity = 68/283 (24.03%), Postives = 119/283 (42.05%), Query Frame = 3
Query:  957 KIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFI-DNILNETK--DQYWLTAEQN-----EKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISS-ERPDSEI--DMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISI------WHSVVMFIKPPNM 1754
             IG + ++   Y  D      W +++L    +  ++ + L+     L+++ D I   +K  D +W+T           G+     R  +       L+L++FP+D     +  SS   P  EI      ++VE S        DQ+ W+L++   +  R  T   T+++  +  L+V    SRR GYF    ++       LS+ +F + +     R  L  T  LT      V   SLPR+SY+T MD +V +    +    I      ++S ++   PP M
Sbjct:   81 SIGPVSSIDMEYQIDIIFAQTWVDTRLRYN-SSSMRILTLNSNMVGLIWLPDTIFRNSKNADSHWITTPNQLLRIWNNGKILYTLRMTINAEC--QLQLHNFPMDEHSCPLVFSSYGYPRDEIIYKWKRNSVETS--------DQKYWRLYQFDFMGLRNTTDVLTTTAGDYVLLTVYFDLSRRMGYFTIQTYIPCILTVVLSWVSFWIKSDATPARTALGITTVLTMTTLSTVARNSLPRVSYVTAMDLFVTVCFLFVFAAMIEYAMLNYYSYIIRRPPPRM 352          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000012532.1 (SMESG000012532.1)

HSP 1 Score: 1129.78 bits (2921), Expect = 0.000e+0
Identity = 599/601 (99.67%), Postives = 601/601 (100.00%), Query Frame = 3
Query:  384 MDIKMNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNTMVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDXXXXXXXXXXXXXXXXXFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIKPPNMGITITTIKPITVQTPVNSDNNTSYKKLFEPXXXXXXXXXXXXSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEKNRLALELRITAKFQKKVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYK 2186
            MDIKMNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNT+VYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIKPPNMGITITTIKPITVQTPVNSDNNTSY+KLFEPNKNTLLKTILLKSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEKNRLALELRITAKFQKKVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYK
Sbjct:    1 MDIKMNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNTIVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIKPPNMGITITTIKPITVQTPVNSDNNTSYRKLFEPNKNTLLKTILLKSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEKNRLALELRITAKFQKKVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYK 601          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000012532.1 (SMESG000012532.1)

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 427/430 (99.30%), Postives = 429/430 (99.77%), Query Frame = 3
Query:  384 MDIKMNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNTMVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDXXXXXXXXXXXXXXXXXFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDK 1673
            MDIKMNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNT+VYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYM +
Sbjct:    1 MDIKMNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNTIVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMAR 430          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000012532.1 (SMESG000012532.1)

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 423/426 (99.30%), Postives = 425/426 (99.77%), Query Frame = 3
Query:  396 MNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNTMVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDXXXXXXXXXXXXXXXXXFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDK 1673
            MNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNT+VYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYM +
Sbjct:    1 MNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGKDSVDKLISALELLRINIDQNTIVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAKKNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMAR 426          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000008589.1 (SMESG000008589.1)

HSP 1 Score: 512.686 bits (1319), Expect = 2.330e-172
Identity = 292/624 (46.79%), Postives = 388/624 (62.18%), Query Frame = 3
Query:  402 FNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVS-NACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGK------DSVDKLISALELLRINIDQNTMVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAK-KNFDVLNHDXXXXXXXXXXXXXXXXXFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIKPPNMGITITTIKPITVQTPVNSDNNTSYKKLFEPXXXXXXXXXXXXSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEKNRLALELRITAKFQKKVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYKEWVKRNKEWVDNHNQQHSHGH 2249
             NK  ++ M  KR + +D YR  ++  DD   S + E N    R   + +  +D+++      SN   N  P G   N       +   V+      I K         D+LI A+E LR +I  NT ++       RS+  G+      RR  + Y ++S+ + +N  V+ +D   +++ +  V    V FLKIGEIDTLKE+YHADAFIQ+KWRE KLD   N+EL   D+D+ W+PLL+IDNIL+ETK+  WLTA  NE  E  +IERR++KGVFLETLELNDFPLDVQDLTIT+++ERPDSEID++PD  E+S INIQTFVDQQEWKLHEHVE+TKR++ QE++SS + HPCLSVTCRA+RRPGYFYWNVFL+MF I+GLSFATF+V   +AE RL+LSFTL LTSV FK+VI QSLP+ISYLTYMDKYVLMSLAILCI+SIWH+ V  +  P+  ++  T  PI+  + + +  N+SY K F+               M    N  + D   K                  E+   E   R+     I  K  +++ERD+ ISF  LY  AH +FI WLYFDAS+RRR M +KDR Y+E++++N+EW  N  ++    H
Sbjct:   22 INKHEVKWMPLKR-FKKDIYRAIDQDDDDSFISQAYELN----RKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTPTMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMH------CRSQQRGK-----TRRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIV-FLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV--PH--VSKVTNGPISNSSSIINRINSSYSKEFQKRLEEKSPF------MKSVINTVNNDNDKK-----------------DEVQEDETGERVLTPGEI--KLLRRIERDVLISFGCLYIIAHCIFIFWLYFDASRRRRLMRQKDRDYREFLQKNREWQQNTKKRRDQMH 599          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000008589.1 (SMESG000008589.1)

HSP 1 Score: 497.278 bits (1279), Expect = 1.447e-166
Identity = 286/604 (47.35%), Postives = 376/604 (62.25%), Query Frame = 3
Query:  402 FNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGRPNCEKTHPIDVNVVS-NACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYGSEIGK------DSVDKLISALELLRINIDQNTMVYDQKTNQTRSRFHGQRLHHHHRRNTAGYSDESEAK-KNFDVLNHDXXXXXXXXXXXXXXXXXFLKIGEIDTLKEIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKDQYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSERPDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSRCHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQLSFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVMFIKPPNMGITITTIKPITVQTPVNSDNNTSYKKLFEPXXXXXXXXXXXXSRMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEKNRLALELRITAKFQKKVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQYKE 2189
             NK  ++ M  KR + +D YR  ++  DD   S + E N    R   + +  +D+++      SN   N  P G   N       +   V+      I K         D+LI A+E LR +I  NT ++       RS+  G+      RR  + Y ++S+ + +N  V+ +D   +++ +  V    V FLKIGEIDTLKE+YHADAFIQ+KWRE KLD   N+EL   D+D+ W+PLL+IDNIL+ETK+  WLTA  NE  E  +IERR++KGVFLETLELNDFPLDVQDLTIT+++ERPDSEID++PD  E+S INIQTFVDQQEWKLHEHVE+TKR++ QE++SS + HPCLSVTCRA+RRPGYFYWNVFL+MF I+GLSFATF+V   +AE RL+LSFTL LTSV FK+VI QSLP+ISYLTYMDKYVLMSLAILCI+SIWH+ V  +  P+  ++  T  PI+  + + +  N+SY K F+               M    N  + D   K                  E+   E   R+     I  K  +++ERD+ ISF  LY  AH +FI WLYFDAS+RRR M +KDR Y++
Sbjct:   22 INKHEVKWMPLKR-FKKDIYRAIDQDDDDSFISQAYELN----RKQSDLSELVDIDIYELEGLSNKSHNRNPNGTILNESPLTPTMRRTVNSASREAINKAEYSTISPADRLIEAIESLRYSIQDNTQMH------CRSQQRGKT-----RRRMSTYGNKSQGRGENHSVIGNDNLKLRKDKVAVELRIV-FLKIGEIDTLKELYHADAFIQAKWREPKLDGHTNEELATTDMDKYWSPLLYIDNILSETKEAQWLTAVANESLEVTVIERRRIKGVFLETLELNDFPLDVQDLTITMTTERPDSEIDLIPDQTEMSAINIQTFVDQQEWKLHEHVEITKRIILQEFSSSMKSHPCLSVTCRAARRPGYFYWNVFLIMFMISGLSFATFSVSPEKAEYRLRLSFTLVLTSVTFKYVITQSLPKISYLTYMDKYVLMSLAILCIVSIWHACVTLV--PH--VSKVTNGPISNSSSIINRINSSYSKEFQKRLEEKSPF------MKSVINTVNNDNDKK-----------------DEVQEDETGERVLTPGEI--KLLRRIERDVLISFGCLYIIAHCIFIFWLYFDASRRRRLMRQKDRDYRK 579          
The following BLAST results are available for this feature:
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRG31.190e-1124.21gamma-aminobutyric acid type A receptor gamma3 sub... [more]
GABRG21.680e-1125.09gamma-aminobutyric acid type A receptor gamma2 sub... [more]
GABRG21.940e-1125.00gamma-aminobutyric acid type A receptor gamma2 sub... [more]
GABRG22.128e-1125.19gamma-aminobutyric acid type A receptor gamma2 sub... [more]
GABRG22.482e-1125.09gamma-aminobutyric acid type A receptor gamma2 sub... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lgc-469.463e-824.62Probable ligand-gated ion channel 46 [Source:UniP... [more]
gab-13.282e-723.33Gamma-aminobutyric acid receptor subunit beta [So... [more]
deg-34.388e-722.61Acetylcholine receptor subunit alpha-type deg-3 [... [more]
deg-34.388e-722.61Acetylcholine receptor subunit alpha-type deg-3 [... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lcch31.884e-622.43gene:FBgn0010240 transcript:FBtr0074129[more]
CG89165.395e-623.19gene:FBgn0030707 transcript:FBtr0301233[more]
CG89165.648e-623.19gene:FBgn0030707 transcript:FBtr0301232[more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrg12.888e-1125.69gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg13.821e-1125.69gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg24.556e-1125.90gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
gabrg29.587e-1125.90gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
gabrg21.088e-1025.90gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRG29.672e-1225.69gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
GABRG29.724e-1225.69gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
ccdc1342.100e-1024.21coiled-coil domain containing 134 [Source:Xenbase;... [more]
GABRG22.997e-1025.93gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
GABRG23.749e-1025.93gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabrg38.310e-1324.60gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrg21.205e-1124.91gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrg21.802e-1125.00gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrg22.022e-1125.00gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrg15.951e-1024.90gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27681|GBRG3_MOUSE5.813e-1224.60Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|P28473|GBRG3_RAT5.916e-1224.60Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|Q99928|GBRG3_HUMAN5.716e-1124.21Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
sp|P34904|GBRG4_CHICK9.269e-1125.30Gamma-aminobutyric acid receptor subunit gamma-4 O... [more]
sp|P22300|GBRG2_BOVIN1.080e-1025.00Gamma-aminobutyric acid receptor subunit gamma-2 O... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LIX34.461e-16859.08Neur_chan_LBD domain-containing protein OS=Opistho... [more]
A0A4S2LQ235.419e-16859.44Neur_chan_LBD domain-containing protein OS=Opistho... [more]
A0A5K4FB253.279e-16558.45Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5J4NW136.168e-16557.43Neur_chan_LBD domain-containing protein OS=Paragon... [more]
G7Y8301.768e-15956.86Gamma-aminobutyric acid receptor subunit gamma-3 O... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrg11.018e-1125.50gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg21.506e-1025.79gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg21.550e-1024.91gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg21.724e-1025.79gamma-aminobutyric acid type A receptor gamma2 sub... [more]
GABRG35.284e-1024.30gamma-aminobutyric acid type A receptor gamma3 sub... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
glra23.995e-722.34glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000002305.13.305e-621.12pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 g... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327906.619e-3632.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268599.831e-2036.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407461.835e-1023.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375552.160e-1022.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320536.970e-1022.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrg14.660e-1125.69gamma-aminobutyric acid type A receptor gamma1 sub... [more]
gabrg27.029e-1125.90gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg28.994e-1125.90gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg29.601e-1125.90gamma-aminobutyric acid type A receptor gamma2 sub... [more]
GABRG31.818e-1024.03gamma-aminobutyric acid receptor subunit gamma-3 [... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012532.10.000e+099.67SMESG000012532.1[more]
SMESG000012532.10.000e+099.30SMESG000012532.1[more]
SMESG000012532.10.000e+099.30SMESG000012532.1[more]
SMESG000008589.12.330e-17246.79SMESG000008589.1[more]
SMESG000008589.11.447e-16647.35SMESG000008589.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015290 ID=SMED30015290|Name=Neur_chan_LBD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2595bp
GAACAAATTAGAGATAGCGTTAATCTGTGTTTGATTTTTTTTTGAATTCA
TAAAAAATAACTCTTAAAAAGATATATCCAGTGAACATTTTCTCCTGTCC
AGAACCACAAAGGGATACACAAAATTGATCATGTTGAGTCAATAGGAAAA
ACATTTTCTAACACTGGAAATTCGATTTTTTCAATCATTGTTTCAATTGA
TTAAAACATTTCCCGCGTTGTTTAAATTAACTGAAATTGTAAGCTGTATT
AATTGAAAAATTCGGCCGTGAATTGAATTGTTTTTTATTCGAACTTTATC
AAAACCAATATGTTCTCTCAAGTATAACAATATATATTTATATATATAAA
TATATATAAATATATAAATATTATAAAATATTCATGGATATTAAAATGAA
TTTCAACAAAATCCTCATTCAAGACATGGTTAACAAACGCGATTACAATC
AAGATACTTACCGAACAACGAACGAAGTATCCGATGATGATGACACTTCC
TGTTCGGATGAGTTTAACAATAGAAACGGAAGACCGAACTGTGAAAAGAC
TCATCCGATTGATGTCAATGTCGTTTCGAATGCATGCTCAAATCTGTTGA
AAAACTACCAACCGTTTGGTGACAACAACAATTTCATTTATGCCGATTCA
CAGATCTTTGATCATGTCGATCAGAATTACGGATCAGAAATCGGAAAGGA
CAGCGTCGACAAGTTGATATCGGCTTTAGAATTGTTGCGGATAAATATCG
ACCAAAATACAATGGTTTACGATCAAAAAACCAACCAAACCCGTTCTAGG
TTTCATGGACAGCGTTTGCATCATCATCATCGTCGAAATACGGCTGGCTA
TTCCGATGAATCTGAAGCTAAAAAAAACTTCGATGTTTTAAATCACGACG
AAAGAATGATGAAAAGAAAAGAAAAAGTTGTCGTAGAAGTTCGAGTTGTT
TTTCTGAAAATCGGAGAAATCGACACATTGAAAGAAATATATCATGCTGA
TGCCTTCATCCAGTCCAAATGGAGAGAATCAAAATTGGACAATAAACCTA
ATGACGAGCTCAAGGCAGTTGATTTGGATCGTTGTTGGAATCCTTTATTA
TTTATTGACAACATTCTAAACGAAACAAAAGATCAGTATTGGCTAACAGC
AGAACAAAATGAAAAAGGAGAAACTTATATTATAGAAAGAAGGAAACTAA
AAGGTGTATTTTTAGAAACCCTAGAACTTAATGACTTCCCATTAGATGTT
CAGGATCTAACTATAACCATTTCTTCAGAACGACCTGATTCTGAAATAGA
TATGGTTCCAGATACAGTAGAGCTCAGCGGAATCAATATACAGACATTTG
TAGACCAACAGGAATGGAAATTGCATGAACACGTAGAAGTTACAAAACGA
GTAGTCACTCAGGAATATACTAGCTCCAGTCGATGTCACCCATGTCTTTC
AGTAACATGTAGGGCTTCACGAAGACCTGGTTATTTTTACTGGAATGTAT
TTTTAGTTATGTTTTTCATTACTGGTTTGTCTTTTGCTACATTCGCAGTG
CCTACAGGACGAGCAGAAAATCGGCTGCAGTTATCCTTTACTCTATTCCT
TACTTCAGTGGCATTCAAGTTTGTGATAAATCAGTCATTGCCTCGAATTT
CATATCTTACATATATGGATAAATATGTGCTCATGTCATTGGCTATTTTA
TGCATTATTAGTATTTGGCATTCTGTTGTAATGTTTATCAAGCCGCCAAA
CATGGGTATCACAATAACCACAATAAAGCCAATCACAGTTCAGACACCAG
TTAACAGTGACAACAATACATCATACAAAAAACTTTTTGAACCTAACAAA
AATACTCTACTTAAAACAATATTACTCAAATCAAGGATGAACCCAAGTTT
TAACAAACGTTCAACCGACAAATCTAATAAACTTTTACTCACTGAAGCAA
AACACATTCCAATTGTTGCTAGATCAAAATCAACCGAGCTGCCTATTTCA
GAAGAAAAGAACCGATTGGCATTAGAACTGAGAATCACTGCAAAATTTCA
AAAAAAAGTAGAGCGAGATATTTTCATATCTTTTGTAATGCTCTATTTCT
TTGCTCACTTTATGTTTATACTTTGGCTCTATTTTGATGCAAGTAAGAGA
AGAAGAGAAATGATAGAAAAGGATCGCCAATATAAGGAATGGGTAAAGCG
TAATAAGGAATGGGTAGATAACCATAACCAGCAACATTCCCATGGTCACA
GAAATAGCAACATTTTAATGAATAGAGTGTAGATTCTATCCGTAAAGGTT
TAGTGATAAATCTATAAAACTAGTTCATTTTGCATGTGATCAAGAAATAG
AAATCAGATTTTATTCCTGTGTAACTATCAATTAAAATTACACTATAAAT
CATGTCGGTAATTCTATTCAAACCATTTAATTAAATAATAATTAAATCAA
TTGTTTAATTAAAACTATCTTTTTTCAATTTATACCCTCATTTATTGACA
ATTACTTTATTAGATATGATTTATAAATTTGACGTTTTTATTTTCTACTA
TGCTCTTCCTTGATTAACTATTTGTAGTTTAATATCCTTTATGTG
back to top

protein sequence of SMED30015290-orf-1

>SMED30015290-orf-1 ID=SMED30015290-orf-1|Name=SMED30015290-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=633bp
MDIKMNFNKILIQDMVNKRDYNQDTYRTTNEVSDDDDTSCSDEFNNRNGR
PNCEKTHPIDVNVVSNACSNLLKNYQPFGDNNNFIYADSQIFDHVDQNYG
SEIGKDSVDKLISALELLRINIDQNTMVYDQKTNQTRSRFHGQRLHHHHR
RNTAGYSDESEAKKNFDVLNHDERMMKRKEKVVVEVRVVFLKIGEIDTLK
EIYHADAFIQSKWRESKLDNKPNDELKAVDLDRCWNPLLFIDNILNETKD
QYWLTAEQNEKGETYIIERRKLKGVFLETLELNDFPLDVQDLTITISSER
PDSEIDMVPDTVELSGINIQTFVDQQEWKLHEHVEVTKRVVTQEYTSSSR
CHPCLSVTCRASRRPGYFYWNVFLVMFFITGLSFATFAVPTGRAENRLQL
SFTLFLTSVAFKFVINQSLPRISYLTYMDKYVLMSLAILCIISIWHSVVM
FIKPPNMGITITTIKPITVQTPVNSDNNTSYKKLFEPNKNTLLKTILLKS
RMNPSFNKRSTDKSNKLLLTEAKHIPIVARSKSTELPISEEKNRLALELR
ITAKFQKKVERDIFISFVMLYFFAHFMFILWLYFDASKRRREMIEKDRQY
KEWVKRNKEWVDNHNQQHSHGHRNSNILMNRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR036719Neuro-gated_channel_TM_sf
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 365..471
e-value: 3.2E-20
score: 74.3
NoneNo IPR availablePANTHERPTHR18945:SF768coord: 170..471
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 190..364
e-value: 1.17661E-12
score: 64.6214
NoneNo IPR availableCDDcd19050LGIC_TM_bactcoord: 367..452
e-value: 6.53743E-22
score: 89.1898
NoneNo IPR availableTMHMMTMhelixcoord: 398..420
NoneNo IPR availableTMHMMTMhelixcoord: 366..388
NoneNo IPR availableTMHMMTMhelixcoord: 562..584
NoneNo IPR availableTMHMMTMhelixcoord: 432..449
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 173..362
e-value: 4.8E-19
score: 70.6
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 179..364
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 171..356
e-value: 5.8E-11
score: 42.2
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 170..471
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 365..583