Protocadherin-11 X-linked

Overview
NameProtocadherin-11 X-linked
Smed IDSMED30015288
Length (bp)2657
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-11 X-linked (SMED30015288) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30015288) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-11 X-linked (SMED30015288) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30015288) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015288

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015288h1SMcG0014158 SmedASXL_004120SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015288h1SMcG0014158 SmedASXL_005068SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30015288h1SMcG0014158 dd_Smed_v4_28547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015288h1SMcG0014158 dd_Smed_v4_28547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015288h1SMcG0014158 dd_Smed_v4_28547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015288h1SMcG0014158 dd_Smed_v6_28547_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 211.846 bits (538), Expect = 3.410e-56
Identity = 225/853 (26.38%), Postives = 382/853 (44.78%), Query Frame = 1
Query:   19 VLLLVNFYFLASKS--MLKFKVDEGVQVGTEIADLTSDF---KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMP---SGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVS--------LLTAFITGSILLYLKI 2478
            +L+ V F+  A +    ++ ++ E V +G  + DL       K+L  T +F  V    D  V    I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  +++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF +      D E   ++ + +   D       +N++ ++     ++    P     ++  ++P   S  I   K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P + ++     L  P   P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL  +  +    L N    K I       T I  VS        +L A + G+I + + I
Sbjct:   45 LLVCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGD--VPLIRIEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLENAAYLDYESTKEYAIKLLAADAGKPP--LNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSY---ELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVI 860          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 211.846 bits (538), Expect = 4.083e-56
Identity = 225/853 (26.38%), Postives = 382/853 (44.78%), Query Frame = 1
Query:   19 VLLLVNFYFLASKS--MLKFKVDEGVQVGTEIADLTSDF---KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMP---SGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVS--------LLTAFITGSILLYLKI 2478
            +L+ V F+  A +    ++ ++ E V +G  + DL       K+L  T +F  V    D  V    I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  +++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF +      D E   ++ + +   D       +N++ ++     ++    P     ++  ++P   S  I   K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P + ++     L  P   P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL  +  +    L N    K I       T I  VS        +L A + G+I + + I
Sbjct:   34 LLVCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGD--VPLIRIEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLENAAYLDYESTKEYAIKLLAADAGKPP--LNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSY---ELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVI 849          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 211.846 bits (538), Expect = 4.083e-56
Identity = 225/853 (26.38%), Postives = 382/853 (44.78%), Query Frame = 1
Query:   19 VLLLVNFYFLASKS--MLKFKVDEGVQVGTEIADLTSDF---KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMP---SGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVS--------LLTAFITGSILLYLKI 2478
            +L+ V F+  A +    ++ ++ E V +G  + DL       K+L  T +F  V    D  V    I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  +++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF +      D E   ++ + +   D       +N++ ++     ++    P     ++  ++P   S  I   K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P + ++     L  P   P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL  +  +    L N    K I       T I  VS        +L A + G+I + + I
Sbjct:   34 LLVCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGD--VPLIRIEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLENAAYLDYESTKEYAIKLLAADAGKPP--LNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSY---ELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVI 849          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 211.46 bits (537), Expect = 4.996e-56
Identity = 225/853 (26.38%), Postives = 382/853 (44.78%), Query Frame = 1
Query:   19 VLLLVNFYFLASKS--MLKFKVDEGVQVGTEIADLTSDF---KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMP---SGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVS--------LLTAFITGSILLYLKI 2478
            +L+ V F+  A +    ++ ++ E V +G  + DL       K+L  T +F  V    D  V    I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  +++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF +      D E   ++ + +   D       +N++ ++     ++    P     ++  ++P   S  I   K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P + ++     L  P   P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL  +  +    L N    K I       T I  VS        +L A + G+I + + I
Sbjct:   45 LLVCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGD--VPLIRIEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLENAAYLDYESTKEYAIKLLAADAGKPP--LNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSY---ELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVI 860          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 209.149 bits (531), Expect = 3.215e-55
Identity = 225/834 (26.98%), Postives = 377/834 (45.20%), Query Frame = 1
Query:   64 LKFKVDEGVQVGTEIADLT-SDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNL------TSDYPINTHVLENTKKEKKIFTAFWILTSIIT--VSLLTAFITGSILLYLKI 2478
            ++ ++ E V +G  + DL  S   N  +TT     L  +   V    I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  +++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF + T    D E   ++ + +   D A         +L +   D +      + +F    + EN   G  LT K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P    +  +  L  P   P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL      T+   IN  V ++T+      T    ++S  +  V +L A + G+I + + I
Sbjct:   30 IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLETAAYLDYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT-KVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVP---PSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVI 828          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 150.984 bits (380), Expect = 1.056e-36
Identity = 196/721 (27.18%), Postives = 321/721 (44.52%), Query Frame = 1
Query:  214 SGILRLITLKNIDREV-------ICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPT--AIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRI-DSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQF-------QIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXX--XXSLNFYLYENMPSGT-ILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKIN--THEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSH---KIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            SG +RL   K++DREV       +  YE+         +D  I    ++ +H     V+D  DN P +  DS   E  + D P I  T+ +  A DLDS     I Y+L +      L   A +  IQ +  LD ET S   L + AS+ G   R S+ ++++T+VD+NDN P+F+    S N  I E+I I +V+  + ATD D G NG+  + +  S+ I    I+Y      TGE+ +R+ +D     +N     ++        +LSS   + + V D+ND  P +    I   K+     + EN      VG +   D D   N            +  SM   E F        I TT + DRE   ++ + +   D        + T+ ++  + ND          N  + E MP G+ I+T  L++ D D D   ++ Y + EA  + F I     +G ++S+    + +   + + +   D+G ++   +  +++ I D++  P  F    F   I E+S I   V +++A D D      IVYSI    +   F ID  SG ++ +S LDRE    + + V A D   P     ++       +E+ +DD NDN      P FT +   A++ +  P   S  Q+ + D+D G N  + Y +    S    ++F++ RTSG + +   +S LD E F+  V+ +   D G
Sbjct:  219 SGEIRLA--KSMDREVLDKHILKVTAYER---------VDPTISASTTVVVH-----VLDVQDNSPIFEKDSYFGEIRE-DAP-IGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASD--SYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY-----STGEVTLRERID----AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL----IAAQKM---ITLEENVAIGEEVGRVYAIDEDSGPNG----------IIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT--LKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQ--GRCVVNVFIDDVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQ-------IEVILDDINDN-----SPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRV---SSKLDREQFAVIVLPIFARDRG 868          

HSP 2 Score: 110.153 bits (274), Expect = 3.517e-24
Identity = 175/691 (25.33%), Postives = 302/691 (43.70%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAI----EYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDE-VFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYH-MNYINKTLLILXXXXXXXXX-XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD----FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFS---GVLT--TNSYLDRE-KVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFP-----VIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKT-GNSNLDVEYFSTHVIKLKVCDS-GNQPKCTVFHPLYVNLTSDY 2340
            + I VID ND+ P   +    +   +    G       AID DS     I Y++     F   +   D+  I+ + +LD ETT++++L + A + G    ++S  I V + DINDN P F K  +  N  I E++P  S ++ L A D D   + + ++RI+       +I    +   + SV+GE+   K  D+         KV VE  A     L     VN+ + DVN         A   N       + E++P    V  +   D D  +N   V+    + FF ++  S      I  +   DRE +    V +  +D A   +N   +  +ILDD +++       S    + E++P GT    ++ + D DI  N  V Y+L+E+S+      F+++   GTL      DRE+ + + L ++  D G    S+   I + + D++DN   F +  +  +I+ENS + + VG++ A D DE     I + I    +  +F I++ +   GV+   T +  D E K +++F ++          +A S    S   V I + D NDN P     VI+   F + ++         + I  I + D D  +N TL Y +E  D   + +  + +G + +K     N+DV +        K C S G   +C+    ++V +  ++
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF---IIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEY--NVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDH---------KVRVEISATDQGGLQGRCVVNVFIDDVNS--------APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSG----DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-QVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFEL----------QASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQM--------ARQIGFIPAFDPD--QNATLEYFLEEND---LIEAEKYTGKILVKQEWKRNMDVSF--------KTCVSDGANTECSTCRFIHVLVEPEW 1092          

HSP 3 Score: 91.6633 bits (226), Expect = 2.050e-18
Identity = 101/376 (26.86%), Postives = 168/376 (44.68%), Query Frame = 1
Query: 1183 RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY--LYENMPSGTILTGKLRSFDKDIDN--NSQVHYYLHEASNKDF-KINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPN-FTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            RS N  F L++MS     +I      DRE  DKH + +   ++       + T+++   +  D     +  +++  + E+ P GT +   L  F +D+D+  N ++ Y L E + K+   IN   G + +    DRE  S + L V   D+G  KR S   + I ++D++DN  VF  D +   I EN  I  V+ +V+A D D  T   + YS+ +        ID  +G +T      RE++D     + A    I  ++       S   + I + D ND+ P +I          N ++ +     + ++Y+ D DSG N  + Y ME  +    F I   SGL+  KT    LD E  + + +K+   D G
Sbjct:  208 RSQN-LFTLDTMSG----EIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTV---LSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTL-----RERIDAKNSPITAV---IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGE----EVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLI--KT-TKLLDRETTARYSLKVTARDMG 557          

HSP 4 Score: 68.1662 bits (165), Expect = 2.804e-11
Identity = 48/182 (26.37%), Postives = 89/182 (48.90%), Query Frame = 1
Query: 1675 DDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDY---IFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPN---FTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLV 2202
            D N + F ++K+V  + E++ I T++ SV+A       + YS++ P++     +F +D  SG +     +DRE +D++ +KV A++   P   A +        V + + D  DN P  IF     F   R +A    P   ++  +++ D DSGEN  + Y +   +   +  I+  SG++
Sbjct:  159 DANAVHFQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTT-------VVVHVLDVQDNSP--IFEKDSYFGEIREDA----PIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVI 327          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 119.783 bits (299), Expect = 4.215e-27
Identity = 147/562 (26.16%), Postives = 251/562 (44.66%), Query Frame = 1
Query:  661 LIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRI-DSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQF-------QIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXX--XXSLNFYLYENMPSGT-ILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKIN--THEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSH---KIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            ++++T+VD+NDN P+F+    S N  I E+I I +V+  + ATD D G NG+  + +  S+ I    I+Y      TGE+ +R+ +D     +N     ++        +LSS   + + V D+ND  P +    I   K+     + EN      VG +   D D   N            +  SM   E F        I TT + DRE   ++ + +   D        + T+ ++  + ND          N  + E MP G+ I+T  L++ D D D   ++ Y + EA  + F I     +G ++S+    + +   + + +   D+G ++   +  +++ I D++  P  F    F   I E+S I   V +++A D D      IVYSI    +   F ID  SG ++ +S LDRE    + + V A D   P     ++       +E+ +DD NDN      P FT +   A++ +  P   S  Q+ + D+D G N  + Y +    S    ++F++ RTSG + +   +S LD E F+  V+ +   D G
Sbjct:    1 MVEITVVDVNDNAPVFASD--SYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY-----STGEVTLRERID----AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL----IAAQKM---ITLEENVAIGEEVGRVYAIDEDSGPNG----------IIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT--LKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQ--GRCVVNVFIDDVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQ-------IEVILDDINDN-----SPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRV---SSKLDREQFAVIVLPIFARDRG 509          

HSP 2 Score: 111.694 bits (278), Expect = 1.159e-24
Identity = 155/628 (24.68%), Postives = 281/628 (44.75%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDG-DLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYA---SNPGIDRSSSLLIQVTIVDINDNPP--LFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNS-FFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSG-TILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIVYSILNPKND----YIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLF----QPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKI 2181
            ++I V+D NDN P + SDS NV  ++   +P +  T+  A D D      + Y+++  +    L        +     +D++  S  T  + A   + P +  SS++ + + ++DIND+ P  + ++ + +    + E++ I   V  + A D DSG NG   + ++ +       E FI+   +G I   K LD +   R +  KV   D    P SL++   + + + D+ND  P  D       K      + E  P+ + +  I    VD +E+ ++  R   +   V + +   +Q  I +     + Q  K  V I  TDQ          + I DD ++ PYF     +  + E+ P G  ++T  L++ D D  +N+++ Y +   S++ F+I+   G +      DRE+R++ ++ V   D  +   ++   I +++ D++DN   FT   +   ISE+  + T    V A+D D   N IV   LN  +      +F +D+ SG L  +S LDRE+     + + A D   P   A S+       + + + D NDN P       T  +L+  L+     P   ++  I + D+D G+N  + + +      K+F I
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATV-KATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPAL--SSTVPLTINVIDINDHAPTLIAAQKMIT----LEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS-------EDFIIDEDSGLIKTTKLLDRETTAR-YSLKVTARDMG-TP-SLNTSTTIAVVLKDINDNAPTFD-------KKEYNVTISEEMPRGSQI--ITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFI-DDVNSAPYFNDHPFSVKIPEHSPIGYPVIT--LKAEDHDRGDNARIVYSID--SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASE-------ITLTLSDVNDNAP-------TFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDI 583          

HSP 3 Score: 109.768 bits (273), Expect = 4.535e-24
Identity = 175/691 (25.33%), Postives = 302/691 (43.70%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAI----EYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDE-VFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYH-MNYINKTLLILXXXXXXXXX-XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD----FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFS---GV--LTTNSYLDRE-KVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFP-----VIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKT-GNSNLDVEYFSTHVIKLKVCDS-GNQPKCTVFHPLYVNLTSDY 2340
            + I VID ND+ P   +    +   +    G       AID DS     I Y++     F   +   D+  I+ + +LD ETT++++L + A + G    ++S  I V + DINDN P F K  +  N  I E++P  S ++ L A D D   + + ++RI+       +I    +   + SV+GE+   K  D+         KV VE  A     L     VN+ + DVN         A   N       + E++P    V  +   D D  +N   V+    + FF ++  S      I  +   DRE +    V +  +D A   +N   +  +ILDD +++       S    + E++P GT    ++ + D DI  N  V Y+L+E+S+      F+++   GTL      DRE+ + + L ++  D G    S+   I + + D++DN   F +  +  +I+ENS + + VG++ A D DE     I + I    +  +F I++ +   GV  + T +  D E K +++F ++          +A S    S   V I + D NDN P     VI+   F + ++         + I  I + D D  +N TL Y +E  D   + +  + +G + +K     N+DV +        K C S G   +C+    ++V +  ++
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF---IIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEY--NVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDH---------KVRVEISATDQGGLQGRCVVNVFIDDVNS--------APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSG----DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-QVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFEL----------QASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQM--------ARQIGFIPAFDPD--QNATLEYFLEEND---LIEAEKYTGKILVKQEWKRNMDVSF--------KTCVSDGANTECSTCRFIHVLVEPEW 733          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 111.694 bits (278), Expect = 1.306e-24
Identity = 177/737 (24.02%), Postives = 297/737 (40.30%), Query Frame = 1
Query:   55 KSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYE--KNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLM----LDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKI---NNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTV---IFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK 2211
            + + KF V E  Q+GT I  ++   +       FV   +++  K     +K D     + T+ ++D E   +++    K+   G  IDI +             EV D NDN P +    + +E  +    G    +PT  D D   F    + +   +    FKL     N  +Q  L+    LD E   K+ L + A + G   +   L   + I+D NDN P+FS+  ++ +  +  +I I S ++ + ATD D G N   S+ I        +N AI    + + T  ++     D           V+  DH     SLSS A V +TV       P +D   +     SN   ++EN+   ++V  +        +  +   R + S  +    +  +Q  +Y  +   I DRE   +H +          +    + L I D NDN P +    ++  L         LT K    D D+  N  + Y + +   +   I+   G +    + D    S +   V  ED G+   S+   +   +LD +  P  F K  +   I E++ I T +  V A +    +   I YS+ N   D    +D  SG +      D EK   Y   V+A ++N         +  S +L+ I++ D NDN+P I +PN  H  L       PE+ +  + ++D DSG    + Y + +E S   F I+  +G VF +
Sbjct:   24 QCLTKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKF----LKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGETIDILV-------------EVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTAS--VSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHD---------VIVVASDHGS--PSLSSSAVVTITVLGSTLSSPPLDIIWLVE---SNSAHLMENSTLGSIVARVSIA----QQYRDTKLRLIGSSALCPQQT--DQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRTLTAK----DPDLGQNGWIRYSVLD--TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN--QDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNAN---------SETSTSLISIRLKDVNDNWP-IFYPNEYH--LTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS--FSINPVTGEVFAQ 699          

HSP 2 Score: 108.227 bits (269), Expect = 1.370e-23
Identity = 170/623 (27.29%), Postives = 265/623 (42.54%), Query Frame = 1
Query:  499 IFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLF---SKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDF--YAIQNNK-ISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKL-------RSFDKDIDNNSQVHYYL---HEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVD---LDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFH 2310
            I Y+L +      +   +  + IQ +   D E    +   + A+N   + S+SL I + + D+NDN P+F      L  R  P PE+      +LV+SA+D DSG  GE S+ I S   +      F +  VTGE+  +KPL   R      F ++V        S  + A +++TV D + + PQ     Y I+  + I    A+      + +   I + D D N             F ++     +  +IY T   D +  D   ++I+ T  +   N     + I D NDN P F    +   + E++        KL       ++ DKD   N +V Y +   H  S+   +I+   G L +    D E   +  L V   D G   RSS   + I +LD++DN   F K  +   + ENS   T+VG V A D   L+   IVY I N  ++Y F ID+  G + T   +DRE +    I +VA D  +P          S A   I + D NDN P  +  + T   + A    P   +I  I + D D G N +++Y  + + S  + K   ++G V+L+   +  D  +    VI   V D G   K  V H
Sbjct:  575 IRYSLQNQDEHLTVDTMSGTVCIQKTF--DFEKQKSYQTTVIATNANSETSTSL-ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEE-----PLLVVSASDMDSGTFGEVSYHILSESSS------FSINPVTGEVFAQKPLARGR------FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHN-------------FSID----EDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDL--------KLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSS--IEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN-GSEY-FGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVP-------PRSSTASARISVLDVNDNPPSCL--SITPIVVPAG--SPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVK---SNGDVYLRRQLNASDERHQRLSVI---VSDQGVPRKSVVCH 1131          

HSP 3 Score: 91.6633 bits (226), Expect = 1.765e-18
Identity = 126/485 (25.98%), Postives = 209/485 (43.09%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSS-SLLIQVTIVDINDNPPLFSKPLFS--RNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQF--QIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI--LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN 1785
            I I + D NDN P +  +  ++   +G  P     + +A D+DS  F  + Y++   +  F +      ++ Q  L        +F L + A + G   S  S  I +T++D +   P FS+  +     E I   I I SV           G   +  + I S   ++     F +   TG+I V + LD D         V++   A LP   S++  V + + D ND  PQ     +       + ++ E+   +     +  +D D  +N EV    ++S     S    +QF  Q+ T  + D E    + + ++ TD        N TL I  LD NDN P F        + EN P  TI+ GK+ + DKD   N Q+ Y +   S   F I+   G + + RS DRE  S +++++  ED+G   RSS     I +LD++DNP        +  +   S ++T +G++ A+D D+ 
Sbjct:  627 ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPL-----ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-----------GAMSKVKYSIYSGDQDHN----FSIDEDTGKIYVTRYLDAD-----VHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLV-------EISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSH--PGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIV-GKVVARDKDSLENGQIVYRITNGSEY-FGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIV-VPAGSPLSTAIGTIVAMDPDKG 1074          

HSP 4 Score: 77.411 bits (189), Expect = 4.124e-14
Identity = 71/278 (25.54%), Postives = 123/278 (44.24%), Query Frame = 1
Query:  358 IEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPP--LFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVN----------DEIPQ---------------IDFYAIQNNKISNQFAVLEN 1107
            I V+D NDN P +      +E ++   P        A D DS     I Y +++ + +F + E   N+Y + S  +D E  S   + + A + G+  RSS+   +++++D+NDNPP  L   P+      +P   P+++ +  + A D D GLNG   +R             F++KS  G++ +R+ L+     R+    VIV D      S+     V ++ G  +           EIP+               +  + IQ+++ISN FA+ E 
Sbjct:  930 IHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRS--IDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIV-----VPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQS------SLFVVKS-NGDVYLRRQLNAS-DERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEPFQKYIEIPKSCPTGCRLTTLNATGVSSWLIQSSEISNHFAIREG 1192          

HSP 5 Score: 67.3958 bits (163), Expect = 4.737e-11
Identity = 122/491 (24.85%), Postives = 203/491 (41.34%), Query Frame = 1
Query:  880 SVTGEIVVRKPLDYDRG-MRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTR------EQFQ--IYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDK----DIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMD--DNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGN-SNLDVEYFSTHVIKLKVCDSGNQPKCTV 2304
            SV  E V+R  L+ DR  +  +  KVI          + +   V++ V ++ND +P           +S    V EN    + V  +   DVD           L  F V +S          +QF   I+ T   D E   +H ++I+ TD ++   + N T+ +     +D      + +  LY+   S    +   + F K    D+D    + Y L + S+  F++    G L         ER    +TV   D G    S+   + ++I + +  D P  F K +F F + ENS I   +G++   +  E    Y I +P+   IF IDKF G L     +DRE+   +  +V        I+  M  + K      + + DENDN PV     + +  L  S+     + I QI ++D DSGEN  + Y + + +   I  ++  +G + L   N + LD    +T  I ++  D G+  +  V
Sbjct: 1875 SVDSEGVIRTNLELDREILERYSLKVIGTGSG---QQIGTR--VDVRVNNLNDNVPSF--------PMSKPRRVPENLRVGSYVATVGAKDVDN-------LAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFD-TFTNLTIFV-----SDINDNAPTFSKPLYQTTVSPATFSPG-QPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGER--YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKP-GFEKAEFRFEVMENSKIGLQIGNLSGEESRE--FHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQV-------EIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAY-YLSLKDSMAH--GQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAV 2322          

HSP 6 Score: 62.003 bits (149), Expect = 2.403e-9
Identity = 105/507 (20.71%), Postives = 205/507 (40.43%), Query Frame = 1
Query:  565 IQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLT--VGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDR---EQQDKHFVSIECTD---QAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEA-SNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSILNPKNDYIFLIDKFSGVLTTNSY----LDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNF 2037
            I+ +L LD E   +++L +  +  G  +     + V + ++NDN P F     S+   +PE++ + S V  + A D D+     +    DS+    +   +F +   TG I +  PLD++  +      +   D +F       + F NLT  V D+ND  P       Q       F+  +   K      I  +D+D         R   ++ +    S+  +    +  +F +      +++ V++  TD    ++  +     ++   +  + P F      F + EN   G +  G L       + + + HY + +  ++K F I+   G L      DRE+R++    V +++E    +  +   H+++LD +DN  VFT   +   + ++      +G + A D D      + Y IL+  +  I  ++  +G +  N +    LD      + I V A D   P   A+ K       V +K+   + + P  + P +
Sbjct: 1882 IRTNLELDREILERYSLKVIGTGSG--QQIGTRVDVRVNNLNDNVPSFP---MSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSS---GQTPTHFNIDQFTGTIHLTAPLDFEV-LPEHTLTIKATDGSF-------DTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAK------IEAHDLD--------ARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIG-LQIGNLSG-----EESREFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGK-----VQVSLKMSSWSGSAPFFVLPVY 2346          

HSP 7 Score: 51.6026 bits (122), Expect = 2.874e-6
Identity = 147/674 (21.81%), Postives = 270/674 (40.06%), Query Frame = 1
Query:   73 KVDEGVQVGTEIADLTS-DFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDL-PGIRKTIPTAIDLDSSVFSTIFYNLSD-PTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNE---PIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNK-AIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP---QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNS----FFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNY-INKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYL-DREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIF 2028
            +V E ++VG+ +A + + D  NL     F+ V +      +HF I   +G + L     +D EV+ E+           + I+   G   T   + I V D NDN P ++              PG       A DLD+     + Y+L    +  F++   +  L+++    +      ++ + + A++ G+  S S  + V+++ I +  P   KP F + E    + E+  I   +  LS  +     + EF +RI   + +   +I+ F      G + V  P+D ++      F+V +++       +  +  V   V D ND +P    + +Y           ++ ++      +G IM +D D  EN  V  R L+        LN  +   Q   +     D        + +E  D  +     + K  + L  +          L  Y   + E+   GT+L  K+R+ ++    N  + Y L E   K   I+   G L      D E    +++ + V D GN  RS+   + IV+  +D+   VFTK  +   I  ++     VG +QA+D D      + YSI + ++     I++ +G++     L  R  +    I VVA+ S        +K +K+   +EI   D   + P ++ 
Sbjct: 1934 RVPENLRVGSYVATVGAKDVDNLAPLRYFL-VSDSSGQTPTHFNIDQFTGTIHLTA--PLDFEVLPEH----------TLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDAR--GALTYSLGQGSSSIFRVAPESGALFMK----VLPPAGERYLVTVTATDNGVP-SFSTSVPVSVI-IGEAEPT-DKPGFEKAEFRFEVMENSKIGLQIGNLSGEE-----SREFHYRIQDPEASKIFSIDKF------GRLFVAGPIDREQ-RATHEFQVEIDNEMMTSQKVQCKCHV--IVLDENDNLPVFTSVAYY----------LSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQ-KIRASNRLGMRNDGLLYSLKEHQGK-LGIDVKTGELTLKTHLDWESEPIISMYLSVSD-GN-GRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQS--TVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSP-------TKQSKTTVYLEIGPFDVQPSLPKLLL 2548          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 107.842 bits (268), Expect = 2.097e-23
Identity = 178/699 (25.46%), Postives = 286/699 (40.92%), Query Frame = 1
Query:  337 LTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDP--------TRFFKLVETA--DNLYIQN----SLMLDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFF------FKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQI--YTTVI-----FDREQQDKHFVSIECTDQAYHM--NYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTL---ISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHIS--ENSVINTVVGSVQAVDLDENTIV------YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQI---YSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCT 2301
            L   ++ IE++D+ND+ P +++  +    +    PG       A D D      I Y  +          T    LVE     N +        L L     S   L  Y +   I  +   ++IQ +    N + P+FS   F     + ED PI +VV  L A D D+G NG   + I  + I   + E   +   +GEI V    D  + M+          KV   D A  P   SS   + L + DVN+  PQ D       ++S    + EN      +  +  ND D   N ++       F + N+        I   T ++      DRE QD H  +I  +D+ + M  +  N T+ + D NDN P          + E++P G  ++  + +FD+DI  NS++ + L+ +    F+I+ H G +         D  +    NL++ V D G+   S+   +H+ ++D+  N +    D      S  ENS I T V  ++A +  +   V      Y I+       F ID+  G + T   LDRE    Y+I V A DS   + +      + +  V I+I D ND+ PV   P +  +    S   P    I ++    + D D+     L++ +E  D    F+I  TSG +   +G   LD E  S H + + +CD G    C+
Sbjct:  473 LAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESE---NKHSPVFSS--FPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVI--HDIAGSSHEVLTVDEQSGEITVAS--DLSKLMKEKLEVLDVQLKVSAID-AGTPVK-SSVKTMKLRIKDVNNHSPQFD-------EVSYYLRISENEKPGKDIFKVTANDFDGGNNGKI------KFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSC-MAAFDEDIGQNSKLKFLLN-SEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQ-KGTVRTTHLLDRETKSAYWITVEARDSKTDLYK--DPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENS---PANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYI-TTSGIRRLDREKQSEHELWVSICDGGEPQLCS 1138          

HSP 2 Score: 84.3445 bits (207), Expect = 3.606e-16
Identity = 148/615 (24.07%), Postives = 268/615 (43.58%), Query Frame = 1
Query:  196 FGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLV---GFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQ-DKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPS---GTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFL-IDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFP 2016
            F ++  +G  ++I   ++DRE   ++ K  I +D          GG   I  + +++ D NDN P ++ D       +    G   TI +A+D D S    I ++L +   +F L E +  L + +   LD E    + L   A++ G   ++ L   + + D+ND+PP F K  F+    I   +P  S +L  S  D D   N    F I   K N + +  F + S   ++++++P   +  M+ +  KV   D  F     S++  +NL     +D         I+  + +    + EN+ K T+V     ++  +V F  +D     +  + FV+N  +   + +    + +++ QQ + H ++I+   +         T++I + NDN P      L   + EN+P+         ++ + D D D   ++ + + +     F+I+   G +  ++  D E     NLTV   D G  +   K  I + ++D +DN   F K  +   + E+  I   +   +A   D+N  +   L P +   F+ ++  +G+LT    LD E +    + VVA DS +P  E         A VEI + DENDN P
Sbjct: 2657 FSVERSTG--KIIVKSSLDRERKNQW-KMTIRADAA--------GGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVAS--QLDREKIDHYKLIARATDEG-GFNTDLPFTIVVSDVNDSPPQFEKEEFN----IDLHLPSTSPILHFSIKDDDLSPNNVSQFFIP--KGNEEGV--FWIDS-NNDLLLKRPEIVENKMQ-YQLKVTAFDGVF---ETSTKVKINLKSSKDSD---------IRCPEANKTVILAENSKKGTVVLGESSLLGPNVTFKLSD-----NDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELI---TVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFD---EIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASD-GEFE--DKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETE-------AQVEISVMDENDNAP 3214          

HSP 3 Score: 77.7962 bits (190), Expect = 3.898e-14
Identity = 137/545 (25.14%), Postives = 230/545 (42.20%), Query Frame = 1
Query:  646 RSSSLLIQVTIVDINDNPPLFSKPLF----SRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDY-DRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVG--DVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQ---DKHF-----VSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNF-------YLYENMPSGT---ILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEG-----NVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT------IVYSILNPKNDYIFLIDKFSGVLTTNS--YLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSH 2166
            +SS   +++ I D+N++ P F +  +    S NE   +DI        ++A D D G NG+  F + +N+  +  I    + + TG + + K LD  D+ +  F   +I  D  F P  +S     NLT+   DVND  P+     +Q+++      + E+ P    V  +   D D  +N ++        F+LNS     +   ++  IF    +   D H      +SIE  D   H + I  T   L     D      ++ F        +YEN   GT   ++  K    ++ +   +  +  +       F I+  +GT+ +    DRE +S+  +TV   D       + +R     + I ILD +D+  V  K  ++  ++ENS  N V+  V+A D D+        +++ I        F ID  SG +TT+    LDREK   + + V   D   P    +  N     +V + + DENDN P   F    H+    S F      + +I++ D+D GEN  L Y +   D+ 
Sbjct:  700 KSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDI------FKVTANDFDGGNNGKIKFSLGNNQEKSSVIS---IDAKTGIVKLLKSLDREDQDVHTF--AIIASDEGF-PMRVS---VTNLTISVEDVNDNPPKC---VVQHSRAR----IPEDLPHGAFVSCMAAFDEDIGQNSKLK-------FLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVAD---HGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSID-QKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEP---QLCSN----VIVIVNVLDENDNSPT--FTQAIHHYSVRSKFA---GKLCRIFAVDADEGENARLTYNITEGDAR 1199          

HSP 4 Score: 77.411 bits (189), Expect = 4.067e-14
Identity = 61/192 (31.77%), Postives = 92/192 (47.92%), Query Frame = 1
Query: 1471 DNNSQVHYYLHEASNKDF-KINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---------ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFP 2016
            D N  + YYL  +    F  +N   G L   +  D E  S+L LTV  +D G     ++  + I ++D +DN   F K+K+V  + ENS     V +V+A+D+D         E  IV           F I+    VL + S +D EK+ +Y +KV+A D   P         +S AL+EI ++DEND+ P
Sbjct: 3141 DQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQS-IDYEKIKKYNLKVIAKDGGRP-------PLRSEALLEIHVEDENDHAP 3324          

HSP 5 Score: 75.8702 bits (185), Expect = 1.182e-13
Identity = 150/667 (22.49%), Postives = 271/667 (40.63%), Query Frame = 1
Query:  340 TIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLM-LDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEP-IPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRK---PLDYDRGMRNFFFKVIVE--DHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFV----LNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHM-------NYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD----FKINTHEG--TLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPE----KSIFQIYSTDSDS------------GENQTLIYGMENEDSHKIFKIHRTSGLVFL 2208
            ++  +++ + D N++ P ++  S  +   + + PG      TA D D      I ++L +      ++       I   L  LD E     T  + AS+ G   R S   + +++ D+NDNPP   K +   +   IPED+P  + V  ++A D D G N +  F ++S K+       F +   +G I +     PLDY    +  FF + +E  DH     S S    V L   D+       +  AI+ + ++ + +V EN+   T V  IM    +  +  +V   +L    +        S  ++  + TT + DRE +  +++++E  D    +       + ++  + ILD ND+ P          + EN P+  ++  K+ + D D  +N      + +    D    F+I+   G  T   +R  DRE++S   L V + D G  +  S   + + +LD +DN   FT  + + H S  S     +  + AVD DE     + Y+I   + D  F ID    ++ + +    E    Y + V A D   P ++  +                     V++  N    +   S   PPE    KS + I  +D+D              +   L + + + D   +F + + +G + L
Sbjct:  702 SVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPP---KCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVP------FRIDHHSGCIFIHAPEYPLDY---HKTPFFNLSIEVADHGDPILSTSCHLHVELV--DIAH-----NHLAIEFDDVAKEASVYENSEIGTEV--IMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIV-KVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFT--QAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNIT--EGDARFSIDNNGNIIASEAIHGDES---YALTVQATDHGTPGQQFAATR-------------------VVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTGQLLL 1320          

HSP 6 Score: 72.7886 bits (177), Expect = 1.232e-12
Identity = 106/457 (23.19%), Postives = 194/457 (42.45%), Query Frame = 1
Query:  238 LKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRID--SNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPK--NTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYEN-MPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSS 1590
            +K +D E++  +    + SDG   D   IL          + VID NDN P +   + +++ M+ +  G       A   D +     +   SD T F  L   A    +  +  LD ET S   L + A + G+    +   ++++++D NDN P F K  +     + E+      VL + A D DS   G  S+ ++  S    +  +  F + S  G++++ + +DY++ ++ +  KVI +D    P  L SEA + + V D ND  P  D          N  A+++      + L+ F ++ D+D  +N   F   +       S    E+ ++ T    +  ++DK+ +++   D          T+ I   + + P   P  +     +N +P G I  G+L++ D+D            E  N   +    EG++ S R+  +E RS+
Sbjct: 3071 VKPLDSEILGFFNLTVVASDGEFEDKATIL----------VTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNL--NAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGK--VKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINS-NGDVLISQSIDYEK-IKKYNLKVIAKDGGRPP--LRSEALLEIHVEDENDHAPTFDD--------CNMTALVQEGEAIGHRLLKFSVS-DLDGPKNGAPFTVEIQGDGA-KSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGII--GRLKASDED-----------EEDQNGLLRFGLVEGSIQSPRAQVQESRST 3486          

HSP 7 Score: 70.0922 bits (170), Expect = 7.216e-12
Identity = 116/465 (24.95%), Postives = 201/465 (43.23%), Query Frame = 1
Query:  565 IQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQ---FAVLENTPKNTLVGFIMTNDVDFNE-NDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINK-TLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGF-----IHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDS 1926
            I  S +L+     ++ + L   +    R+ S L  ++++DIND PP F  P +S +  I E       V+++SATD D     E+S       ++    ++F +    G I V K L++  G+      +   D A  P+  ++   VN+    V  ++P          + SN    F+V+E+     ++G +   + + +E    +   S  S   L     R   +I      DRE++++  ++I   D A  ++ I   T+ I D NDN P F  D   F + E+   GT +T    + D+D   + ++ + L E  N  F +N + G L      DRE+     L     DEG       GF       IV+ D++D+P  F K++F   +   S    +  S++  DL  N +  + I     + +F ID  + +L     +   K+ +Y +KV AFD 
Sbjct: 2459 IHVSRVLNYHRDKRYQIPLVVEDATGRRAFSTLT-LSVIDINDKPPFFVLPFYSTS--ISESAKEGDTVMMVSATDDDENDTIEYSL------LDGSESQFFSVHPRQGTITVAKKLEHKAGV-TLSLTIKATDSANPPHHATTTVEVNIASESV--KVP----------RFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRA-DAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVT-IFSAMDRDDSPSGRIRFSLVE-ENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG-------GFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKM-QYQLKVTAFDG 2890          

HSP 8 Score: 67.781 bits (164), Expect = 3.755e-11
Identity = 121/543 (22.28%), Postives = 227/543 (41.80%), Query Frame = 1
Query:  370 DTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSS-----VFSTIFYNLSDPTR-FFKLVETADNLYIQNSLMLD---SETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVG--DVNDEIP--QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDE--VFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTI--LTGKLRSFDKDIDNNSQVHYYLHEASNKD-----FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFD 1923
            D ND +P +    ++ +  D  + G   TI +A D+D++         + Y + D     F +      L +   +  D   +E T K  L++  ++      + L++++        PP F +  +  N  +   I   S +L ++       L    +    SN   +K      +   TG I V + L+Y R  R +   ++VED      +    AF  LT+   D+ND+ P   + FY+          ++ E+  +   V  +   D D N+  E  +   S + FF ++      Q  I      + +      ++I+ TD A   ++   T+ + +           S + YL+  M    +  + G+++  + +ID   ++ + +   S +      F +    G +I   S DRE ++   +T+  +  G V   +   + + I D++DN   F  D   F ISE++ + T V    A+D D++    I +S++  +N Y F +++ SG LT  S LDREK+D Y +   A D
Sbjct: 2277 DVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKV-LNVSVTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANA-LENTIVNKSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKR-YQIPLVVED------ATGRRAFSTLTLSVIDINDKPPFFVLPFYST---------SISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQFFSVHP----RQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEV-NIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEID---EIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITT--VTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVE-ENPY-FDLNENSGWLTVASQLDREKIDHYKLIARATD 2789          

HSP 9 Score: 54.299 bits (129), Expect = 4.888e-7
Identity = 56/279 (20.07%), Postives = 117/279 (41.94%), Query Frame = 1
Query: 1465 DIDNNSQVHYYLHEASNKDF-KINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKND----YIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            D D N  + Y L + S   F  ++  +GT+   +  + +   +L+LT+   D  N    +   + + I         F+   ++F + E++ +  V+G VQ ++ + + I ++I+    +      F +++ +G +   S LDRE+ +++ + + A           +    +I  V + I D NDN P     +  + R   S       S+    + D D   +  + + +  E+ +  F ++  SG +   T  S LD E    + +  +  D G 
Sbjct: 2531 DDDENDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRA---------DAAGGVHAITTVTVDIGDVNDNAPAF---HGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPY--FDLNENSGWL---TVASQLDREKIDHYKLIARATDEGG 2792          

HSP 10 Score: 53.9138 bits (128), Expect = 5.936e-7
Identity = 59/226 (26.11%), Postives = 96/226 (42.48%), Query Frame = 1
Query: 1576 EERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGS-------VQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNS 2223
            + R S+  T  VE     +  +K  I  +I     +PI F +  +   I EN    + V S       V A+D D  +   + Y +L+PK++ +F +D++SG + T    D EK+  Y   V AFD   P   ++       +L+ + + DEND       P F  N L+ S+  P    +     T  D     +L Y +  +D    F +   +G V +K  N 
Sbjct: 1633 KHRKSVECTAIVESTEGQQDIAK-VIAKIIRTNQHSPI-FRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMP-----SLIVVTVIDENDE-----PPRFPSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFI--KDQSVPFSVDSKTGDVLVKDSNG 1844          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 101.293 bits (251), Expect = 1.939e-21
Identity = 164/675 (24.30%), Postives = 286/675 (42.37%), Query Frame = 1
Query:  358 IEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPT------AIDLDSSVFSTIFYNL----SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQ--VTIVDINDNPPLFSKPLF----SRNEPIPEDIPINSVVLVLSATDRDSGLNGE--FSFRID--SNKINNKAIEYF-IMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQ------------IDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTIL---TGK----LRSFDKDIDN-NSQVHYYLHEASN----KDFKINTHEGTLISLRSFDREERSSLNLTVYVEDE-------GNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT-IVYSILNPKNDYI-FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQT-LIYGMENEDSHKIFKIHRTSGLVFL 2208
            I + D N+N P +  D      +   + G  KT P       A D DSS    I Y+L    S+  + F +      L     ++ D ET  +  + + A++ G DR      Q  V +VDINDN P F +P +    SR E +       + V+ + A D D+  N E  +S  ID  + + +   +++F ++   +GEI + KP+      + F F VI +D+  +P +L S A V L V D   + P+            +D     N  I    AV     +N+ V + +T         E   R  N F   N     E  ++      D EQ + + +++  TD    +   +    +++  D +      +++ +   + E M     L    GK    +++ D D D   ++VHY +   +N    K F+I+   G +     FDRE+     LTV   D         N        + IVI D++DN   F + K++  + E+      V +++A DLD+++ + Y ++      I F +   SG +     LD E  D+Y + ++A D            + +   V I I+D NDN P      +    +   +  P  K +F +++TD+D  E  + ++Y +E + + ++F+I + SG + L
Sbjct:  853 IGIEDVNNNKPEF-PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG-DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAV------GTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK--TQKFIFNVIADDNG-IPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGN-----EWVEVVIMEGLDYEQVNNYTLTLTATDMTSRV--ASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGR----------HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIP--KVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIEL 1497          

HSP 2 Score: 89.7373 bits (221), Expect = 7.592e-18
Identity = 148/559 (26.48%), Postives = 238/559 (42.58%), Query Frame = 1
Query:  517 DPTRFFKLVETADNLYIQNSLMLDSETTSKFTLH-LYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDR-GMRNFFFK--VIVEDHAFLPYSLSSEAFVNLTVGDVNDE----IPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQ--FQI--YTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY--------LYENMPS----------GTILTG----------KLRSFDKDIDNNSQV---HYYLHEASNKDFKINTHEGTLISLRS--FDREERSSLNLTVYVEDEGNVKRSSKGFIH--IVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSI-------LNPKNDYIF--LIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFP 2016
            D T++F++  +   +++   L  D     K  LH L  +    +R S + + + I D+NDN P F++PL++    + EDIP+N  +L ++A D+D+G N   ++ +D++         F + S  GEI  +  LD D+   R+F ++  V   DH   P SLSS A +++   + NDE    +P   + A           V E+    T V  I   D D    DEV      SF   N  ST++   F I  +T ++     + +H VS    D A   N IN T+++ DD     Y      ++         +  N P             I+ G          K+ + D D   N  +    YY    S K F I+   G L       FDRE R   ++TV   D G+  R   GF    + ++D++DN   F +  +   +S    + T V +V A D D      I YS+          +ND  F  L+++ SG +T    +   K  ++   V+A D+ IP  EA+    +S A V + + D+    P
Sbjct:  580 DETKWFRIDPSTGIIHLTRLLDFDDPALPK--LHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQ--VREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN--------FSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHG-EPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAF----------VAEDAQGGTPVIQIQARDAD---RDEV----TYSFMDKNGRSTQKMNLFSIDEHTGLV-----KLRHGVS--AADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGD--RPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIP--EAL----QSSAQVTLNVLDKQQKAP 1091          

HSP 3 Score: 60.8474 bits (146), Expect = 4.831e-9
Identity = 70/246 (28.46%), Postives = 110/246 (44.72%), Query Frame = 1
Query: 1444 KLRSFDKDIDNNSQVHYYL--HEASNKD--FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVI--LDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE----NTIVYSILNPKNDYIFL-IDKFS-----GVLTTNSYLDREKV---DRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGE 2124
            + R FD     N+ + Y +  ++  N +  F+I+ + G + ++RS DRE  S     + V        S +GF ++ I   DM+DN   F K ++   + E + I   V S  A D DE    N   Y  L+ ++DY ++  DK S     GVL     LD E V   D + + +   D     E A+      +ALV     D ND+ P I     T +R+   +  P   SI +  +TD D+G+
Sbjct: 1572 QARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQ-LSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAV-----HVALV-----DRNDHAPHI--HGATEHRVREDV--PRGTSIGRYTATDRDAGD 1802          

HSP 4 Score: 60.4622 bits (145), Expect = 5.919e-9
Identity = 97/403 (24.07%), Postives = 163/403 (40.45%), Query Frame = 1
Query:  664 IQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLV-LSATD----------------RDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYD-RGMRNFFFKVIVEDHAFLPYSLSSEAFVNLT--VGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNS----FFVLNSMSTREQ----FQIYTTVIF-DREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDN-PIVFTKDKFVFHISENSVINTV-VGSVQAVDLD 1779
            +QV + DINDN P+F + LF   E   E I  + V  + + A D                R+  +NGE  FRID N               TG+I   + LD +    R F  +V   D   +P   S E F N+T  V D+ND  P   F+     K   + +V E  P    V      D D    D VF   L+     F+V     +++      ++   + + D  Q+D   + I  +D  +         L+  D ++       +    + E++P GT + G+  + D+D  + ++          + F I+  +GTL    + DRE+ +  NL +   D  N     +  + + + D++DN P  +T  +      EN+ +N +    ++A D D
Sbjct: 1532 VQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQN---------------TGKIFAMRSLDREISSEREFIIEVRANDRG-VP---SREGFANVTIKVTDMNDNAP---FF----EKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALV--DRNDHAPHIHGATEHRVREDVPRGTSI-GRYTATDRDAGDTARFRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPEPYTVPRPCI-FRENTPVNQLGTCEIRATDRD 1901          

HSP 5 Score: 60.077 bits (144), Expect = 9.111e-9
Identity = 132/557 (23.70%), Postives = 241/557 (43.27%), Query Frame = 1
Query:  643 DRSSSLLIQVTIVDI--NDNPPLFSKPLFSRNEPIPEDIPIN-SVVLVLSATDR---DSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIV---EDHAFLPYSLSSEAFVNLTV--GDVNDEIPQI--DFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQ-QDKHFV---SIECTDQAYHMNYINKTLLILXXXXXXXXXX----XXSLNFYLYENMPSGT-ILTGKLRSFDKDIDNNSQVHYYLHEASNKD------FKINTHEGTLISLR----SFD-REERSSLNLTVYVEDEGNV------KRSSKGFIHIVILDMDDNPIVF---TKDKFVFHISENSVIN---TVVGSVQAVDLDENT---IVYSILNPKND--YIFLIDKFSGVLTTNSYL--DREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKID--DENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGME 2151
            D ++S L +V I++I  ++ PP F+K  +     + ED  ++ SVV V + + R   D    G  ++ ++ +   ++  ++F +   TG I + + LD+D        K+ V   ED+         E+ V+LT+   DVND +P      Y  Q         V E+ P N  +  +   D D  +N  +     N  F +NS       +I   V  D +Q  ++HFV   ++   D    ++  +  ++ +   + +              ++ E+   GT ++  + R  D+D     +V Y   + + +       F I+ H G L+ LR    + D  E  + +NLTV V+D+G+         +S   + I I D+++N   F    K   +  I E +      T+V  V+A D D +    IVYS+   +++    F+ID+ +GVLT + ++  DRE   R  + V A D           +   I   +  ++  D NDN P    P++     + S F+    S+  +++ D+D+  N  + Y +E
Sbjct:  507 DNTTSQLSEVAILEILADERPPQFAKQEYEVT--VSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDET-KWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN--------RESHVDLTIRIDDVNDNVPTFTRPLYTAQ---------VREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNG-----EISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD-----EVTYSFMDKNGRSTQKMNLFSIDEHTG-LVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV-KVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG---------DRPLIGFCQFSVEVVDINDNSPQFERPSY---ETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLE 1019          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 166.007 bits (419), Expect = 2.549e-41
Identity = 192/745 (25.77%), Postives = 330/745 (44.30%), Query Frame = 1
Query:  193 HFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTI--HEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINN--------KAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSL--NSFF----VLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLN---FYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD----FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSI------------LNP-KNDYI---FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIAL-VEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGM------ENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            +F I+ +SG +R+   K +D E      K+++      ++IQ  LG        ++ IEV D NDN P + +  + +   +    G       A D DS     + Y+L   +        A + ++  S  LD E++ + TL + A++ G+   S++L I V + D+NDNPP+F K  +S N  + E   IN+ ++ ++A+D D+G N   ++RI    ++N           ++F +   +G I +R PLD  R  R+ +   ++      P +  ++  V + V D ND  P+         K   +F + EN  + ++VG +  +D+D  EN  +    L  NS F    V   +STRE          DRE ++ + + +E  DQ   +      + I   + ND              + E  P GT +  ++R+ D+D   N+ + Y + +  + D    F I+   G + +    D EERS   L V   D GN  R +   + + +LD++DN   FT    VF + E++ +  VVGS+  ++   + +  S+            LNP   D I   F ID+ SG L     LDRE    + +++ A D+        S N +S A+ V+I++ D NDN P   +P    + L  S   P    I    +TD+D+G N  L Y +       NE   +   + R   L    +  + LD E    +++ ++  D  +
Sbjct:  874 YFSIETNSGNIRIA--KPLDHEA-----KSQV-----LLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVN--VSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLD--RETRDRYQLTVLATDNGTP-AAHAKTRVIVRVLDANDNDPKF-------QKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPL--------DRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVV-RVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDT------TASNNPQSSAITVKIEVADVNDNAPE--WPQDPID-LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSS 1576          

HSP 2 Score: 147.902 bits (372), Expect = 1.226e-35
Identity = 193/776 (24.87%), Postives = 331/776 (42.65%), Query Frame = 1
Query:   67 KFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILR----LITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL-----SDPTRFFKLVETADNLYI--QNSLMLDSETTSKFTLHLYASNPGIDRSSSLL-IQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNN---KISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVI---FDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENM----PSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD---FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIVYSILNPKNDYI--FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS-------IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            K +V EGV V  +I  +  DF  +     ++ V        +  G++ D  I R    + T   +DRE    Y    I   G  I              + + V D NDN P +   S+++EF +     +++T+  A DLD   ++T  YN+     +D  R     E    LY+  Q S  LD ETT  ++L + A + G       + + +TI D+NDN P+F++  +     +PE+  + + VL + A+D D+  NG   + I+  + + +  + F +   TG I + K LD++    +    V+ +DH   P  L + AFV++ V DVND  P I+   + ++   KIS      E+      V  I  +D D          +LN      +++TR+   IY  ++    DRE    + +S+  TD+     + +K++  L   D +        + Y    M    P  ++L  ++ + D+D   NS + Y L E        F+I+   G + +    D E      LTV   D G    SS   + + I D++DN  +F +  +   ++EN  +   +  V A D D   N +V   +     ++  F +   SG +     LD E+   Y   V+A D              + A++++++ D NDN PV     F       SL + P+ S       I  + +TD D G    + Y +   +   IF+I R++G +F+   +  L V     H++ +   D GN
Sbjct:   83 KLEVFEGVAVDYQIGYI-GDFGGIDSGPPYIIV--------AEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNI-------------RVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFAT--VPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKE--QMFRIDPRTGAIYINKALDFETKELHELV-VVAKDHGEQP--LETTAFVSIRVTDVNDNQPTINVIFLSDDASPKIS------ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDN-SIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIF-LRITDVNDNPPEFEQDLYHANVMEVADPGTSVL--QVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---------GLSTTAMIKMQLTDVNDNRPV-----FYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDM-LSVRTQPMHMLNISATDGGN 804          

HSP 3 Score: 144.436 bits (363), Expect = 1.455e-34
Identity = 172/694 (24.78%), Postives = 293/694 (42.22%), Query Frame = 1
Query:  328 GGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIR-KTIP----TAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSS-LLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFL-PYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV----FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI----LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEAS-------------NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGM---ENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTV 2304
            GG  T   I++++ D NDN P +      V   +      +  + P     A D D   F  + Y +   +    F++  +   +++    ML   T     L++ A++ G  RS++  ++ ++I+D    PP+F K  +  N  + EDIP  +VV  + A   D        + I S   +     YF +++ +G I + KPLD++        +V++   A L    +     VN+ V DVND  P+ +   ++        +V E+      +     +D D   + +V       S    F +++ S      +  +   D E   +H + +  TD        N T+L+    ++DN         S+N     ++ +  I   ++ + D D  NN+++ Y + +A              ++ F I  + G +      DRE R    LTV   D G     +K  + + +LD +DN   F K K+ F I EN    +VVG V A DLD  EN  +   L P N   F +   +G ++T   LDRE  + Y + V A D   P+  A          V I + D NDN P I  P    + ++    QPP   + ++ + D D G+N ++ Y +    + D H +F I  TSG++  +     LD E  S + + +   D GN P+ TV
Sbjct:  693 GGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARY--NYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG----YFSIETNSGNIRIAKPLDHEAKS-----QVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVR-------ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG----HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQII---QVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVP-------VRIHVSDVNDNAPEIADPQ--EDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRV---VLDHEERSIYRLGVAASDGGNPPRETV 1348          

HSP 4 Score: 135.961 bits (341), Expect = 6.179e-32
Identity = 179/727 (24.62%), Postives = 309/727 (42.50%), Query Frame = 1
Query:  340 TIHEIQIEVIDTNDNIPYWNSDSINVEFMD----GDLPGIRKTIPTAIDLDSSVFSTIF------YNLSDPTR-----FFKLVETADNLYIQNSLMLDSETTSKFTLHLYA------SNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRI-----DSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEND----EVFCRSLNSFFVLNSMS-TREQFQIYTTVIFDREQQDKHFVSIECTDQAY---HMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNV----------KRSSKGF-------------IHIVILDMDDNPIVFTKDK-FVFHISENS---VINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNL 2328
            T+  +++EV+D NDN P + S S+     +    G + G    I    D+  +     F      Y L+  T+      F +   + NL +  + +LD E  S+F L + A      +NP   +SS++ +++ + D+NDN P +  P    +  + E  P+ +++   +ATD D+G NG+  +R+       N+   +A+  F M S+TG + ++ PLD++           ++  + +   L +   V L + D ND  P          K ++ F + + T    +V  I+  D D  +N     E+   +    F +NS +   E  +       D E+  +  + I   D        + +N  L++   ++N P F        + EN+PSG+ +           +N +  +      +N  F ++   G + +   FDRE ++S  L VYV D              +RSS                I+I + D++DN   F     +   + ENS   VI+TVV S    DLDE     ++YSI        F ID  SG L+    LDRE+  RY +++ A D   P      K+ +    + I ++D+NDN P      +T +    +   P   S+ QI + D+D G N  L+Y + NE   + F I   SGL+   T    LD E  +++   +   D G     +   P+ +N+
Sbjct: 1347 TVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVV--ARLLDREVQSEFRLEIRALDTTASNNP---QSSAITVKIEVADVNDNAPEW--PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF-ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVAS----DLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQP------KSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDA---PLGTSVVQISAVDADLGVNARLVYSLANETQWQ-FAIDGQSGLI---TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINV 2047          

HSP 5 Score: 135.961 bits (341), Expect = 6.450e-32
Identity = 197/774 (25.45%), Postives = 332/774 (42.89%), Query Frame = 1
Query:   58 SMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--------------SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRS-SSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSL-------NSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI--LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDK--DIDNNS--------QVHYYLHEASNKD-----FKINTHEGTLISLRSFDREERSSLNLTVYVEDE--GNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSI------LNPKNDY---IFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQ----IYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFL 2208
            SM++  V E  ++G  +    +  K+ G + +    L +   K   F I   SG   LI  +++D E    +      +DG    +   L        I ++V D NDN P +  D  +V   +      +     A DLD+   + I Y +              SD ++ F +   +  +Y++  L  D ET  ++ L + A++ G   + +   + V ++D NDN P F K  +     I E++   SVV V++A+D D G N   + R     IN+     F +  VTGEI  R+PLD  R +R  +  V+       P   S+   V + V DVND  P+I       +   +  +V E  P  T V  +   D D  +N  +    +       +  F ++  S      I T V+ D E++  + + +  +D         + L +  LD NDN P F   SL F + E+   G ++ G +   ++  D+  NS        +V Y L+  + KD     F I+ H G L+  R  DRE +S   L +   D    N  +SS   + I + D++DN   + +D     +SE + + T++ +  A D D  T   + Y +      LN   +    +F +D  +G L+  + LD E V  Y + V A D +  + E +    ++   V ++I D ND+ P  + PN +  +  ASLF      I +    I + D DSG+N  L Y +   +    F+I+  +G++ L
Sbjct:  934 SMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGK-GLFAIDARSG--HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNL-------TILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL--DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFR--IEENLRRGSVVGVVTASDLDLGENA--AIRYSLLPINSS----FQVHPVTGEISTREPLD--RELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEI------ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSG----VIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVV-GSISPIERPADVVRNSVEESFEDLRVTYTLNPLT-KDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERL----QTSVTVRLRILDANDHAPHFVSPNSSGGK-TASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIEL 1667          

HSP 6 Score: 119.783 bits (299), Expect = 5.979e-27
Identity = 212/826 (25.67%), Postives = 351/826 (42.49%), Query Frame = 1
Query:   52 SKSMLKFKVDEGVQVGTEIADLT--------------SDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLV----ETADNLYIQNSLM--------LDSETTSKFTLHLYA----SNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEP----IPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPL-----DYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEND----EVFCRSLNSFFVLN----SMSTREQFQ-----IYTTVIFDRE------------QQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXS-LNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEAS-NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVIL--DMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDS--HKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVC--DSGNQPKCTV 2304
            + S L F+V E   +G  +  ++                F++L +T     +   +D   + F I   SG   L+  + +DREV  E+ + +I +    +D         +   ++IEV D NDN P W  D I+++  +    G      TA D D+     + Y L    R+F  +    E A +L+  +SL         LD E   ++ L + A    SN      +S+ +++ I+D ND+ P F  P  S  +     I +   I  VV  + A D DSG NG+ ++ I       +    F + S TG I + K L     D ++G R F   +  +DH   P    S   ++L V   ++  P+    A+    I      LEN P  + V  +    +   EN     E+     N  F ++     ++TR QF       Y   ++ R+            ++ +   SI  T    H +     + + D NDN P F P S     + EN   G I T  + + D D   N+ + Y +   +    F I++  G L S R  DRE+ S   L +   D G  K S +G  +I I   D +DN   F   K+   + E++ + T V  + AVD D      +VYS+ N +  + F ID  SG++TT   LDRE    Y   V+A D          +   +   V+I + D NDN P  IF  + +     +L QP + ++ ++ + D+D G N  ++Y +  E+S     F+I+ ++G +   + + +L  E  S  ++ L+V   D GN P+ ++
Sbjct: 1366 TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPL--TKDLIEAAFDIDRHSG--NLVVARLLDREVQSEF-RLEIRA----LDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRL---IRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR----FRINSQTGIIELVKSLPPATEDVEKGGR-FNLIIGAKDHG-QPEPKKSSLNLHLIVQGSHNNPPRF-LQAVYRATI------LENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHT--VVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPK-SRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-ETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDG------GRYEVRSATVPVQINVLDINDNRP--IFERYPYIGQVPALIQPGQ-TLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGAL---SASQSLASE--SGKLLHLEVVARDKGNPPQSSL 2147          

HSP 7 Score: 100.523 bits (249), Expect = 5.005e-21
Identity = 162/682 (23.75%), Postives = 288/682 (42.23%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYW----NSDSINVEFMDGDLPGIRKTIP--TAIDLDSSVFSTIFYNLS--DPTRFFKLVETADNLYIQNSL---MLDSETTSKFTLHLYASNPGID--RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAF----------------------VNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMT---NDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAY---HMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVK-RSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYI---FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQT-LIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFST 2250
            +++ ++D ND+ P++    +S          D   I + +    A+D DS     + Y ++  +    F++      + +  SL     D E   +F L + A + G    + SSL + + +   ++NPP F + ++     I E++P  S VL ++A       N   S+ I +   N    + F +    G I  R   D +    ++   V V D A    +LSS A                       + +TVGDVND  P+         +  + + +  + P+N+  G I T   +D+D   N ++   S+    + N  S        +    DREQ  ++ + I+ +D+        + N T+ + D NDN P F        + E+ P GT +  ++ + D D+  N+++ Y L   +   F I+   G + ++   DRE ++S N  V   D G  + RS+   + I +LD++DN  +F +  ++  +         +  VQA+D D      IVYS LN +N  +   F I+  +G L+ +  L  E      ++VVA D   P +        S+ L+E+ I +     PV+ F N T+ R+      P    + Q+ +  SD    +    +G  NED   I  +   SG + +   +  LD + FST
Sbjct: 1588 VRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRAT--ILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN----DLFHVDWQRGIITTRGQFDRE-SQASYVLPVYVRD-ANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF--------RPGSCYGL--SVPENSEPGVIHTVVASDLDEGPNADLI-YSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV-QISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYS-LNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQS-------SLGLIELLIGEAPQGTPVLRFQNETY-RVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDG--ILSLDSLSGEIRVNKPHL-LDYDRFST 2237          

HSP 8 Score: 77.411 bits (189), Expect = 5.473e-14
Identity = 72/302 (23.84%), Postives = 142/302 (47.02%), Query Frame = 1
Query: 1435 LTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKIN-THEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE-NTIVY-----SILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVI----------IFPNFTHNRLNASLFQPPEKSIFQIYSTDSDS-GENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
               ++ +FD D  +N+++ Y++ + ++ + F I     G + +    DRE R    L +   DEG  + +    I + I+D++DN   F  +  V  +SE + +  V+ S+ A D+D    + Y     S ++ +N  IF +D++SG L     LD E    Y + V+A D+           +++  ++ ++++DENDN PV           I P  +    + S+    +  +  + +TD+DS G N  +IY +  E + + F +H ++G+V +        V     + +++   D+G
Sbjct: 2340 FVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA----------HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSV----DFDLLTVNATDADSEGNNSKVIYII--EPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG 2624          

HSP 9 Score: 68.1662 bits (165), Expect = 3.673e-11
Identity = 64/220 (29.09%), Postives = 103/220 (46.82%), Query Frame = 1
Query: 1657 IVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLID-KFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENE---DSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            I + D +DN   F++ +FV  +SE +   T V  V A D D  +   + Y I++  +D  F+I+  FSG++ TN  LDRE  D Y +K++A D  +P            A + ++I D NDN P   FP   +N +  S        I  I + D D+    T   G E+    ++  IF + R SG + LK     LD E    + + +   D+ ++ +
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVP-------QMTGTATIRVQIVDVNDNQPT--FP--PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLK---RRLDYELQQEYELDVIASDAAHEAR 2515          

HSP 10 Score: 68.1662 bits (165), Expect = 3.673e-11
Identity = 65/222 (29.28%), Postives = 105/222 (47.30%), Query Frame = 1
Query: 1657 IVILDMDDN-PIVFTKDKFVFHISENSVINTVVGSVQAVDLD-ENT----IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREK-VDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGM----ENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQ 2289
            I ILD +DN PI     K+   ISE + +   +  +QA+D D ENT    +VY I +  ++++F ID  +GVL  N+ LD +     Y + + A DS+        +   S+    +++ DENDN P      + H        +P   S+F+ +++D D G    L Y +     +E S K+F++   SGLV   T     D E    + ++L   D G +
Sbjct: 2740 ITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSH------HQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAEN---EPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLV---TSAFVFDYEQRQRYDMELLASDMGGK 2949          

HSP 11 Score: 65.0846 bits (157), Expect = 3.176e-10
Identity = 75/274 (27.37%), Postives = 128/274 (46.72%), Query Frame = 1
Query: 1441 GKLRSFDKDIDN--NSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERS-SLNLTVYVEDEGNVKR-SSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKND----YIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIAL-VEIKIDDENDNFPVIIFPNFTHNR----LNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK 2211
             +L++ D D +N  NS+V Y +   +++  F I+   G L      D +  + S  L +   D  + +   S     + + D +DN   F   ++V  ++EN  + + V    A DLD+     + YSI    +D     +F +D  SG++T+    D E+  RY ++++A D        M     S+A+ VEI+  DE         P FT       L A++  P    + Q+ +TDSDSG +  ++Y +    SH  FK++R+SG V +K
Sbjct: 2773 AQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD--------MGGKKASVAVRVEIESRDE-------FTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH--FKVNRSSGAVLIK 3029          

HSP 12 Score: 61.6178 bits (148), Expect = 3.980e-9
Identity = 56/235 (23.83%), Postives = 112/235 (47.66%), Query Frame = 1
Query:  349 EIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLV-ETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDS-NKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP 1044
            E+ IE+ D NDN P ++         +G+  G       A D D+   + + Y++ D       V E A +  ++ +++LD E    + L + A++ G+ + + +  I+V IVD+NDN P F     +    + E   + +V+  +SA D D+      ++R+ + + ++ + +  F +   +G++V+++ LDY+   + +   VI  D A       +   + + V D ND  P
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP---NNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYEL-QQEYELDVIASDAAH-----EARTVLTVRVNDENDNAP 2530          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 166.007 bits (419), Expect = 2.549e-41
Identity = 192/745 (25.77%), Postives = 330/745 (44.30%), Query Frame = 1
Query:  193 HFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTI--HEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINN--------KAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSL--NSFF----VLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLN---FYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD----FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSI------------LNP-KNDYI---FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIAL-VEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGM------ENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            +F I+ +SG +R+   K +D E      K+++      ++IQ  LG        ++ IEV D NDN P + +  + +   +    G       A D DS     + Y+L   +        A + ++  S  LD E++ + TL + A++ G+   S++L I V + D+NDNPP+F K  +S N  + E   IN+ ++ ++A+D D+G N   ++RI    ++N           ++F +   +G I +R PLD  R  R+ +   ++      P +  ++  V + V D ND  P+         K   +F + EN  + ++VG +  +D+D  EN  +    L  NS F    V   +STRE          DRE ++ + + +E  DQ   +      + I   + ND              + E  P GT +  ++R+ D+D   N+ + Y + +  + D    F I+   G + +    D EERS   L V   D GN  R +   + + +LD++DN   FT    VF + E++ +  VVGS+  ++   + +  S+            LNP   D I   F ID+ SG L     LDRE    + +++ A D+        S N +S A+ V+I++ D NDN P   +P    + L  S   P    I    +TD+D+G N  L Y +       NE   +   + R   L    +  + LD E    +++ ++  D  +
Sbjct:  874 YFSIETNSGNIRIA--KPLDHEA-----KSQV-----LLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVN--VSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLD--RETRDRYQLTVLATDNGTP-AAHAKTRVIVRVLDANDNDPKF-------QKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPL--------DRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVV-RVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDT------TASNNPQSSAITVKIEVADVNDNAPE--WPQDPID-LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSS 1576          

HSP 2 Score: 147.902 bits (372), Expect = 1.226e-35
Identity = 193/776 (24.87%), Postives = 331/776 (42.65%), Query Frame = 1
Query:   67 KFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILR----LITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL-----SDPTRFFKLVETADNLYI--QNSLMLDSETTSKFTLHLYASNPGIDRSSSLL-IQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNN---KISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVI---FDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENM----PSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD---FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIVYSILNPKNDYI--FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS-------IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            K +V EGV V  +I  +  DF  +     ++ V        +  G++ D  I R    + T   +DRE    Y    I   G  I              + + V D NDN P +   S+++EF +     +++T+  A DLD   ++T  YN+     +D  R     E    LY+  Q S  LD ETT  ++L + A + G       + + +TI D+NDN P+F++  +     +PE+  + + VL + A+D D+  NG   + I+  + + +  + F +   TG I + K LD++    +    V+ +DH   P  L + AFV++ V DVND  P I+   + ++   KIS      E+      V  I  +D D          +LN      +++TR+   IY  ++    DRE    + +S+  TD+     + +K++  L   D +        + Y    M    P  ++L  ++ + D+D   NS + Y L E        F+I+   G + +    D E      LTV   D G    SS   + + I D++DN  +F +  +   ++EN  +   +  V A D D   N +V   +     ++  F +   SG +     LD E+   Y   V+A D              + A++++++ D NDN PV     F       SL + P+ S       I  + +TD D G    + Y +   +   IF+I R++G +F+   +  L V     H++ +   D GN
Sbjct:   83 KLEVFEGVAVDYQIGYI-GDFGGIDSGPPYIIV--------AEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNI-------------RVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFAT--VPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKE--QMFRIDPRTGAIYINKALDFETKELHELV-VVAKDHGEQP--LETTAFVSIRVTDVNDNQPTINVIFLSDDASPKIS------ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDN-SIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIF-LRITDVNDNPPEFEQDLYHANVMEVADPGTSVL--QVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---------GLSTTAMIKMQLTDVNDNRPV-----FYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDM-LSVRTQPMHMLNISATDGGN 804          

HSP 3 Score: 144.436 bits (363), Expect = 1.455e-34
Identity = 172/694 (24.78%), Postives = 293/694 (42.22%), Query Frame = 1
Query:  328 GGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIR-KTIP----TAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSS-LLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFL-PYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV----FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI----LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEAS-------------NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGM---ENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTV 2304
            GG  T   I++++ D NDN P +      V   +      +  + P     A D D   F  + Y +   +    F++  +   +++    ML   T     L++ A++ G  RS++  ++ ++I+D    PP+F K  +  N  + EDIP  +VV  + A   D        + I S   +     YF +++ +G I + KPLD++        +V++   A L    +     VN+ V DVND  P+ +   ++        +V E+      +     +D D   + +V       S    F +++ S      +  +   D E   +H + +  TD        N T+L+    ++DN         S+N     ++ +  I   ++ + D D  NN+++ Y + +A              ++ F I  + G +      DRE R    LTV   D G     +K  + + +LD +DN   F K K+ F I EN    +VVG V A DLD  EN  +   L P N   F +   +G ++T   LDRE  + Y + V A D   P+  A          V I + D NDN P I  P    + ++    QPP   + ++ + D D G+N ++ Y +    + D H +F I  TSG++  +     LD E  S + + +   D GN P+ TV
Sbjct:  693 GGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARY--NYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG----YFSIETNSGNIRIAKPLDHEAKS-----QVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVR-------ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG----HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQII---QVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVP-------VRIHVSDVNDNAPEIADPQ--EDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRV---VLDHEERSIYRLGVAASDGGNPPRETV 1348          

HSP 4 Score: 135.961 bits (341), Expect = 6.179e-32
Identity = 179/727 (24.62%), Postives = 309/727 (42.50%), Query Frame = 1
Query:  340 TIHEIQIEVIDTNDNIPYWNSDSINVEFMD----GDLPGIRKTIPTAIDLDSSVFSTIF------YNLSDPTR-----FFKLVETADNLYIQNSLMLDSETTSKFTLHLYA------SNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRI-----DSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEND----EVFCRSLNSFFVLNSMS-TREQFQIYTTVIFDREQQDKHFVSIECTDQAY---HMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNV----------KRSSKGF-------------IHIVILDMDDNPIVFTKDK-FVFHISENS---VINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNL 2328
            T+  +++EV+D NDN P + S S+     +    G + G    I    D+  +     F      Y L+  T+      F +   + NL +  + +LD E  S+F L + A      +NP   +SS++ +++ + D+NDN P +  P    +  + E  P+ +++   +ATD D+G NG+  +R+       N+   +A+  F M S+TG + ++ PLD++           ++  + +   L +   V L + D ND  P          K ++ F + + T    +V  I+  D D  +N     E+   +    F +NS +   E  +       D E+  +  + I   D        + +N  L++   ++N P F        + EN+PSG+ +           +N +  +      +N  F ++   G + +   FDRE ++S  L VYV D              +RSS                I+I + D++DN   F     +   + ENS   VI+TVV S    DLDE     ++YSI        F ID  SG L+    LDRE+  RY +++ A D   P      K+ +    + I ++D+NDN P      +T +    +   P   S+ QI + D+D G N  L+Y + NE   + F I   SGL+   T    LD E  +++   +   D G     +   P+ +N+
Sbjct: 1347 TVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVV--ARLLDREVQSEFRLEIRALDTTASNNP---QSSAITVKIEVADVNDNAPEW--PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF-ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVAS----DLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQP------KSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDA---PLGTSVVQISAVDADLGVNARLVYSLANETQWQ-FAIDGQSGLI---TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINV 2047          

HSP 5 Score: 135.961 bits (341), Expect = 6.450e-32
Identity = 197/774 (25.45%), Postives = 332/774 (42.89%), Query Frame = 1
Query:   58 SMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--------------SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRS-SSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSL-------NSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI--LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDK--DIDNNS--------QVHYYLHEASNKD-----FKINTHEGTLISLRSFDREERSSLNLTVYVEDE--GNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSI------LNPKNDY---IFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQ----IYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFL 2208
            SM++  V E  ++G  +    +  K+ G + +    L +   K   F I   SG   LI  +++D E    +      +DG    +   L        I ++V D NDN P +  D  +V   +      +     A DLD+   + I Y +              SD ++ F +   +  +Y++  L  D ET  ++ L + A++ G   + +   + V ++D NDN P F K  +     I E++   SVV V++A+D D G N   + R     IN+     F +  VTGEI  R+PLD  R +R  +  V+       P   S+   V + V DVND  P+I       +   +  +V E  P  T V  +   D D  +N  +    +       +  F ++  S      I T V+ D E++  + + +  +D         + L +  LD NDN P F   SL F + E+   G ++ G +   ++  D+  NS        +V Y L+  + KD     F I+ H G L+  R  DRE +S   L +   D    N  +SS   + I + D++DN   + +D     +SE + + T++ +  A D D  T   + Y +      LN   +    +F +D  +G L+  + LD E V  Y + V A D +  + E +    ++   V ++I D ND+ P  + PN +  +  ASLF      I +    I + D DSG+N  L Y +   +    F+I+  +G++ L
Sbjct:  934 SMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGK-GLFAIDARSG--HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNL-------TILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL--DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFR--IEENLRRGSVVGVVTASDLDLGENA--AIRYSLLPINSS----FQVHPVTGEISTREPLD--RELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEI------ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSG----VIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVV-GSISPIERPADVVRNSVEESFEDLRVTYTLNPLT-KDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERL----QTSVTVRLRILDANDHAPHFVSPNSSGGK-TASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIEL 1667          

HSP 6 Score: 119.783 bits (299), Expect = 5.979e-27
Identity = 212/826 (25.67%), Postives = 351/826 (42.49%), Query Frame = 1
Query:   52 SKSMLKFKVDEGVQVGTEIADLT--------------SDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLV----ETADNLYIQNSLM--------LDSETTSKFTLHLYA----SNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEP----IPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPL-----DYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEND----EVFCRSLNSFFVLN----SMSTREQFQ-----IYTTVIFDRE------------QQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXS-LNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEAS-NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVIL--DMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDS--HKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVC--DSGNQPKCTV 2304
            + S L F+V E   +G  +  ++                F++L +T     +   +D   + F I   SG   L+  + +DREV  E+ + +I +    +D         +   ++IEV D NDN P W  D I+++  +    G      TA D D+     + Y L    R+F  +    E A +L+  +SL         LD E   ++ L + A    SN      +S+ +++ I+D ND+ P F  P  S  +     I +   I  VV  + A D DSG NG+ ++ I       +    F + S TG I + K L     D ++G R F   +  +DH   P    S   ++L V   ++  P+    A+    I      LEN P  + V  +    +   EN     E+     N  F ++     ++TR QF       Y   ++ R+            ++ +   SI  T    H +     + + D NDN P F P S     + EN   G I T  + + D D   N+ + Y +   +    F I++  G L S R  DRE+ S   L +   D G  K S +G  +I I   D +DN   F   K+   + E++ + T V  + AVD D      +VYS+ N +  + F ID  SG++TT   LDRE    Y   V+A D          +   +   V+I + D NDN P  IF  + +     +L QP + ++ ++ + D+D G N  ++Y +  E+S     F+I+ ++G +   + + +L  E  S  ++ L+V   D GN P+ ++
Sbjct: 1366 TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPL--TKDLIEAAFDIDRHSG--NLVVARLLDREVQSEF-RLEIRA----LDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRL---IRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR----FRINSQTGIIELVKSLPPATEDVEKGGR-FNLIIGAKDHG-QPEPKKSSLNLHLIVQGSHNNPPRF-LQAVYRATI------LENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHT--VVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPK-SRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-ETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDG------GRYEVRSATVPVQINVLDINDNRP--IFERYPYIGQVPALIQPGQ-TLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGAL---SASQSLASE--SGKLLHLEVVARDKGNPPQSSL 2147          

HSP 7 Score: 100.523 bits (249), Expect = 5.005e-21
Identity = 162/682 (23.75%), Postives = 288/682 (42.23%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYW----NSDSINVEFMDGDLPGIRKTIP--TAIDLDSSVFSTIFYNLS--DPTRFFKLVETADNLYIQNSL---MLDSETTSKFTLHLYASNPGID--RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAF----------------------VNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMT---NDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAY---HMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVK-RSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYI---FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQT-LIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFST 2250
            +++ ++D ND+ P++    +S          D   I + +    A+D DS     + Y ++  +    F++      + +  SL     D E   +F L + A + G    + SSL + + +   ++NPP F + ++     I E++P  S VL ++A       N   S+ I +   N    + F +    G I  R   D +    ++   V V D A    +LSS A                       + +TVGDVND  P+         +  + + +  + P+N+  G I T   +D+D   N ++   S+    + N  S        +    DREQ  ++ + I+ +D+        + N T+ + D NDN P F        + E+ P GT +  ++ + D D+  N+++ Y L   +   F I+   G + ++   DRE ++S N  V   D G  + RS+   + I +LD++DN  +F +  ++  +         +  VQA+D D      IVYS LN +N  +   F I+  +G L+ +  L  E      ++VVA D   P +        S+ L+E+ I +     PV+ F N T+ R+      P    + Q+ +  SD    +    +G  NED   I  +   SG + +   +  LD + FST
Sbjct: 1588 VRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRAT--ILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN----DLFHVDWQRGIITTRGQFDRE-SQASYVLPVYVRD-ANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF--------RPGSCYGL--SVPENSEPGVIHTVVASDLDEGPNADLI-YSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV-QISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYS-LNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQS-------SLGLIELLIGEAPQGTPVLRFQNETY-RVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDG--ILSLDSLSGEIRVNKPHL-LDYDRFST 2237          

HSP 8 Score: 77.411 bits (189), Expect = 5.473e-14
Identity = 72/302 (23.84%), Postives = 142/302 (47.02%), Query Frame = 1
Query: 1435 LTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKIN-THEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE-NTIVY-----SILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVI----------IFPNFTHNRLNASLFQPPEKSIFQIYSTDSDS-GENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
               ++ +FD D  +N+++ Y++ + ++ + F I     G + +    DRE R    L +   DEG  + +    I + I+D++DN   F  +  V  +SE + +  V+ S+ A D+D    + Y     S ++ +N  IF +D++SG L     LD E    Y + V+A D+           +++  ++ ++++DENDN PV           I P  +    + S+    +  +  + +TD+DS G N  +IY +  E + + F +H ++G+V +        V     + +++   D+G
Sbjct: 2340 FVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA----------HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSV----DFDLLTVNATDADSEGNNSKVIYII--EPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG 2624          

HSP 9 Score: 68.1662 bits (165), Expect = 3.673e-11
Identity = 64/220 (29.09%), Postives = 103/220 (46.82%), Query Frame = 1
Query: 1657 IVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLID-KFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENE---DSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            I + D +DN   F++ +FV  +SE +   T V  V A D D  +   + Y I++  +D  F+I+  FSG++ TN  LDRE  D Y +K++A D  +P            A + ++I D NDN P   FP   +N +  S        I  I + D D+    T   G E+    ++  IF + R SG + LK     LD E    + + +   D+ ++ +
Sbjct: 2310 IELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVP-------QMTGTATIRVQIVDVNDNQPT--FP--PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLK---RRLDYELQQEYELDVIASDAAHEAR 2515          

HSP 10 Score: 68.1662 bits (165), Expect = 3.673e-11
Identity = 65/222 (29.28%), Postives = 105/222 (47.30%), Query Frame = 1
Query: 1657 IVILDMDDN-PIVFTKDKFVFHISENSVINTVVGSVQAVDLD-ENT----IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREK-VDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGM----ENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQ 2289
            I ILD +DN PI     K+   ISE + +   +  +QA+D D ENT    +VY I +  ++++F ID  +GVL  N+ LD +     Y + + A DS+        +   S+    +++ DENDN P      + H        +P   S+F+ +++D D G    L Y +     +E S K+F++   SGLV   T     D E    + ++L   D G +
Sbjct: 2740 ITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSH------HQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAEN---EPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLV---TSAFVFDYEQRQRYDMELLASDMGGK 2949          

HSP 11 Score: 65.0846 bits (157), Expect = 3.176e-10
Identity = 75/274 (27.37%), Postives = 128/274 (46.72%), Query Frame = 1
Query: 1441 GKLRSFDKDIDN--NSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERS-SLNLTVYVEDEGNVKR-SSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKND----YIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIAL-VEIKIDDENDNFPVIIFPNFTHNR----LNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK 2211
             +L++ D D +N  NS+V Y +   +++  F I+   G L      D +  + S  L +   D  + +   S     + + D +DN   F   ++V  ++EN  + + V    A DLD+     + YSI    +D     +F +D  SG++T+    D E+  RY ++++A D        M     S+A+ VEI+  DE         P FT       L A++  P    + Q+ +TDSDSG +  ++Y +    SH  FK++R+SG V +K
Sbjct: 2773 AQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD--------MGGKKASVAVRVEIESRDE-------FTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH--FKVNRSSGAVLIK 3029          

HSP 12 Score: 61.6178 bits (148), Expect = 3.980e-9
Identity = 56/235 (23.83%), Postives = 112/235 (47.66%), Query Frame = 1
Query:  349 EIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLV-ETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDS-NKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP 1044
            E+ IE+ D NDN P ++         +G+  G       A D D+   + + Y++ D       V E A +  ++ +++LD E    + L + A++ G+ + + +  I+V IVD+NDN P F     +    + E   + +V+  +SA D D+      ++R+ + + ++ + +  F +   +G++V+++ LDY+   + +   VI  D A       +   + + V D ND  P
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP---NNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYEL-QQEYELDVIASDAAH-----EARTVLTVRVNDENDNAP 2530          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 163.696 bits (413), Expect = 1.584e-40
Identity = 180/727 (24.76%), Postives = 325/727 (44.70%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTR--FFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLP-YSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIF-----DREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXX--------SLNFYLYENMPSGT---ILTGKLRSFDKDIDNNSQVHYYLHEAS--------NKDFKINTHEGTLISLRSFDREERSS-LNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS-----IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVS 2430
            I I V+D NDN P +   S  V  ++    G       A D D  V S + +++S   R   F +     +LY+   L  D E  + +TL++ AS+ G    S+++L  V +VD NDNPP+F      R   I E IP+ + ++ ++A D DSGLNG+ S+ I   +       +F + + TG I   + +D +  +  F   V+  D A      LS+E  V + V D+ND  P   F ++    +  +F+  + +  +T V  +   D D + N       L ++ +++      + Q  T +I        +Q+ ++ ++++ TD+A      +  + I                      L+  +YEN P GT    +T  L S        +++ Y++   +        ++ F I+   G L +    DRE       + VY    G   R+S+  + + +LD +D+P  F    FV+++SE+  I   + +++A D D    V  +L   +D  FL++  +G L  N  LDRE   +Y +++   D     E          A   I++ D NDN P  +F +  ++      F  PE +     + QI + D+D G+N  L YG+ ++ ++ +F ++  +G++ L    + LD E    +++ ++  D+G QP  +    +Y N+  D   N  + +      ++F    I T ++TVS
Sbjct: 1370 ITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPL--DYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQ--IKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRE-SIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPV--FVSMNAAILPPKFSTSKGS--STAVMQVHAKDADSSSN------GLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLAS--------AEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTE----------AYATIQVSDTNDNPP--LFEDTVYS------FDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTL---TARLDYEEVQHYILIVQAQDNG-QPSLSTTITVYCNVL-DLNDNAPIFDPMSYSSEVFENVPIATEVVTVS 2050          

HSP 2 Score: 145.591 bits (366), Expect = 5.646e-35
Identity = 165/690 (23.91%), Postives = 305/690 (44.20%), Query Frame = 1
Query:  349 EIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLD------SSVFSTIFYNLSDPTRFFKLVETADN------LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLF--SRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDR--------GMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDF-YAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCR--SLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNF--YLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASN-KDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT--IVYSILNPKNDYI----FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHN--------RLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQ 2289
            E++I+V+D NDN P +   SI + F +    G R  +  A D D      +  +  +  N+ +    F+LV TA+       L+++ +  LD E+   + L++ A + G   R   L + VTI+D+NDNPP+F    +  S NE     +P   VV V+ A+D D G N + ++ +   +        F +   TG I   + ++  +          ++  F V   DH           +V + + D ND  P I F +     K++    V EN    T+V  +   D D   N     R  S N           +   +    + DRE+  K+ +++   DQ          L+I  ++ ND     +   +   L E  P+G+ +   + + D+D   N+QVHY +   +  K F ++   G +++    DRE R ++ L++   D G   + +   + ++ILD +D    F++ +    + E++   T+V  + A D D+ T   V   L P  + +    F +D  +G LTT   LDREK+ +Y I V+A D   P  ++      + A V + + D NDN P     ++ ++        +L   + +  E+ +  + ++D D G+N  + Y +E+     +F++   SG + L+ G++   + +   + + +   D+G +
Sbjct:  141 EVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNK---FRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETA---LPGTPVVTVM-ASDNDLGDNSKITYYLAETE------HQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSP--RQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVAT---VDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVA-SITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQS------ATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEK--ERILLHVTASDKDDGDNALIEYRLES-GGEGLFQLDARSGAISLR-GDAPASMHWKPHYKLLVSARDAGQR 801          

HSP 3 Score: 143.28 bits (360), Expect = 3.593e-34
Identity = 207/801 (25.84%), Postives = 347/801 (43.32%), Query Frame = 1
Query:   55 KSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEF----VSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGS--LTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEND----EVFCRSLNSFFVLNSMST--------REQFQIYTTVIFDREQQDK--HFVSIECTD----------------------QAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD--------FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGE-NQTLIYGMENEDSHKIFKIHRTSG-LVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
            +S L   V E   +GT I  +T+   +  I  E+    V+    R      F I    GIL   T   +DRE   E  + ++ +        I LGG    +  ++++ V+D ND+ P +  D+  V  +  DL  I  TI T    D     ++ + L D      L+E +    I N   LD ET SK+ L +  S+ G+  + +    + + D NDNPPLF   ++S +  IPE+      V  + A D D G N + S+ + S+  N    + F +   TG + +   LDY+  ++++   V  +D+     SLS+   V   V D+ND  P  D        +S    V EN P  T V  +   D+D   N      +    ++S F ++S  T        RE    YT  +  R+  D+   F  +E T                       +   ++   K  +++ D +++   F  +    + EN+   T++   +++ D D   N  + Y + EA ++D        F +N  +G L  + + DRE RSS  L +   D G   +S++  + I ILD +DN  VF   ++   ++EN+ I  +V  V A D+DE     I YSI+    ++ F I + +GV+     L+ E++ RY + V A D       A+       A + I I D NDN P  +   +   R+  +   P    +  + + D+D+   N  + Y ++  DS  +F+I+ +SG +  LK     LD E  S + + L   D+G+ P
Sbjct: 1716 RSKLSGSVYENEPIGTSILTVTAHLASAEI--EYFVTNVTATGSRGQVDRLFDIDAKLGILS--TAAELDREAGPEEYEVEVYA--------IALGGQPRTSRTKVRVTVLDKNDSPPQF-LDTPFVYNVSEDLQ-IGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILND-TLDRETKSKYELRIRVSD-GVQYTEAYAT-IQVSDTNDNPPLFEDTVYSFD--IPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWAN----DVFSLNPQTGMLTLTARLDYEE-VQHYILIVQAQDNGQP--SLSTTITVYCNVLDLNDNAPIFD-------PMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIA-VKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDC------ALENPAGDTAELTINILDINDNRPTFLDSPYLA-RVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDS-DLFRINASSGDIALLKP----LDREQQSEYTLTLVAMDTGSPP 2470          

HSP 4 Score: 142.51 bits (358), Expect = 6.394e-34
Identity = 155/627 (24.72%), Postives = 282/627 (44.98%), Query Frame = 1
Query:  661 LIQVTIVDINDNPPLFSKPLFSRNEP---IPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTR-----EQFQIYTTVIFDREQQDKHFVSIECTD--QAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDRE-------------ERSSLN---------LTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVS 2430
            ++ + I+D+NDN P+F+  L   +EP   +PE+  +   + +    DRD+G+N   S+      + N   + F +  VTG + +++P+  + G      +++  D       LSS+  +++ + DVND  P  D         S + ++ E T  NT    +   D+D  +N  +      S+ ++   + R         ++     DRE++D + +++ C D  Q    + +   + ++D+NDN P F   +  F + EN P+ T + GKL + D+DI  N+++ + L  +  +DF I+T  G + +LR FDRE             E  SL          L   V D G  +   K  + +++ D++DN   F +  +   ISE +   T +  V   D DE     + YS+        F +D  +G L+    LDRE  + + + VVA D+   ++  +S N    A + I + DENDN      P FT +    S+ +  P    + +  ++D+D G N  +++ +   +    F I   +G ++L   +  LD E  +++ + +   D G     T    LY  L  D   N  +  +T   ++I     + T I+TV+
Sbjct:  927 IVNIAIIDLNDNAPVFA--LDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISY-----SLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSL-IHVELMATDAGSP--PLSSKLSLSVLIADVNDHTPVFDH-------TSYETSLPETTKVNTRFFALAATDIDLGDNGRI------SYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFV-GKLTAVDRDIGRNAELSFTL-SSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAA--LKHPLSSN----ASITIVVLDENDN-----APEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYL---HKPLDYEDITSYTLNITASDCGTPSLSTTV--LYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVT 1512          

HSP 5 Score: 140.198 bits (352), Expect = 3.273e-33
Identity = 170/668 (25.45%), Postives = 284/668 (42.51%), Query Frame = 1
Query:  364 VIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDY---------------DRGMRN------FFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQF-------QIYTTVIFDREQQDKHFVSIECTDQAY-HMNYINK--TLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSILN-----PKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP-------PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTG 2217
            + D ND+ P ++  S      +      R     A D+D      I Y +   +  R F +       Y+     LD E    + L +   + G   RSS + + + ++D NDN P F+   F+ +  IPE+ P ++ V  L+A DRD G N E SF + S        + F + +  G I   +P D                D  +R          +  V D+  +P  L  +  V + V DVND  P+         +      + E   + T +  + T D D   N +V       ++ L   +   QF       Q+      DRE Q+ H + +   D A  H    N   T+++LD+NDN P F   S    + E  P+GT L  + R+ D D   NSQV + +   + +D F I++  G+L   +  D E+ +S  L +   D G    S+    +++++D +DNP +F     V  I E   + T + +V A D D      + Y+I       P+  + F I+  +GV+ T   +DRE +D + + VVA D   P E  +S       LV + ++D NDN PV +        +NA++  P          ++ Q+++ D+DS  N  + Y + +    ++FK+ R +G++    G
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDG---YLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFS--IPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQ------TQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNG-IP-RLQDKVKVKVIVTDVNDNAPEF-------LRAPYHVTISEGASEGTHITHVFTQDADEGLNGDV-------YYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELM-RFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRH-FGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEK----LVTVIVEDINDNAPVFV-------SMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVS-GPQELFKLQRNTGIITFTPG 1665          

HSP 6 Score: 117.857 bits (294), Expect = 2.459e-26
Identity = 142/548 (25.91%), Postives = 238/548 (43.43%), Query Frame = 1
Query:  649 SSSLLIQVTIVDINDNPPLFSKPLFSRNE-PIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNK---INNKAIEYFIMKSVTGEIVVRKPLDYDRGMRN-FFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFA--VLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVI-----FDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMP------SGTILTGKLRSFDKDIDN-NSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHN-----RLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK 2211
            SS++ + + I D+ND  P+F     S NE  I E++ IN+VV+ + A D D G NG   + +   +   +       F +    G++ V   LD  R +R+ +   +   D    P S  S+  + +   D ND  P  D           Q++  V EN     +V  +   DVD   N  +         VL   +        T V+      + E+  ++ +++   D A      +   L ++  D +        + YL   M        G +LT  + ++D D    NSQV Y+L E  +  F+IN   G +  L+  DRE++S   LT+   D G+   +  G + + + D++DN  VF    +   + EN    T V + +A D DE     + +++L  ++ + F ID  +G ++T + LDRE+   Y + ++A DS+I    A S N      + I + D NDN P   F + T+N     R++   F      +F   + D D GEN  + Y +   D H  F I+  +G+V  K
Sbjct: 2148 SSTVKVTILIKDVNDEVPVF----ISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALD--RELRSSYLLNITARDRGEPPQSTESQLLIRIL--DENDNSPVFD---------PKQYSASVAENASIGAMVLQVSATDVDEGANGRI-----RYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLT--VNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLG-EHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVN------LTISVSDVNDNIPK--FDSTTYNVAVPERISKGEF------VFGARALDLDDGENAVVHYTISGRDQH-YFDINTKTGVVSTK 2655          

HSP 7 Score: 114.775 bits (286), Expect = 2.371e-25
Identity = 179/663 (27.00%), Postives = 278/663 (41.93%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSD---SINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLS-DPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMS------TREQFQIYTTVIFDREQQDKHFVSIECTDQ------AYHMNY------------------INKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDN--NSQVHYYLHEASNK-DFKINTHEGTLISLRSFDREERSSLNLTVYVEDEG-NVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSH----KIFKIHRTSGLV 2202
            + I +ID NDN P +  D      +   +    G    +    D D+ V S I Y+L+ +P + F++      LY+Q  +   +E  S   + L A++ G    SS L + V I D+ND+ P+F    +  +  +PE   +N+    L+ATD D G NG  S+ I          E        G + VR PL  DR  R+++   +    A  P S SS   V + V D ND  PQ       N+  +  F++ EN P +T VG +   D D   N E+        F L+S +      TR  F I T   FDRE   K   + E + +      +   NY                  +   +++ D NDN P F     +  + E    GT +T     F +D D   N  V+Y L + +    F +++  G L   R  DRE +   +L V  +D       SS   I IV+LD +DN   FT+      + E S   T +   +A D D+     +V+SI        F ID  +G L  +  LD E +  Y + + A D   P   ++S    +  L  + + D+NDN P  IFP+    R       P +  I  + + D DSG N  + Y +  ++      + F I+  +G++
Sbjct:  928 VNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIR--AEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETS--LPETTKVNTRFFALAATDIDLGDNGRISYEIIEGN-----TERMFGVFPDGYLFVRAPL--DREERDYYALTVSCRDAGQP-SRSSVVPVVIHVIDENDNAPQ-----FTNSTFT--FSIPENAPADTFVGKLTAVDRDIGRNAEL-------SFTLSSQTQDFTIDTRNGF-IKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHIT---HVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTP---SLS----TTVLYNVLVVDDNDNPP--IFPSTAIVRQIKEGI-PLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVI 1550          

HSP 8 Score: 112.849 bits (281), Expect = 7.675e-25
Identity = 212/815 (26.01%), Postives = 342/815 (41.96%), Query Frame = 1
Query:   70 FKVDEGVQVGTEIADLTS-DFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL-SD-PTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHA------------------------------FLPYS----LSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEN-----------DEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLL--ILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEA-SNKDFKINTHEGTLISLRSFDREERSSLNLTVYVED---EGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVI--NTVVGSVQAVDLDE---NTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG-NQPKCTVFHPLYVNLT 2331
            + V E +Q+G  I+ L + D   LG  T F+ +++  D K   F ++  +G  +LI    +DRE   +YE     SDG +           T     I+V DTNDN P +     + +  +    G +     A D D    + + Y + SD     F L      L +  +  LD E    + L + A + G    S+++ +   ++D+NDN P+F    +S    + E++PI + V+ +SA D DSG NG   + I +  ++++    F + S  G I  R+ LD +     +   V   D A                              FL +     LSS   V + + DVNDE+P   F +      +N+ A++EN   NT+V  +   D D   N           DE   +S    F LN        Q+      DRE +  + ++I   D+          LL  ILD+NDN P F P   +  + EN   G ++  ++ + D D   N ++ Y +     N DF I+   G +   ++ + E  S  +LTV  ED   E     +++  + I ILD++DN   F    ++  + EN+V      V +V A D D    N+ V   L   +  +F I+  SG +     LDRE+   Y + +VA D+  P             +V +++ D NDN PV    ++ H  +  +L  P    +    +TD D G N  L + +  E  H+ F I   +G +   T    LD E  S + + L   DS   +P+ +      VNLT
Sbjct: 1830 YNVSEDLQIGHTISTLRAHDPDTLGSVT-FL-LMDGHDGK---FLLEPSTG--KLILNDTLDRETKSKYELRIRVSDGVQ----------YTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTL--TARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSE--VFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSE----FGIDS-NGTIRTRRNLDREH-RSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPV--FIS------ANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDG----QLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVL-QVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAE--LTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGT-------GIVRVEVQDINDNDPVFELQSY-HATVRENL--PSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR-FHIDSETGEISTAT---TLDREETSVYHLTLMAQDSSITEPRAS-----SVNLT 2583          

HSP 9 Score: 105.145 bits (261), Expect = 1.931e-22
Identity = 132/537 (24.58%), Postives = 236/537 (43.95%), Query Frame = 1
Query:  466 AIDLDSSVFSTIFYNLS--DPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSL-LIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVG--DVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQI-------YTTVIFDREQQDKHFVSIECTD-QAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDI-DNNSQVHYYLHEAS-NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD----ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDN 2010
            A D D+     + Y++S  +  + F + E    + IQ    LD +   ++ L++   + G    SS+ ++ + + D+NDNPP+F+   +     IPE+ P+ + V    A D+DS  N    +    +  +     +FIM    G I      DY+   R +  ++  ++    P S S E++ NL V    VN+  PQ              F V E +   T VG +   D D  E+  V+       ++L   S  + F+I       Y     DRE Q++  +++   +  +   N  ++  +I+   D +        ++Y   + E  P GT +T  +++ DKD+   N+Q  Y +   +  + FKI+   G + +    DREE S+ NL +   D G   ++    +HI + D++DN   FT +    +ISEN    T + ++ A D D         Y ++  K+     +D+ SGV+ + +  DRE            ++ I +E++     KS  L+ I + D+NDN
Sbjct: 3253 ATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQ--QLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCY--IPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDR---HFFIMNQSNGTISSAVSFDYEE-RRIYTLQIKAKN----PDS-SMESYANLYVHVLGVNEFYPQFLQPVFH-------FDVSETSAVGTRVGAVQATDKDSGEDGRVY-------YLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIK-HYYTSTISEAAPVGTKVT-TVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTP-------ILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          

HSP 10 Score: 102.834 bits (255), Expect = 1.084e-21
Identity = 164/677 (24.22%), Postives = 284/677 (41.95%), Query Frame = 1
Query:  340 TIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYN--LSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTI--VDINDNPPLF-SKPLFSR--NEPIPEDIPINSVVLVLSATDRDSG-LNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTR-----EQFQIYTTVIFDREQQDKHFVSIECTDQAY---HMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLT----VYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNS-YLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPV---IIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            T  ++ I ++D NDN P ++    +    +    G      +A D+D      I Y+  L D    F + E  D   ++ +  L+ E  S+++L + A +  ++  +    ++TI  +DINDN P F   P  +R     +P   P    VL ++A D D+  LN +  + +          + F + + +G+I + KPLD ++    +   ++  D    P  L+    V + V D+ND  P    + +Q    S    V EN P  T V      D D   N ++       F +L     R     E  +I T    DRE+   + +++   D +      + +N T+ + D NDN P F   + N  + E +  G  + G  R+ D D   N+ VHY +       F INT  G + +      + +S  +LT    +   D+G    SSK  + +++   +  P         F +SE+     ++  V A    +     I Y+I          +D  SG+L+     LD E    Y I + A D + P       + +S+ L+ + + D NDN PV   +I+        NA + +   P + I  + ++D DSG+N  +IY ++N D    F+I   SG ++ +     LD E    +   ++  D G
Sbjct: 2260 TESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISE--DTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVP---PNGGYVLTVNAYDADTPPLNSQVRYFLKEGDS-----DLFRINASSGDIALLKPLDREQ-QSEYTLTLVAMDTGSPP--LTGTGIVRVEVQDINDNDP---VFELQ----SYHATVRENLPSGTHVLTPRATDKDEGLNAKL------RFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGA-RALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTP-------SLRSVTLITLNVTDANDNAPVMEQLIY--------NAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQN-DFDGTFEITE-SGEIYTRM---RLDREEIGDYAFVVEAVDQG 2889          

HSP 11 Score: 102.449 bits (254), Expect = 1.375e-21
Identity = 141/603 (23.38%), Postives = 266/603 (44.11%), Query Frame = 1
Query:  463 TAIDLDSSVFSTIFYNLSD-PTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRD-SGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPL-----DYDRGMRNFF-FKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP---QIDFYA-IQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSG-TILTGKLRSFDKDIDNNSQVHYYLHEASNK-DFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIVYSILNPKND--YIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFL 2208
            T+ DLD    +   Y+ S+ P   F++   + N+ +     LD E   ++ L + AS+ G  R+ +  I +TI D NDN P F    +S +   PE     ++V  + ATDRD  G N   S+ +       +    F +   TGE+  +K +      Y R   N +   V+  D+   P  L SE  VN+ + D ++  P   Q ++ A +  + +  Q  V  +      +G   TN++D++    +   +L+S F +     R    I            ++ + +  TD+       ++T +++     +      S+N Y   + EN P G TILT  + + D D   N  + Y +   + + DF ++   G ++  +  D +     +L + V+D G    SS   + I++ D++DNP VF   ++  +I EN  + T V    A D D  +N I++    P     + F++++ +G +++    D E+   Y +++ A + +  +E        S A + + +   N+ +P  + P F     + S        +  + +TD DSGE+  + Y +    + K F+I   +GL+++
Sbjct: 2935 TSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAG--HLDREQQDEYILKVVASD-GAWRAETP-ITITIQDQNDNAPEFEHSFYSFS--FPELQQSIALVGQIIATDRDKQGPNSVISYSL------QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPP--LYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLG---TNEMDYS----LMTFNLSSIFSVG----RHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQS-DETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILT--VGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSME--------SYANLYVHVLGVNEFYPQFLQPVF---HFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYV 3498          

HSP 12 Score: 97.8265 bits (242), Expect = 2.921e-20
Identity = 145/598 (24.25%), Postives = 255/598 (42.64%), Query Frame = 1
Query:  583 LDSETTSKFTLHLYASN---PGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFA--VLENTPKNTLVGFIMTNDVDFNENDEV---FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYE--NMPSGTILTGKLRSFDKDIDN-NSQVHYYLHEASNKDFKINTHEGTLISLRS-------FDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQA---VDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKI-HRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTV 2304
            LD E T  + + + A++   P +   S  LI + + D NDN P+  + L    E + E+ P   ++ V+ A+DRDSG NG   +R+     N+    + I +S  GEI  R  LD +  + ++ F V   D   +P+ ++  A V L + D ND  P          K +  F+  V EN    + V  + ++D+D   N      F  +    F +   S      I      DREQQD++ + +  +D A+      +T + +   D +        +FY +    +     L G++ + D+D    NS + Y L + S   F I+   G + S ++       + R   +   LTV   D G     S+  ++I I+D  +NP  F + +++  + +++V    +  V A    DL  N + YS++      IF + +  G +T    +      RY + V A D  +P +   ++       V I +  EN     +  P F+ N     + +  P   +I  + +TD D+G N  L Y +   +  + F +  RT G+V  +     LD +    + + + V D G  P  +V
Sbjct: 2768 LDYELTHLYEIWIEAADGDTPSL--RSVTLITLNVTDANDNAPVMEQ-LIYNAEVLEEESPPQ-LIAVVKASDRDSGDNGNVIYRLQ----NDFDGTFEITES--GEIYTRMRLDREE-IGDYAFVVEAVDQG-VPH-MTGTASVLLHLLDKNDNPP----------KFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSG----NITVAGHLDREQQDEYILKVVASDGAWRA----ETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPM-FSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETR-------VVIVVTGEN-----MDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQ----QLDYDLIQEYHLNITVQDLGYHPLSSV 3317          

HSP 13 Score: 95.1301 bits (235), Expect = 2.315e-19
Identity = 145/640 (22.66%), Postives = 269/640 (42.03%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLS-DPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR---SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQID--FYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSM--STREQFQ----IYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKL---RSFDK-DIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGM--ENEDSHKIFKIHRTSGLV 2202
            I + V D NDN P       N E ++ + P     +  A D DS     + Y L  D    F++ E+ +   I   + LD E    +   + A + G+     ++S+L+   ++D NDNPP F++ LFS N  + E+  I S V+ ++++D D G N   S+    N       E F ++  +G I V   LD ++    +  KV+  D A+      +E  + +T+ D ND  P+ +  FY+    ++    A         LVG I+  D D    + V   SL     + S+  +T E F      +    + R  ++ + +++  TD      Y ++ L+ ++  D            YL   +P   +   ++    + DK D+  N   +  +    +  F +  H+G +  ++       +   L V   D G   +S +  + IV+   + +   F+ + +   + EN  + + + +V A D D      + YSI        F +D+ +G +     LD + +  Y +       NI +++       S+A++ I + D NDN PV     F H   +  + +  P    +FQ ++ D DS +N  + Y       D H  F +++++G +
Sbjct: 2796 ITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGE---IYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLH--LLDKNDNPPKFTR-LFSLN--VTENAEIGSFVIRVTSSDLDLGANANASYSFSENP-----GEKFRIEPQSGNITVAGHLDREQ-QDEYILKVVASDGAW-----RAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIA---------LVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLY-SECLVNINIVDAHNNPPKFEQAEYLAP-LPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHL-------NITVQDLGYHPLSSVAMLTIILTDVNDNPPV-----FNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRH-FFIMNQSNGTI 3392          

HSP 14 Score: 92.4337 bits (228), Expect = 1.386e-18
Identity = 171/728 (23.49%), Postives = 303/728 (41.62%), Query Frame = 1
Query:  196 FGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLP---GIRKTIPTAIDLDSSVF-STIFYNLSDP-TRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLT--VGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV---FCRSLNSFFVLNS----MSTREQFQ---------IYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTL-ISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFP--VIIFP-NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            F I  D+G++R+   KN++ E +  Y    + ++ C ++       +    E+ I ++D NDN P +         M+  +P   G   T+  A D D+    S + Y L +  +  F++  ++ ++ +   L  D E  S++TL L A + G    + + +++V + DINDN P+F   L S +  + E++P  + VL   ATD+D GLN +  F +    ++      F + S TGEI     LD +     +   ++ +D +      SS   VNLT  V DVND IP+ D         +   AV E   K   V      D+D  EN  V          +F +N+    +ST+ + +          YT VI   +Q ++   S               T+++        + +  + +F + E++  G ++T K+ +         ++ Y +      D  +++ + G L +     D E      + +   D       S   I + + D +DN  V  +  +   + E      ++  V+A D D      ++Y + N   D  F I + SG + T   LDRE++  Y   V A D  +P       +    A V + + D+NDN P    +F  N T N    S        + ++ S+D D G N    Y   +E+  + F+I   SG + +     +LD E    +++K+   D  
Sbjct: 2326 FSISEDTGVVRVA--KNLNYERLSRYSLT-VRAEDCALE-----NPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTV-NAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPL--DREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFE--LQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR-----FHIDSETGEISTATTLDREE-TSVYHLTLMAQDSSITEPRASS---VNLTISVSDVNDNIPKFD-------STTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSS-----------KAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMIT-KVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQN-DFDGTFEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGVP-------HMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSF-------VIRVTSSDLDLGANANASYSF-SENPGEKFRIEPQSGNITVA---GHLDREQQDEYILKVVASDGA 2992          

HSP 15 Score: 88.9669 bits (219), Expect = 1.855e-17
Identity = 178/792 (22.47%), Postives = 314/792 (39.65%), Query Frame = 1
Query:   52 SKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHE----------------IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRF--FKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR--SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCR--------SLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNY---INKTLLILXXXXXXXXXXXXSLNFYL----YENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEG--TLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDN----PIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILN-------PKNDYIFLIDKFSGVLTTNSYLDREK-VDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDS 2280
            + S   F + E     T +  LT+  +++G   E    L+    +   F I   +G ++  TL+  DRE + +  +N   + G    ++  + G+  + E                +++ V D NDN P +     +V   +G   G   T     D D  +   ++Y+L+       F L      L +     LD E+     L + A +  +    SS+  I + ++D NDN P F++   S    + E  P  + ++   A+D D G+N +  F I +    +     F + S+TG + + KPLDY+  + ++   +   D      SLS+    N+ V D ND  P     AI          + E  P  T +  +  +D D   N +V                F +N+    E   I+T    DRE  D   +++  TD+A          K + ++ ++ ND      S+N  +    +      +    ++ + D D  +N  V Y +     + FK+  + G  T      F +E R  L L    E   + +RSS+ +I I+      +    P    + K    + EN  I T + +V A  L    I Y + N        + D +F ID   G+L+T + LDRE   + Y ++V A            +   S   V + + D+ND+ P  +   F +   N S       +I  + + D D+  + T +  M+  D    F +  ++G + L   N  LD E  S + ++++V D 
Sbjct: 1154 TNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSS---QTQDFTIDTRNGFIK--TLRPFDREALVKVSRNA-EASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSL--GRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQ--SSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDT----FHIDSITGSLYLHKPLDYED-ITSYTLNITASDCGTP--SLSTTVLYNVLVVDDNDNPPIFPSTAIVRQ-------IKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINT----ETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA-HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAI-------ALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVY---NVSEDLQIGHTISTLRAHDPDTLGSVTFLL-MDGHDGK--FLLEPSTGKLIL---NDTLDRETKSKYELRIRVSDG 1900          

HSP 16 Score: 88.5817 bits (218), Expect = 2.293e-17
Identity = 121/457 (26.48%), Postives = 199/457 (43.54%), Query Frame = 1
Query:  340 TIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQ-FQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXX--XXSLNFYLYENMPSGT-ILTGKLRSFDKDID-NNSQVHYYLHEASNKDF-KINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNP 1686
            ++  + I + D NDN P +N    +    +    G       A D DS   + I Y    S P R F  +    N  I +++  D E    +TL + A NP     S   + V ++ +N+  P F +P+F  +  + E   + + V  + ATD+DSG +G   + +  +  N+K    F + + TG I V + LD +   R     V+ +++  +  + + EA V +++ D ND    I  Y            + E  P  T V  +   D D    +  F  S+ +  +  S     Q  +I T    DRE+   + + I   D        + T+ I  ++ ND      P+ LN Y+ EN P+GT I+T  L + D D+  N     Y L    +K +  ++ + G + S  SFDRE    L   + VED G  K+ S+  + I +LD +DNP
Sbjct: 3316 SVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHF-FIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFD--VSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSS-NDKG---FRIDTNTGLIYVARHLDRETQNR-VVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTST--------ISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMT--LIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNP 3754          

HSP 17 Score: 68.1662 bits (165), Expect = 4.207e-11
Identity = 111/448 (24.78%), Postives = 181/448 (40.40%), Query Frame = 1
Query: 1081 SNQFAVLENTPKNTLVGFIMTN---DVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD--FKINTHEGT--------LISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVD---LDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLD---------REKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFT---------HNRLNASLFQPPEKSIFQIYSTDSDSGENQ----TLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFH 2310
            S  F VLE  P+ T VGFI T       FNE    F         L+ ++     ++ T V+ DRE    H+  +  + Q  +   I   + +LD NDN P F   S+     E+  SGT L     + D D+  N     Y   A N D  F++ T            L +  + DRE R S  L +   D G+  R     +++ ILD++DNP +F    +   ++E ++  T V +V A D    D + I Y +   + ++ F ++  +GV++T   ++                   V A D   P ++  +        V + + D ND+ P+I F  F           N +N ++       +  +   DSDSG N      ++ G  NE  H  F++   + L  ++  N  LD E    + + +   D G   + T  H
Sbjct:   68 SADFEVLEGQPRGTTVGFIPTKPKFSYRFNEPPREF--------TLDPVTG----EVKTNVVLDREGMRDHYDLVVLSSQPTYP--IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAAT-DADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA--ETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRT-------YVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTV-------VAAVAVKDSDSGLNGRTSVRIVSG--NELGH--FRLEEAADLHIVRV-NGVLDREEIGKYNLTVVAMDQGTPARTTTAH 479          

HSP 18 Score: 59.3066 bits (142), Expect = 1.756e-8
Identity = 71/302 (23.51%), Postives = 133/302 (44.04%), Query Frame = 1
Query: 1477 NSQVHYYLHEASN-KDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRS------SKGFIHIVILDMDDNPIVFTKDK---FVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS-----IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNL 2328
            NS + Y + +    ++F+I+T  G + + R  DREE+++  LT+      +   +       +  ++I I+D++DN  VF  D+       + EN+ +   +   +  D D      I YS+ N  N   F I   +GVL     +  E      ++++A D+  P   +    +  IA       D ND+ PV     F H     SL   PE +      F + +TD D G+N  + Y +   ++ ++F +    G +F++   + LD E    + + +   D+G QP  +   P+ +++
Sbjct:  863 NSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ-FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIA-------DVNDHTPV-----FDHTSYETSL---PETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVF-PDGYLFVR---APLDREERDYYALTVSCRDAG-QPSRSSVVPVVIHV 1143          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 159.073 bits (401), Expect = 3.730e-39
Identity = 189/735 (25.71%), Postives = 325/735 (44.22%), Query Frame = 1
Query:   76 VDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQ--------RDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPT---AIDLDSSVFSTIFYNL---SDPTRFFKLVETADNLYIQNSLM--LDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNE--NDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHE------ASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE--NTIVYSILNPKN--DYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIF-QIYSTDSDSGENQTLIYGMENEDSHKIFKI 2181
            + EG  VG+ +  L +  +++G   E    +          +D ++  F I   SG++   T  ++DRE    Y      +D      +           +Q++V+D NDN P ++  +  V+  +    G          A D D    + I Y +   +  ++F     + D++    SL+  LD E+   + L + A + G   RS++  + V ++D NDN P F    F   E + E++P+   ++ + A D D G N E ++ I S + +N  +    +   TG +   KPLD +   R F F+V+ +D    P S SS   V +TV DVND  P  +    + N       V E+ P  T V  +   D D +   + E+   +    F + S + R    I  ++  D +Q+ +  +++  TD     +     + I D N+  P F     +  ++E+ P GT +   + + D D+  N+Q+ Y L+E       S   F IN   G +++    DRE  S   LTV  +D GN   S    + I + D++DN   F    +   I E++++ T V  V A D D   N  +  +L+ ++  D  F+ID  SG + TN  LDRE V  + +  +A D   P    +S    S   V+I+++D ND+ P    P F  +++  +L+ P   P  S+  +I++ D D G N  + Y +   D    F +
Sbjct:  473 IREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVIS--TRSSLDRETSDSYHLLVTAADLASAQSE----RRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQF-----SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQF--QESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-SERDDNFPLA---VDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSS--VVITVQDVNDNDPAFNPKYYEAN-------VGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSL--DYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVL-VVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP---PLS----STVEVQIRLEDVNDS-P----PTFASDKI--TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 2 Score: 143.665 bits (361), Expect = 2.443e-34
Identity = 184/732 (25.14%), Postives = 315/732 (43.03%), Query Frame = 1
Query:  190 SHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLT---IHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGE--IVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQI-------YTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD--FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE--NTIV-YSILNPKNDYIFLIDKFSGV----LTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPV-----IIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            S F I   SG + L+  K +D E +  Y          ++ I+   GGS +     ++ + VID NDN P + +       ++    G       A D D    + I Y++S+    F L       ++Q    LD E   +F   + A + G+  +S+S  + +T+ D+NDN P F+   +  N  + ED P  + V  ++ATD D   +    + I +     +    F + S  G   I + + LDY +  R F   V   D        S  A V++ + D N+  P       +N   S   +V E+ P  T V  +   D D   N ++   SLN   + N + + + F I        T    DRE    + +++   D   + +  + T + +   D +          Y   + E+   GT +  ++ + D D+  N ++ Y L +   +D  F I+   GT+ + +  DRE  +  +LT    D+G+   SS   + I + D++D+P  F  DK   ++ ENS + +VVG + A D DE  N +V YSI+   +   F +    G     L T + LD E   + F  VV          A S   ++ A +EI + D NDN PV     +IF NF  +         P   I +I + D+D  +   L Y + + ++  + +++ +SG + L +   N +V  F+T  +++ V D  N+ K
Sbjct:  630 SQFSIDSMSGDVSLV--KPLDYESVRSY----------RLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEAN--VGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGR----FAITSQNGRGLITIAQSLDYKQEKR-FLLTVAATDSG----GRSDTATVHINITDANNFAP-----IFENAPYSA--SVFEDAPVGTTVLVVSATDSDVGVNAQI-TYSLNEESI-NGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGG-NPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVI-QVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVV---------RAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF--------PSGEIGRIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVL-SPQLNTNVPKFAT--MEVSVSDGINEAK 1303          

HSP 3 Score: 135.191 bits (339), Expect = 9.418e-32
Identity = 191/752 (25.40%), Postives = 313/752 (41.62%), Query Frame = 1
Query:  142 ITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETAD---------NLYIQNSLMLDSETTSKFTLHL----YASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDI---PINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVF--CRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLY-----ENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGT-LISL-RSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYIFLIDKFS-----GVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENED-SHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
            +    VS+L+ R    S    K DS    + T  ++DRE++  +    + +D    D      G+ T+   Q+ V+D ND+ P + ++       +G   G       A D D    + I Y +   T    L +  +         +  I     LD ET+  + L +     AS     R+++  +QV ++D NDN P FS+  ++    +PED      ++ V  + ATD D G N    + I    I       F + S++G++ + KPLDY+  +R++   +  +D      S +++  VN  V D ND  P+  FY  Q      Q +VLEN P    +  +   D D   N E+       +  F L ++  R  + + T    DRE+Q +    +   D        + +++I      D      + N   Y     E+ P GT +T    +   D D +S++HY +   + +  F I +  G  LI++ +S D ++     LTV   D G   RS    +HI I D ++   +F    +   + E++ + T V  V A D D      I YS+     + +   D FS     G + TN+ LDRE    Y + V A D   P   ++S        VEI + D NDN P    P +  + L  +L      S+ Q+ ++D D G N  + Y + + D     F I  TSG +     N  LD E  +   +     D G+ P
Sbjct:  391 VVYSMVSLLDSR----SQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATD----DSFPPRSGTTTL---QVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQ--VPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI----IGGNTQSQFSIDSMSGDVSLVKPLDYE-SVRSYRLVIRAQDGGSPSRSNTTQLLVN--VIDANDNAPR--FYTSQ-----FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVI---TVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTAT---DPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP---SLSDTTD----VEIGVTDVNDNAPAFKSPLYQASILEDALVG---TSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTI---RTNKGLDRESVAVFHLTAIAVDKGSPP 1092          

HSP 4 Score: 93.5893 bits (231), Expect = 6.609e-19
Identity = 83/311 (26.69%), Postives = 137/311 (44.05%), Query Frame = 1
Query: 1411 ENMPSGTILTGKLRSFDKDIDNNSQVHY----YLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSI---------LNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            E  P+G  +T  +R+ D +   +S V Y     L   S   FK+++  G + +  S DRE        V   D+    RS    + + +LD +D+   F  ++F   I E + + + V +++A D D      I Y I            +   IF ID  SGV++T S LDRE  D Y + V A D    +  A S+   + A V++K+ D+NDN+P      +T            + ++  I +TD+D G N  + Y +   ++   F I   SG V L      LD E   ++ + ++  D G+  +
Sbjct:  370 EEQPAGAAVT-TVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAAD----LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSR 669          

HSP 5 Score: 67.781 bits (164), Expect = 4.697e-11
Identity = 52/209 (24.88%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 1693 FTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYS---ILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPE--KSIFQIYSTDSDSGENQTLIYGME---------NEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCD 2277
            F +  +V  + E       V +V+A D +++ +VYS   +L+ ++  +F +D  +GV+TT++ LDRE +D ++ +VVA D + P     +        +++ + D ND+      P F   +  AS+ +      ++  + +TD D G+N  + YG+E          +    IF+I   SG++   +  S+LD E   ++ + +   D
Sbjct:  359 FEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTT-------LQVNVLDCNDH-----SPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVI---STRSSLDRETSDSYHLLVTAAD 552          

HSP 6 Score: 57.7658 bits (138), Expect = 4.945e-8
Identity = 59/214 (27.57%), Postives = 97/214 (45.33%), Query Frame = 1
Query:   82 EGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLM--LDSETTSK-FTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLF 708
            E   VGT +  + +   ++G+      +L+ RD +   F I   SG +R  T K +DRE +  +    I  D     +      S T+ E+QI + D ND+ P + SD I +   +    G       A D D  V + + Y++   D +  F LV    +   Q   M  LD E+T K F L + A++P +   +   I++ + D+NDN P+ 
Sbjct: 1018 EDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIR--TNKGLDRESVAVFHLTAIAVDKGSPPL------SSTV-EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAH--IEILVTDVNDNAPVL 1220          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 158.688 bits (400), Expect = 4.796e-39
Identity = 188/735 (25.58%), Postives = 321/735 (43.67%), Query Frame = 1
Query:   76 VDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQ--------RDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPT---AIDLDSSVFSTIFYNL---SDPTRFFKLVETADNLYIQNSLM--LDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNE--NDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHE------ASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE--NTIVYSILNPKN--DYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIF-QIYSTDSDSGENQTLIYGMENEDSHKIFKI 2181
            + EG  VG+ +  L +  +++G   E    +          +D ++  F I   SG++   T  ++DRE    Y      +D      +           +Q++V+D NDN P ++  +  V+  +    G          A D D    + I Y +   +  ++F     + D++    SL+  LD E+   + L + A + G   RS++  + V ++D NDN P F    F   E + E++P+   ++ + A D D G N E ++ I     N        +   TG +   KPLD +   R F F+V+ +D    P S SS   V +TV DVND  P  +    + N       V E+ P  T V  +   D D +   + E+   +    F + S + R    I  ++  D +Q+ +  +++  TD     +     + I D N+  P F     +  ++E+ P GT +   + + D D+  N+Q+ Y L+E       S   F IN   G +++    DRE  S   LTV  +D GN   S    + I + D++DN   F    +   I E++++ T V  V A D D   N  +  +L+ ++  D  F+ID  SG + TN  LDRE V  + +  +A D   P    +S    S   V+I+++D ND+ P    P F  +++  +L+ P   P  S+  +I++ D D G N  + Y +   D    F +
Sbjct:  473 IREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVIS--TRSSLDRETSDSYHLLVTAADLASAQSE----RRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQF-----SIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQF--QESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP----LAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSS--VVITVQDVNDNDPAFNPKYYEAN-------VGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSL--DYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVL-VVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP---PLS----STVEVQIRLEDVNDS-P----PTFASDKI--TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 2 Score: 143.28 bits (360), Expect = 2.977e-34
Identity = 184/732 (25.14%), Postives = 315/732 (43.03%), Query Frame = 1
Query:  190 SHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLT---IHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGE--IVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQI-------YTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD--FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE--NTIV-YSILNPKNDYIFLIDKFSGV----LTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPV-----IIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            S F I   SG + L+  K +D E +  Y          ++ I+   GGS +     ++ + VID NDN P + +       ++    G       A D D    + I Y++S+    F L       ++Q    LD E   +F   + A + G+  +S+S  + +T+ D+NDN P F+   +  N  + ED P  + V  ++ATD D   +    + I +     +    F + S  G   I + + LDY +  R F   V   D        S  A V++ + D N+  P       +N   S   +V E+ P  T V  +   D D   N ++   SLN   + N + + + F I        T    DRE    + +++   D   + +  + T + +   D +          Y   + E+   GT +  ++ + D D+  N ++ Y L +   +D  F I+   GT+ + +  DRE  +  +LT    D+G+   SS   + I + D++D+P  F  DK   ++ ENS + +VVG + A D DE  N +V YSI+   +   F +    G     L T + LD E   + F  VV          A S   ++ A +EI + D NDN PV     +IF NF  +         P   I +I + D+D  +   L Y + + ++  + +++ +SG + L +   N +V  F+T  +++ V D  N+ K
Sbjct:  630 SQFSIDSMSGDVSLV--KPLDYESVRSY----------RLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEAN--VGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGR----FAITSQNGRGLITIAQSLDYKQEKR-FLLTVAATDSG----GRSDTATVHINITDANNFAP-----IFENAPYSA--SVFEDAPVGTTVLVVSATDSDVGVNAQI-TYSLNEESI-NGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGG-NPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVI-QVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVV---------RAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF--------PSGEIGRIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVL-SPQLNTNVPKFAT--MEVSVSDGINEAK 1303          

HSP 3 Score: 134.806 bits (338), Expect = 1.239e-31
Identity = 191/752 (25.40%), Postives = 313/752 (41.62%), Query Frame = 1
Query:  142 ITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETAD---------NLYIQNSLMLDSETTSKFTLHL----YASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDI---PINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVF--CRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLY-----ENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGT-LISL-RSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYIFLIDKFS-----GVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENED-SHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
            +    VS+L+ R    S    K DS    + T  ++DRE++  +    + +D    D      G+ T+   Q+ V+D ND+ P + ++       +G   G       A D D    + I Y +   T    L +  +         +  I     LD ET+  + L +     AS     R+++  +QV ++D NDN P FS+  ++    +PED      ++ V  + ATD D G N    + I    I       F + S++G++ + KPLDY+  +R++   +  +D      S +++  VN  V D ND  P+  FY  Q      Q +VLEN P    +  +   D D   N E+       +  F L ++  R  + + T    DRE+Q +    +   D        + +++I      D      + N   Y     E+ P GT +T    +   D D +S++HY +   + +  F I +  G  LI++ +S D ++     LTV   D G   RS    +HI I D ++   +F    +   + E++ + T V  V A D D      I YS+     + +   D FS     G + TN+ LDRE    Y + V A D   P   ++S        VEI + D NDN P    P +  + L  +L      S+ Q+ ++D D G N  + Y + + D     F I  TSG +     N  LD E  +   +     D G+ P
Sbjct:  391 VVYSMVSLLDSR----SQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATD----DSFPPRSGTTTL---QVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQ--VPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI----IGGNTQSQFSIDSMSGDVSLVKPLDYE-SVRSYRLVIRAQDGGSPSRSNTTQLLVN--VIDANDNAPR--FYTSQ-----FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVI---TVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTAT---DPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP---SLSDTTD----VEIGVTDVNDNAPAFKSPLYQASILEDALVG---TSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTI---RTNKGLDRESVAVFHLTAIAVDKGSPP 1092          

HSP 4 Score: 93.5893 bits (231), Expect = 7.254e-19
Identity = 83/311 (26.69%), Postives = 137/311 (44.05%), Query Frame = 1
Query: 1411 ENMPSGTILTGKLRSFDKDIDNNSQVHY----YLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSI---------LNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            E  P+G  +T  +R+ D +   +S V Y     L   S   FK+++  G + +  S DRE        V   D+    RS    + + +LD +D+   F  ++F   I E + + + V +++A D D      I Y I            +   IF ID  SGV++T S LDRE  D Y + V A D    +  A S+   + A V++K+ D+NDN+P      +T            + ++  I +TD+D G N  + Y +   ++   F I   SG V L      LD E   ++ + ++  D G+  +
Sbjct:  370 EEQPAGAAVT-TVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAAD----LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSR 669          

HSP 5 Score: 67.781 bits (164), Expect = 5.025e-11
Identity = 52/209 (24.88%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 1693 FTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYS---ILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPE--KSIFQIYSTDSDSGENQTLIYGME---------NEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCD 2277
            F +  +V  + E       V +V+A D +++ +VYS   +L+ ++  +F +D  +GV+TT++ LDRE +D ++ +VVA D + P     +        +++ + D ND+      P F   +  AS+ +      ++  + +TD D G+N  + YG+E          +    IF+I   SG++   +  S+LD E   ++ + +   D
Sbjct:  359 FEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTT-------LQVNVLDCNDH-----SPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVI---STRSSLDRETSDSYHLLVTAAD 552          

HSP 6 Score: 57.7658 bits (138), Expect = 5.335e-8
Identity = 59/214 (27.57%), Postives = 97/214 (45.33%), Query Frame = 1
Query:   82 EGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLM--LDSETTSK-FTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLF 708
            E   VGT +  + +   ++G+      +L+ RD +   F I   SG +R  T K +DRE +  +    I  D     +      S T+ E+QI + D ND+ P + SD I +   +    G       A D D  V + + Y++   D +  F LV    +   Q   M  LD E+T K F L + A++P +   +   I++ + D+NDN P+ 
Sbjct: 1018 EDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIR--TNKGLDRESVAVFHLTAIAVDKGSPPL------SSTV-EVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAH--IEILVTDVNDNAPVL 1220          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 206.838 bits (525), Expect = 8.586e-55
Identity = 199/710 (28.03%), Postives = 327/710 (46.06%), Query Frame = 1
Query:  229 LITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIV--EDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            L T   IDRE +C       N   C  +I++ ++      + +I+  + D NDN P + S  IN+   +      R  +P+A D D  +     Y L      F L  +ET +      L +Q SL  D ET   F + +   + G   +SS+ ++QVT+ D+NDN P+F       N  +PE+ P+ + V  L ATD D G N +  F   SN+I+     +F + S TG I V++PLD +    N   K+IV   D +  P    S A V + V D+ND +P ID   I N  ++    + EN P NT +  I   D D + N +V C + +           +QF + T    D E   ++ + I  +D       +N + ++L    ++           +   + EN   GT L  K+ + D D  +N+ + Y L   +   F I++  G L  ++  DRE++   + TV   D G     S   + +++ D +DN   FT  ++ F++ EN  +   VG +   D D  +N +V  SI+N K++  F+ID  +GV+  N   DRE+   Y   V A D+ +           S A V I + D NDN PV + P  N++++ + ++    P   + ++++ D+D+G N  L Y +       +F I +T+G + L+      D      H + +KV D G QP+
Sbjct:   85 LTTANRIDREKLC---SGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSL--DRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN--VPENAPMGTSVTHLHATDADLGSNAQIHFSF-SNQISPSTKRHFAIDSTTGLITVKQPLDREV---NPVHKLIVLASDGSSTP----SRATVIVNVTDINDNVPSIDTRYIMN-LVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPP--LNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLI-KISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDN--FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGL-------MQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTS--PGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQ---GLHRLVVKVKDLG-QPE 760          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 206.838 bits (525), Expect = 1.270e-54
Identity = 207/762 (27.17%), Postives = 348/762 (45.67%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSM-----LKFKVDEGVQVGTEIADLT----SDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKN-IDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIV--EDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK 2211
            +++L    FL  ++      +K +  E V++G    DL      D K L    +F  V    D  +    +K ++    ++T  N IDRE +C       N   C  +I++ ++      + +I+  + D NDN P + S  IN+   +      R  +P+A D D  +     Y L      F L  +ET +      L +Q SL  D ET   F + +   + G   +SS+ ++QVT+ D+NDN P+F       N  +PE+ P+ + V  L ATD D G N +  F   SN+I+     +F + S TG I V++PLD +    N   K+IV   D +  P    S A V + V D+ND +P ID   I N  ++    + EN P NT +  I   D D + N +V C + +           +QF + T    D E   ++ + I  +D       +N + ++L    ++           +   + EN   GT L  K+ + D D  +N+ + Y L   +   F I++  G L  ++  DRE++   + TV   D G     S   + +++ D +DN   FT  ++ F++ EN  +   VG +   D D  +N +V  SI+N K++  F+ID  +GV+  N   DRE+   Y   V A D+ +           S A V I + D NDN PV + P  N++++ + ++    P   + ++++ D+D+G N  L Y +       +F I +T+G + L+
Sbjct:   10 LVVLFTCLFLMCRAQEKDYTVKEEQPENVRIGNLRKDLNLNLDPDIK-LSSALQFKPVYKTGDVPL----VKVEASTGEILTTANRIDREKLC---SGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSL--DRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN--VPENAPMGTSVTHLHATDADLGSNAQIHFSF-SNQISPSTKRHFAIDSTTGLITVKQPLDREV---NPVHKLIVLASDGSSTP----SRATVIVNVTDINDNVPSIDTRYIMN-LVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPP--LNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLI-KISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDN--FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGL-------MQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTS--PGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQ 736          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 201.83 bits (512), Expect = 4.810e-53
Identity = 209/766 (27.28%), Postives = 350/766 (45.69%), Query Frame = 1
Query:   64 LKFKVDEGVQVGTEIADLTSDFKN--LGITTEFVSVLNQRDFKVSHFGIKFDSGILRLI--------TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC-RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            ++ ++ E V +G    DL     N   G T+  V  L      VS  G   D+ +LR++        T   IDRE +C     + +    +I++ I+      + +I+I V DTNDN P + S  IN+   +  L   R  IP+A D D+   S   Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN P+F +     +  IPE+ P+ + V+ L ATD D G N E  +   + +++      F + + TG I V++PLD +    +    V+  D +  P    + A + + V DVND  P ID   I +   +    + E  P NT +  I  +D D + N +V C    +  F L ++    Q+ + T+ + D E   ++   I  +D       +N+T L+    +++           +   + EN      LT  + + D+D   N+++ Y L   ++  F ++   G L + R FDREE+     TV   D G     S+  + + ILD +DN   FT + F F +SEN    + VG +   D D  EN +V  SILN   +  F++D  SGV+ +N   DRE+   Y   V A D+  P   + +K       V I + D NDN P++I+P    +     L   P   + ++++ D D+G N  L Y + + +   +F+I   +G + L+   +  D+     H + + + D G
Sbjct:   30 IREELQENVLIGNIPKDLNISHMNSATGATSNLVYRL------VSKAG---DTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVH--IPENSPVGTSVVQLQATDADVGANAEIKYMFGA-QVSPATRRLFALNTTTGLITVQRPLDREETAIHKL-TVLASDGSSSP----ARATITINVTDVNDNAPNIDLRYIIS-PTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDN-QYLLETSALLDYEGTKEYIFKIVASDSGKP--SLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLT-TISATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNEN--FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAK-------VTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADI---GLHRLVVNISDLG 758          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 201.83 bits (512), Expect = 4.810e-53
Identity = 209/766 (27.28%), Postives = 350/766 (45.69%), Query Frame = 1
Query:   64 LKFKVDEGVQVGTEIADLTSDFKN--LGITTEFVSVLNQRDFKVSHFGIKFDSGILRLI--------TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC-RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            ++ ++ E V +G    DL     N   G T+  V  L      VS  G   D+ +LR++        T   IDRE +C     + +    +I++ I+      + +I+I V DTNDN P + S  IN+   +  L   R  IP+A D D+   S   Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN P+F +     +  IPE+ P+ + V+ L ATD D G N E  +   + +++      F + + TG I V++PLD +    +    V+  D +  P    + A + + V DVND  P ID   I +   +    + E  P NT +  I  +D D + N +V C    +  F L ++    Q+ + T+ + D E   ++   I  +D       +N+T L+    +++           +   + EN      LT  + + D+D   N+++ Y L   ++  F ++   G L + R FDREE+     TV   D G     S+  + + ILD +DN   FT + F F +SEN    + VG +   D D  EN +V  SILN   +  F++D  SGV+ +N   DRE+   Y   V A D+  P   + +K       V I + D NDN P++I+P    +     L   P   + ++++ D D+G N  L Y + + +   +F+I   +G + L+   +  D+     H + + + D G
Sbjct:   30 IREELQENVLIGNIPKDLNISHMNSATGATSNLVYRL------VSKAG---DTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVH--IPENSPVGTSVVQLQATDADVGANAEIKYMFGA-QVSPATRRLFALNTTTGLITVQRPLDREETAIHKL-TVLASDGSSSP----ARATITINVTDVNDNAPNIDLRYIIS-PTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDN-QYLLETSALLDYEGTKEYIFKIVASDSGKP--SLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLT-TISATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNEN--FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAK-------VTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADI---GLHRLVVNISDLG 758          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 201.445 bits (511), Expect = 4.919e-53
Identity = 216/793 (27.24%), Postives = 356/793 (44.89%), Query Frame = 1
Query:   64 LKFKVDEGVQVGTEIADLTSDFKN--LGITTEFVSVLNQRDFKVSHFGIKFDSGILRLI--------TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC-RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTS-DYPINTHVL 2361
            ++ ++ E V +G    DL     N   G T+  V  L      VS  G   D+ +LR++        T   IDRE +C     + +    +I++ I+      + +I+I V DTNDN P + S  IN+   +  L   R  IP+A D D+   S   Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN P+F +     +  IPE+ P+ + V+ L ATD D G N E  +   + +++      F + + TG I V++PLD +    +    V+  D +  P    + A + + V DVND  P ID   I +   +    + E  P NT +  I  +D D + N +V C    +  F L ++    Q+ + T+ + D E   ++   I  +D       +N+T L+    +++           +   + EN      LT  + + D+D   N+++ Y L   ++  F ++   G L + R FDREE+     TV   D G     S+  + + ILD +DN   FT + F F +SEN    + VG +   D D  EN +V  SILN   +  F++D  SGV+ +N   DRE+   Y   V A D+  P   + +K       V I + D NDN P++I+P    +     L   P   + ++++ D D+G N  L Y + + +   +F+I   +G + L+                K  + D G        H L VN++   YP + H L
Sbjct:   30 IREELQENVLIGNIPKDLNISHMNSATGATSNLVYRL------VSKAG---DTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVH--IPENSPVGTSVVQLQATDADVGANAEIKYMFGA-QVSPATRRLFALNTTTGLITVQRPLDREETAIHKL-TVLASDGSSSP----ARATITINVTDVNDNAPNIDLRYIIS-PTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDN-QYLLETSALLDYEGTKEYIFKIVASDSGKP--SLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLT-TISATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNEN--FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAK-------VTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEE---------------KPTIADIG-------LHRLVVNISDLGYPKSLHTL 766          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 225.328 bits (573), Expect = 1.088e-60
Identity = 221/777 (28.44%), Postives = 363/777 (46.72%), Query Frame = 1
Query:  235 TLKNIDREVICE--YEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXX----XXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN-QPKCTV-FHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIIT------VSLLTAFITGSILLYLKI 2478
            T   IDRE +C   + +NK     C  ++++ ++      + +I+  + D NDN P + S  IN+   +      R ++P+AID D  V     Y L      F L  +ET +      L +Q SL  D E    + + +   + G   RSS+ ++QVT+ D+NDN P+F +     N  IPED  + + V  L ATD D G N +  F    N+I N A  +F + + TG I V++PLD +    +    V+  D +  P    S A V + + D+ND IP ID   I N  ++    + E  P NT +  I   D D + N +V C + +            QF + T    D E   ++ + I  +D       +N++ ++L        N P F    +     EN P GT LT K+ + D D   N+++ Y L   +   F ++   G L ++R  DRE++     TV  +D GN    +   + + +LD +DN   FT +++ F++ EN  +   VG +   D D  EN +V  S++N +++  F+ID  +GV+  N   DRE+   Y  +V A D   P + +  K       V I ++D NDN PV + P  N++++ +  S    P   + ++Y+ D+D+G N  L Y +   +S  +F I   SG + LK     L  ++   + + +KV DSG  +P  T+ F  L+VN T      +++ E  +K K+           IT      V ++ A I G++ + L I
Sbjct:  105 TSNRIDREKLCSGIFTENK-----CFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSL--DREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVN--IPEDAAVGTSVTQLHATDADLGSNAKIHFYF-GNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKL-TVLASDGSSTP----SRATVTINITDINDNIPSIDTRYIIN-PVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPP--LNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELT-KISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVK-------VTIFVEDVNDNKPVFVIPSNNYSYDLVQTS--TSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLK--EKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITN--GSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVI 847          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 224.942 bits (572), Expect = 1.313e-60
Identity = 232/837 (27.72%), Postives = 387/837 (46.24%), Query Frame = 1
Query:   61 MLKFKVDEGVQVGTEIADLTSDF-KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKN-IDREVICE--YEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXX----XXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN-QPKCTV-FHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIIT------VSLLTAFITGSILLYLKI 2478
            +++ ++ E V +G  + DL      +L    +F  V    D  +    I+ +     + T  N IDRE +C   + +NK     C  ++++ ++      + +I+  + D NDN P + S  IN+   +      R ++P+AID D  V     Y L      F L  +ET +      L +Q SL  D E    + + +   + G   RSS+ ++QVT+ D+NDN P+F +     N  IPED  + + V  L ATD D G N +  F    N+I N A  +F + + TG I V++PLD +    +    V+  D +  P    S A V + + D+ND IP ID   I N  ++    + E  P NT +  I   D D + N +V C + +            QF + T    D E   ++ + I  +D       +N++ ++L        N P F    +     EN P GT LT K+ + D D   N+++ Y L   +   F ++   G L ++R  DRE++     TV  +D GN    +   + + +LD +DN   FT +++ F++ EN  +   VG +   D D  EN +V  S++N +++  F+ID  +GV+  N   DRE+   Y  +V A D   P + +  K       V I ++D NDN PV + P  N++++ +  S    P   + ++Y+ D+D+G N  L Y +   +S  +F I   SG + LK     L  ++   + + +KV DSG  +P  T+ F  L+VN T      +++ E  +K K+           IT      V ++ A I G++ + L I
Sbjct:   29 IVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPL----IRVEENTGEIFTTSNRIDREKLCSGIFTENK-----CFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSL--DREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVN--IPEDAAVGTSVTQLHATDADLGSNAKIHFYF-GNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKL-TVLASDGSSTP----SRATVTINITDINDNIPSIDTRYIIN-PVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPP--LNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELT-KISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVK-------VTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTS--PGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLK--EKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITN--GSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVI 827          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 224.942 bits (572), Expect = 1.454e-60
Identity = 232/837 (27.72%), Postives = 387/837 (46.24%), Query Frame = 1
Query:   61 MLKFKVDEGVQVGTEIADLTSDF-KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKN-IDREVICE--YEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXX----XXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN-QPKCTV-FHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIIT------VSLLTAFITGSILLYLKI 2478
            +++ ++ E V +G  + DL      +L    +F  V    D  +    I+ +     + T  N IDRE +C   + +NK     C  ++++ ++      + +I+  + D NDN P + S  IN+   +      R ++P+AID D  V     Y L      F L  +ET +      L +Q SL  D E    + + +   + G   RSS+ ++QVT+ D+NDN P+F +     N  IPED  + + V  L ATD D G N +  F    N+I N A  +F + + TG I V++PLD +    +    V+  D +  P    S A V + + D+ND IP ID   I N  ++    + E  P NT +  I   D D + N +V C + +            QF + T    D E   ++ + I  +D       +N++ ++L        N P F    +     EN P GT LT K+ + D D   N+++ Y L   +   F ++   G L ++R  DRE++     TV  +D GN    +   + + +LD +DN   FT +++ F++ EN  +   VG +   D D  EN +V  S++N +++  F+ID  +GV+  N   DRE+   Y  +V A D   P + +  K       V I ++D NDN PV + P  N++++ +  S    P   + ++Y+ D+D+G N  L Y +   +S  +F I   SG + LK     L  ++   + + +KV DSG  +P  T+ F  L+VN T      +++ E  +K K+           IT      V ++ A I G++ + L I
Sbjct:   49 IVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPL----IRVEENTGEIFTTSNRIDREKLCSGIFTENK-----CFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSL--DREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVN--IPEDAAVGTSVTQLHATDADLGSNAKIHFYF-GNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKL-TVLASDGSSTP----SRATVTINITDINDNIPSIDTRYIIN-PVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPP--LNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELT-KISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVK-------VTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTS--PGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLK--EKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITN--GSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVI 847          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 207.994 bits (528), Expect = 5.422e-55
Identity = 208/724 (28.73%), Postives = 338/724 (46.69%), Query Frame = 1
Query:  235 TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVI--DTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC---RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG-NQPKCT---VFHPLYVNLTS 2334
            T   IDRE +C    N  + + C  ++++++  +     I+I++I  DTNDN P + S  IN+   +  L   R  IP+A+D D+       Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN P+F +     +  IPE+ PI + V+ L ATD D G N E  + I   ++ +     F + + TG I V++PLD +    +    V+  D +  P    + A V + V DVND  P ID   I +  I+    + E  P NT +  I  +D D + N +V C   R +   F L ++    Q+ + T+ + D E   +    I   D       +N+T L+  + +++           +   + EN   G  LT  + + D+D   NS + Y L   ++  F ++   G L + R FDREE+     TV   D G     S+  + + +LD +DN   FT + F F +SEN    + VG + A D D      +  SILN   +  F++D +SG++ +N   DRE+   Y   V A D   P   + +K       V I I D NDN PV+I P    +     L   P   + ++++ D+D+G N  L Y + + ++  +F+I   +G + L+   S  DV     H + + + D G  +P  T   VF  LYVN T+
Sbjct:   88 TSTRIDREKLCAGSSNS-DENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVH--IPENAPIGTSVVQLHATDADIGSNAEIKY-IFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKL-TVLATDGSSTP----ARATVTINVTDVNDNPPNIDLRYIIS-PINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREVP--FHLKAVYDN-QYLLETSSLLDYEGIKEFSFKIVAADTGKPS--LNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLT-TVSASDEDSGKNSDIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNEN--FVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAK-------VTINIMDANDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPSAADV---GLHRLVVNISDLGYPKPLHTLVLVF--LYVNETA 778          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000039400.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:18417570:18420374:1 gene:ENSXETG00000012683.1 transcript:ENSXETT00000039400.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 2.252e-51
Identity = 185/668 (27.69%), Postives = 328/668 (49.10%), Query Frame = 1
Query:   25 LLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSH------FGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL-VETADNLYIQNSLM----LDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKT--LLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDF------KINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDN------PIVFTKDKFVFHI-SENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSG-VLTTNSYLDREKVDRYFIKVVAFDSNIP 1935
            LL ++   A  + L + + E  + G  + ++    K+LG++   +  L +R F++S       F +  ++G   L     IDRE +CE       +  C + ++ ++   L I  ++IE+ D NDN P ++ D++N+E  +   PG R  +  A+D D  + S   Y++S    +FKL V+T+ +  +   L+    LD E  S   + L A + GI  R+   +I++ I DINDN PLFS+ L+  +  + E  P+N++V+ ++ATD D G+NG  ++ +  ++I+  A + F + + TGEI  +  LD++       +++IVE  A     L S A V + + D ND  P+I   ++ N       ++ EN+   T++  I   D+D  EN  V+C+  +      + S+   F++ TT   DRE+   + ++I+ TD+        KT  L++LD NDN P F   S   Y+ EN PSG+ +  ++++ D D+D+N+++ Y +   +  +F       IN+  G L + R FD E+     + V  +D G+   +S   + I I D++DN      P     D   F I    S    +V  V AVD D      + Y  L       F I + +G + T   + ++E + +  + +V  + + P
Sbjct:   23 LLFSWLCKAITAQLHYSISEEEKKGYFVGNIA---KDLGLS---IQDLAKRKFRISSVTAEHFFNVNLENG--NLYVADRIDRESVCEM------TPICSLSLEAVVENPLNIFHVEIEIKDINDNSPSFSKDTMNLEITELTHPGTRFILGDALDPDDGMNSLQAYDISK-NEYFKLNVKTSSDGRMIPELVLERPLDREKQSALQIILTALDGGIPARTGISMIKIIISDINDNSPLFSQELYQVS--LTESAPVNTLVIQMNATDADEGVNGHITYYL--SRISKAAQQKFTIDTETGEIRTKGTLDFETTKA---YEMIVE--AQDGGGLFSNAKVVIQIVDANDNAPEIILTSVSN-------SIPENSVPGTVIALINIRDIDSGENGNVYCQITDLLPFEITSSSSNYFRLLTTRNLDREEMHGYNITIKATDRGSPSLSTTKTIKLVLLDVNDNPPVFGQASYVVYIPENNPSGSSVF-QVQASDPDLDDNAKITYSIMNTNTDNFPVSSYISINSMTGILYAQRPFDYEQLREFGIQVMAKDNGSPPLNSTTTVTICITDLNDNSPKILYPSTSADDSAQFEIVPRTSNKGELVAKVVAVDADSGHNAWLSYEFLQVSESMSFTISRHTGEIRTLRVFPEKETLKQRLVVLVKDNGSPP 658          

HSP 2 Score: 123.25 bits (308), Expect = 4.077e-28
Identity = 164/636 (25.79%), Postives = 285/636 (44.81%), Query Frame = 1
Query:  664 IQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTG-------EIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP--QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV------FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGT---LISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAV--DLDENT-IVYSILN------PKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ-PPEKS-----IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYV---NLTSDYPINTHVLENTKKEKK----IFTAFWILTSIITVSLLTAFIT 2451
            +++ I DINDN P FSK   + N  I E     +  ++  A D D G+N   ++ I  N       EYF +   T        E+V+ +PLD  R  ++    ++      +P + +  + + + + D+ND  P    + Y         Q ++ E+ P NTLV  +   D D   N  +        ++    F +++    E  +I T    D E    + + +E  D     +     + I+D NDN P     S++  + EN   GT++   L +  +DID+    + Y        F+I +       L++ R+ DREE    N+T+   D G+   S+   I +V+LD++DNP VF +  +V +I EN+   + V  VQA   DLD+N  I YSI+N      P + YI  I+  +G+L      D E++  + I+V+A D+  P          S   V I I D NDN P I++P+ + +  +++ F+  P  S     + ++ + D+DSG N  L Y          F I R +G +  +T     + E     ++ L V D+G+ P+    +   V   N   D P   + L+N+  +      +  A  +++ + T++++ A I+
Sbjct:  124 VEIEIKDINDNSPSFSKD--TMNLEITELTHPGTRFILGDALDPDDGMNSLQAYDISKN-------EYFKLNVKTSSDGRMIPELVLERPLD--REKQSALQIILTALDGGIP-ARTGISMIKIIISDINDNSPLFSQELY---------QVSLTESAPVNTLVIQMNATDADEGVNGHITYYLSRISKAAQQKFTIDT----ETGEIRTKGTLDFETTKAYEMIVEAQDGGGLFSNAKVVIQIVDANDNAPEIILTSVSNSIPENSVPGTVIA--LINI-RDIDSGENGNVYCQITDLLPFEITSSSSNYFRLLTTRNLDREEMHGYNITIKATDRGSPSLSTTKTIKLVLLDVNDNPPVFGQASYVVYIPENNPSGSSVFQVQASDPDLDDNAKITYSIMNTNTDNFPVSSYIS-INSMTGILYAQRPFDYEQLREFGIQVMAKDNGSPPL-------NSTTTVTICITDLNDNSPKILYPSTSAD--DSAQFEIVPRTSNKGELVAKVVAVDADSGHNAWLSYEFLQVSESMSFTISRHTGEI--RTLRVFPEKETLKQRLVVL-VKDNGSPPRSATINLNLVVADNFQQDIPQMNNQLQNSDSQSNLDIYLVIALALVSFLFTLTVMLAIIS 718          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdhgb7 (protocadherin gamma subfamily B, 7 [Source:MGI Symbol;Acc:MGI:1935199])

HSP 1 Score: 200.675 bits (509), Expect = 7.086e-53
Identity = 188/671 (28.02%), Postives = 316/671 (47.09%), Query Frame = 1
Query:   22 LLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVS----HFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADN--------LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCR-SLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYL---YENMPSGTILTGKLRSFDKDIDNNSQVHYYL------HEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDN------PIVFTKDKFVFHISENSV-INTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIP 1935
            +LL+  +  A    +++ + E +  G+ +  L    K+LG++   VS    R  +VS    HF +  +SG   L+    IDRE IC+  +       C++ ++ +L   L I  + +E+ D ND+ P +  D IN+E  + D PG R  + +A DLD  + S   Y LS P  +F L+   DN        L +Q   MLD E  S   L L A + G   R+ +  +++ +VD NDN P+FS+ ++     +PED+P  + VL L A D+D G+N EF++      + NKA   F +  +TG+IV R+ LD++  +  +   V  +D      SLSS+  V + V D ND  P+I   ++ +        + E++P  T+V      D D  EN EV C  S N+ F ++S S+   +++ T  I DREQ   + V+I  TD+       + T + L+  D +          YL    EN   GT +T +++++D D+ +N  V Y +       +A +    +N   G + + R+FD E+  S  LT+   D+G+   S+   + +++ D +DN      P +      +F +   +     +V  V AVD D      + Y +L   +  +F +   +G + T   L  +   R  + V   D   P
Sbjct:   19 ILLLPLFCPALGQPVRYSIPEELDRGSVVGKLA---KDLGLSVLEVSA---RKLRVSAEKLHFSVDSESG--DLLVKDRIDREQICKGRRK------CELQLEAVLENPLNIFHVVVEIEDVNDHAPQFPKDEINLEISESDSPGARTILESAKDLDIGMNSLSKYQLS-PNDYFLLL-VKDNPDGSKYPELELQK--MLDREAESTHHLMLTAVDGGDPPRTGTTQLRIRVVDANDNRPVFSQDVYRVR--LPEDLPPGTTVLRLKAMDQDEGINAEFTYSFLG--VANKA--QFSLDPITGDIVTRQSLDFEE-VEQYTIDVEAKDRG----SLSSQCKVIIEVLDENDNRPEIIITSLSDQ-------ISEDSPSGTVVALFKVRDRDSGENAEVMCSLSGNNPFKIHS-SSNNYYKLVTDSILDREQTPGYNVTITATDRG-KPPLSSSTTITLNVADVNDNAPVFQQQAYLINVAENNQPGTSIT-QVKAWDPDVGSNGLVSYSIIASDLEPKALSSFVSVNQDSGVVYAQRAFDHEQIRSFQLTLQARDQGSPALSANVSMRVLVDDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALSDKDAARQRLLVAVRDGGQP 650          

HSP 2 Score: 102.449 bits (254), Expect = 9.691e-22
Identity = 143/575 (24.87%), Postives = 250/575 (43.48%), Query Frame = 1
Query:  670 VTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIM-------KSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP--QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQ-------IYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTG-KLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEG---TLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT-------IVYSILNPKNDYIFL-IDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLF------QPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
            V I D+ND+ P F K     N  I E     +  ++ SA D D G+N    +++  N       +YF++        S   E+ ++K LD +    +      V D    P + +++  + + V D ND  P    D Y ++         + E+ P  T V  +   D D   N E       SF     ++ + QF        I T    D E+ +++ + +E  D+    +     + +LD+NDN P     SL+  + E+ PSGT++   K+R  D+D   N++V   L  + N  FKI++       L++    DRE+    N+T+   D G    SS   I + + D++DN  VF +  ++ +++EN+   T +  V+A D D  +       I+ S L PK    F+ +++ SGV+      D E++  + + + A D   P   A+S N      + + +DD NDN P +++P    +   ++LF        P   + ++ + D+DSG N  L Y +       +F +   +G V      S+ D    +   + + V D G  P
Sbjct:  121 VEIEDVNDHAPQFPKDEI--NLEISESDSPGARTILESAKDLDIGMNSLSKYQLSPN-------DYFLLLVKDNPDGSKYPELELQKMLDREAESTHHLMLTAV-DGGDPPRTGTTQ--LRIRVVDANDNRPVFSQDVYRVR---------LPEDLPPGTTVLRLKAMDQDEGINAEFTY----SFL---GVANKAQFSLDPITGDIVTRQSLDFEEVEQYTIDVEAKDRGSLSSQCKVIIEVLDENDNRPEIIITSLSDQISEDSPSGTVVALFKVR--DRDSGENAEVMCSL--SGNNPFKIHSSSNNYYKLVTDSILDREQTPGYNVTITATDRGKPPLSSSTTITLNVADVNDNAPVFQQQAYLINVAENNQPGTSITQVKAWDPDVGSNGLVSYSIIASDLEPKALSSFVSVNQDSGVVYAQRAFDHEQIRSFQLTLQARDQGSP---ALSAN----VSMRVLVDDRNDNAPRVLYPTLEPD--GSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALSDKDA---ARQRLLVAVRDGGQPP 651          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 197.593 bits (501), Expect = 1.013e-51
Identity = 215/784 (27.42%), Postives = 349/784 (44.52%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDF-------KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITL-KNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYH-MNYINKTLLILXXXXXXXXXXXXS-LNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
             +LL    F +      + V E +     I DL  D        K+L    +F  V    D  +    I+ + G   + T    IDRE +C      +    C  ++++ ++      + +I+  + D NDN P + +  IN+   +      R ++P AID D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ PI S V  L ATD D G N    F   SN ++N A   F + + TG I V++PLD +    +    V+  D    P    + A V + V D+ND +P ID   I N   +    + EN P NT +  I   D D   N  V C + +   F L  + +  QF + T    D E   ++ + +   D     +N  +  L+ + D +++   F  S ++  + EN   G  LT K+ + D D   N+++ Y L   +  +F ++   G L +++  DRE++     TV  +D G     S   + + +LD +DN  +FT +++ F++ E+   +  VG +   D D  EN+ V  SIL+  ND  F ID  SGV+  N   DRE+ + Y   V A       E+    +  S A V I + D NDN P+ I P  N++   +  S    P   +F++ + D D G N  ++Y +   ++  +F I +TSG + LK       V     H + +K  D G QP
Sbjct:   11 AVLLACVVFQSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPL----IRIEEGTGEIFTTGARIDREKLC---AGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS--IPENAPIGSSVTQLHATDADIGENARIHFYF-SNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLL-VLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVN-PTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSN-QFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLT-KISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQ-FTIDPQSGVIRPNISFDRERQESYTFYVKA-------EDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN--PGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLK---EKCMVSDLGLHRVIVKANDLG-QP 759          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 197.978 bits (502), Expect = 1.274e-51
Identity = 215/784 (27.42%), Postives = 349/784 (44.52%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDF-------KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITL-KNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYH-MNYINKTLLILXXXXXXXXXXXXS-LNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
             +LL    F +      + V E +     I DL  D        K+L    +F  V    D  +    I+ + G   + T    IDRE +C      +    C  ++++ ++      + +I+  + D NDN P + +  IN+   +      R ++P AID D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ PI S V  L ATD D G N    F   SN ++N A   F + + TG I V++PLD +    +    V+  D    P    + A V + V D+ND +P ID   I N   +    + EN P NT +  I   D D   N  V C + +   F L  + +  QF + T    D E   ++ + +   D     +N  +  L+ + D +++   F  S ++  + EN   G  LT K+ + D D   N+++ Y L   +  +F ++   G L +++  DRE++     TV  +D G     S   + + +LD +DN  +FT +++ F++ E+   +  VG +   D D  EN+ V  SIL+  ND  F ID  SGV+  N   DRE+ + Y   V A       E+    +  S A V I + D NDN P+ I P  N++   +  S    P   +F++ + D D G N  ++Y +   ++  +F I +TSG + LK       V     H + +K  D G QP
Sbjct:   11 AVLLACVVFQSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPL----IRIEEGTGEIFTTGARIDREKLC---AGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS--IPENAPIGSSVTQLHATDADIGENARIHFYF-SNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLL-VLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVN-PTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSN-QFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLT-KISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQ-FTIDPQSGVIRPNISFDRERQESYTFYVKA-------EDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN--PGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLK---EKCMVSDLGLHRVIVKANDLG-QP 759          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 196.823 bits (499), Expect = 3.455e-51
Identity = 215/784 (27.42%), Postives = 349/784 (44.52%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDF-------KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITL-KNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYH-MNYINKTLLILXXXXXXXXXXXXS-LNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
             +LL    F +      + V E +     I DL  D        K+L    +F  V    D  +    I+ + G   + T    IDRE +C      +    C  ++++ ++      + +I+  + D NDN P + +  IN+   +      R ++P AID D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ PI S V  L ATD D G N    F   SN ++N A   F + + TG I V++PLD +    +    V+  D    P    + A V + V D+ND +P ID   I N   +    + EN P NT +  I   D D   N  V C + +   F L  + +  QF + T    D E   ++ + +   D     +N  +  L+ + D +++   F  S ++  + EN   G  LT K+ + D D   N+++ Y L   +  +F ++   G L +++  DRE++     TV  +D G     S   + + +LD +DN  +FT +++ F++ E+   +  VG +   D D  EN+ V  SIL+  ND  F ID  SGV+  N   DRE+ + Y   V A       E+    +  S A V I + D NDN P+ I P  N++   +  S    P   +F++ + D D G N  ++Y +   ++  +F I +TSG + LK       V     H + +K  D G QP
Sbjct:   11 AVLLACVVFQSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPL----IRIEEGTGEIFTTGARIDREKLC---AGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS--IPENAPIGSSVTQLHATDADIGENARIHFYF-SNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLL-VLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVN-PTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSN-QFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLT-KISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQ-FTIDPQSGVIRPNISFDRERQESYTFYVKA-------EDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN--PGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLK---EKCMVSDLGLHRVIVKANDLG-QP 759          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 196.052 bits (497), Expect = 5.317e-51
Identity = 215/784 (27.42%), Postives = 349/784 (44.52%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDF-------KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITL-KNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYH-MNYINKTLLILXXXXXXXXXXXXS-LNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
             +LL    F +      + V E +     I DL  D        K+L    +F  V    D  +    I+ + G   + T    IDRE +C      +    C  ++++ ++      + +I+  + D NDN P + +  IN+   +      R ++P AID D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ PI S V  L ATD D G N    F   SN ++N A   F + + TG I V++PLD +    +    V+  D    P    + A V + V D+ND +P ID   I N   +    + EN P NT +  I   D D   N  V C + +   F L  + +  QF + T    D E   ++ + +   D     +N  +  L+ + D +++   F  S ++  + EN   G  LT K+ + D D   N+++ Y L   +  +F ++   G L +++  DRE++     TV  +D G     S   + + +LD +DN  +FT +++ F++ E+   +  VG +   D D  EN+ V  SIL+  ND  F ID  SGV+  N   DRE+ + Y   V A       E+    +  S A V I + D NDN P+ I P  N++   +  S    P   +F++ + D D G N  ++Y +   ++  +F I +TSG + LK       V     H + +K  D G QP
Sbjct:   11 AVLLACVVFQSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPL----IRIEEGTGEIFTTGARIDREKLC---AGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVS--IPENAPIGSSVTQLHATDADIGENARIHFYF-SNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLL-VLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVN-PTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSN-QFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLT-KISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILD-VNDQ-FTIDPQSGVIRPNISFDRERQESYTFYVKA-------EDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTN--PGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLK---EKCMVSDLGLHRVIVKANDLG-QP 759          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 7.425e-58
Identity = 211/758 (27.84%), Postives = 343/758 (45.25%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDF-------KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITL-KNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNE---PIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXS--LNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENT-IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK 2211
             +LL    F +      + + E +     I DL  D        ++L    +F  V    D  +    I+ + G   + T    IDRE +C      +    C  ++++ ++      + +I+  + D NDN P + +  IN+   +      R  +P  ID D+ +     Y+L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN     +P+F  NE    IPE+ P+ S V  L ATD D G N +  F   SN I+N A + F + S TG I +++PLD +    N    V+  D    P    + A V + V D+ND IP ID   I N  I+    + EN P NT +  I   D D + N  V C + +   F L  + +  QF + T    D E   ++ + +   D        +  LLI   ++ND         L+  + EN   GT LT K+ + D D   N++++Y L   +  +F ++   G L +++  DRE++   + TV  +D G     +   + + +LD +DN  VFT +++ F++ EN   +  VG +   D D  EN+ ++ SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV + P+  ++         P   +F + + D+D+G N  L Y M   ++  +F I +TSG + LK
Sbjct:   11 AVLLACIVFQSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPDRSLTTPMQFKLVYKTGDVPL----IRIEEGTGEIFTTGARIDREKLC---AGIVVDAHCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSRYALPATIDPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKEL--DREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDN-----RPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYF-SNLISNMAKKLFHLNSTTGLITIKEPLDREES-PNHKLLVLASDGGLTP----ARAMVLVNVTDINDNIPSIDIRYIIN-PINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFTDHEVPFRLRPVFSN-QFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLT-KISAMDADSGRNAEINYLLGFDAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDD--FTIDPQTGVIQPNISFDREKQESYTFYVKA-------EDGGRISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKGLFIIDQTSGNITLK 736          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.549e-54
Identity = 224/853 (26.26%), Postives = 382/853 (44.78%), Query Frame = 1
Query:   19 VLLLVNFYFLASKS--MLKFKVDEGVQVGTEIADLTSDF---KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMP---SGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVS--------LLTAFITGSILLYLKI 2478
            +L+ V F+  A +    ++ ++ E V +G  + DL       K+L  T +F  V    D  +    I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  +++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF +      D E   ++ + +   D       +N++ ++     ++    P     ++  ++P   S  I   K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P + ++     L  P   P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL  +  +    L N    K I       T I  VS        +L A + G+I + + I
Sbjct:   45 LLVCVVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPL--IRIEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLENAAYLDYESTKEYAIKLLAADAG--KPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSY---ELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVI 860          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.078e-54
Identity = 229/850 (26.94%), Postives = 381/850 (44.82%), Query Frame = 1
Query:   19 VLLLVNFYFLASKS--MLKFKVDEGVQVGTEIADLT-SDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVS--------LLTAFITGSILLYLKI 2478
            +L  V F+  A +    ++ ++ E V +G  + DL  S   N  +TT     L  +   V    I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  +++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF + T    D E   ++ + +   D A         +L +   D +      + +F    + EN   G  LT K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P  N+++  +  S    P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL  +  +    L N    K I       T I  VS        +L A + G+I + + I
Sbjct:   13 LLACVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKEL--DREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLETAAYLDYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT-KVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTN--PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTNDYVKILVAAVAGTITVVVVI 828          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 8.127e-54
Identity = 229/851 (26.91%), Postives = 384/851 (45.12%), Query Frame = 1
Query:   19 VLLLVNFYFLASKS--MLKFKVDEGVQVGTEIADLT-SDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQP---PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNL------TSDYPINTHVLENTKKEKKIFTAFWILTSIIT--VSLLTAFITGSILLYLKI 2478
            +L  V F+  A +    ++ ++ E V +G  + DL  S   N  +TT     L  +   V    I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  +++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF + T    D E   ++ + +   D A         +L +   D +      + +F    + EN   G  LT K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P    +  +  L  P   P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL      T+   IN  V ++T+      T    ++S  +  V +L A + G+I + + I
Sbjct:   13 LLACVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLETAAYLDYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT-KVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP---SNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVI 828          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.184e-53
Identity = 224/834 (26.86%), Postives = 369/834 (44.24%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDF-------KNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF-FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL---DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVSLLTA 2442
             +LL    F +      + + E +     I DL  D        K+L    +F  V    D  ++   I+ D+G +   T   IDRE +C         + C  ++++ I+      + +I+  + D NDN P + +  IN+   +      + T+P A+D D  +     Y L      F L  +ET +      L +Q  L  D E    + + +   + G   RSS+ ++QV++ D NDN P+F +     +  IPE+ P+ + V  L ATD D G N +  F   SN ++N A   F + + TG I +++PLD +    N    V+  D   +P    + A V + V DVND +P ID   I N  I++   + EN P NT +  I   D D + N  V C + +   F L  + +  QF + T    D E   ++ + +   D A         +L +   D +      + +F    + EN   G  LT K+ + D D   N++++Y L   +  +F ++   G L  ++  DRE+      T+  +D G    +S   + + I+D +DN  VFT +++ F++ EN   +  VG +   D    D + +  SIL+  +D  F ID  +GV+  N   DREK + Y   V A       E+    +  S A V I + D NDN PV I P  N+++  +  S    P   +FQ+ + D+D+G N  + Y +   ++  +F I + +G + L       DV     H + +K  D G QP  ++F  + VNL  +  +    L N    K I       T I  VS  T+
Sbjct:   11 AVLLACVVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLTR--IEEDTGEI-FTTGARIDREKLC---AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKEL--DREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS--IPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREE-TPNHKLLVLASDGGLMP----ARAMVLVNVTDVNDNVPSIDIRYIVN-PINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-QFLLETAAYLDYESTKEYAIKLLAAD-AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT-KVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKA-------EDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTN--PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLM---EKCDVTDLGLHRVLVKANDLG-QPD-SLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTS 808          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A068Y543 (Protocadherin 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000570400 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 3.971e-89
Identity = 262/786 (33.33%), Postives = 370/786 (47.07%), Query Frame = 1
Query:  343 IHEIQIEVIDTNDNIPYW--NSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSD-------PTRF----FKLV--ETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRS---------------SSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSN----KINNKAIEYFIMKSVTGEIVVRKPLDYDR-----------------------GMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFY----------------AIQNNKISNQ---FAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVL-------------------NSMSTR----EQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTIL----TGKLR-----SFDKDIDNNSQVHYYLHEASN--KDFKINTHEGTLISLRSFDREERSS--LNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDL-DENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFL---------KTGNSNLDVEYFS----------THVIKLKVCDSGNQPKCTV 2304
            I+ ++I V+D ND  P+W  N     VEF DGD  G R+++P AIDLD    + I Y +         P  +    FKL+  ++  +LY+Q    +D E TS + L L A++ G+D+S               S+L + V + DINDN P F++P+F+ + P+ E  P+ SVVL L ATD DSG NG F F    N     I+  A   F ++   G +VVR+PLD DR                       GM  F FKV+V D A   Y+ SSEA VN+ V D NDE P I                    I ++++S Q     V EN P +T V  I  +D+DF   DE  C   N  F L                   NS + +     Q+ I T V  DRE      + I CTD+A H +  N T+LI D ND+ P F  + + + + EN P GTIL     G  R     + D D+  N  V Y   E S   ++F I++  G + +   FDREE      N+    + +G    +  G + +V+LD++DNP VF ++ + F I+EN    T VG V A DL D+  I Y + N  +  +F ID+ SG L T   LDRE    Y  KV+  D          K   + A V + ++DENDN PV I PN T N L  ++ Q     +  I ++D+D G+N  + Y ++  +S  +F I   SGL+FL          T  S+ D    +           HVI L+ CDSG +P+CTV
Sbjct:  160 IYHLRITVLDVNDQAPFWPENLQRHVVEFRDGDPVGKRQSLPLAIDLDQGENARISYRIEQDLVDEPSPEGWDSLPFKLIHDQSDGSLYLQTEREIDHEATSSYKLVLKATD-GVDKSLPDSIVAECFLRQHTSTLTLTVVVQDINDNDPKFTQPVFTPDRPVSEATPVGSVVLRLKATDADSGENGAFHFGFAPNVGWRSIDKLAQHLFDVRP-NGNVVVRRPLDVDRQWKLVDDLKKSSNSDLFGRDNVKGM-EFSFKVVVVDEADSKYARSSEATVNIVVVDENDEAPVIGVMRPTTSGECVRSLGKPTGITSSRLSTQTSYACVFENAPVDTFVATIQVSDMDFCGEDERECVLDNKNFTLVAEEHANTRLSANQLTHVFNSQALKGPSVSQYAILTAVALDREATPFQQIQILCTDRANHQSVHNVTVLIGDINDHKPQFAQEVMTYQVPENSPPGTILKPLYVGPTRNSVALATDGDVGKNGMVKYSFIEGSRTAENFSIDSFTGVISTRIRFDREENGKYVFNILAVDQADGENTLTGTGTVEVVVLDVNDNPPVFAQETYTFQIAENLPRGTRVGQVTAFDLDDQGPISYYLSNDYDALVFQIDRTSGELFTRRPLDREDQSNYTFKVLVRDFAALGGGVEKKTYTATATVTVVLEDENDNSPVFILPNATANALTVAVSQTLGHKLAVIIASDADEGDNGRITYKIKAGNSLNLFSIDPQSGLLFLADSLSRFNEATNTSSADEAATARAIQLSTQPTVHVITLEACDSGVEPRCTV 942          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A3R7HBN6 (Protocadherin-11 X-linked (Fragment) OS=Clonorchis sinensis OX=79923 GN=PCDH11X PE=4 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 4.154e-88
Identity = 283/939 (30.14%), Postives = 414/939 (44.09%), Query Frame = 1
Query:   97 GTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKN---------------KINSDG----------CKIDIQI----------ILG-------GSLTIHEIQIEVIDTNDNIPYWNS--DSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTR------FFKLVETA-DNLYIQNSLMLDSETTSKFTLHLYA---SNPGIDR--------SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSN----KINNKAIEYFIMKSVTGEIVVRKPLDYDRG----------MRN------------------------FFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQN------NKIS------NQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTRE----------QFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGK-----------------LRSFDKDIDNNSQVHYYLHE--ASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNI---PIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK----------------------TGNSNLDVEYF----STHVIKLKVCDSGNQP--KCTVFHPLYVNLTSDYPINTHVLENTKKEKKI 2388
            G   A+L S   + G   EF SVLN     V+   +K D    R++  + IDRE +C   ++               K+ S G          C I +++          I G           I  +++ + D NDN PYW        V F DGD  G R+T+P A+DLDS +   + Y L   T        F L++ A + +Y+  +  +D E    +   L A   SNP  D+        +S+L+I V I DINDN PLF +P+F+ N PIPE  P+ + VL+L+ATD D+G+NG F F              A +YF ++S  G IVVR+ LD DR            RN                        F F V+VED A  PYS SSEA V +TV D NDE P ++   ++       N +S      N  +V EN P  T V  +   D DF   D V CR   S F L   S ++           + + T +  DRE      V I C D A H+   N ++ +LD+NDN P F  ++ +  ++ENM  GT L                      + D D   N+ V Y L E   +   FKI+   GT+ +  SFDRE      L     D G    +S   + I +LD++DN   F   ++ FH++EN    T VG V A DLD +    I Y + +  +   F IDK +GV+     LDREK  RY   V+A D+N+     +   S        V + IDDENDN+PV + PN T N L  ++ +     +  I +TD+D GEN  + Y + + +++ +F +  T+GL++L                        G++ +DV       S H++ L+ CD G  P  KCT+F  L + + +    +   +EN  +  +I
Sbjct:   62 GKSQAELQSKKDDWGDLFEF-SVLNSGHLGVNSVEVKKDG---RVLVARRIDREQLCLGSQSVGSPLDSVYSVKFVPKLTSQGSHSSMASSSHCIITLKLSVFSRAAQTKITGIKSSKADNPQAILTVRLLIDDINDNAPYWPGHLKRFQVVFRDGDPIGERRTLPPAVDLDSGLNGRLIYELVPTTHSDKNSGTFSLIDHAMEGIYLCATKQVDREEREAYQYILKAIDHSNPDDDQMPSEESRFTSTLVIDVHIEDINDNTPLFVQPIFTPNTPIPETTPVGTTVLILNATDADAGINGAFHFGFSREHAWLPTEIYAKQYFDIRS-NGHIVVRRSLDVDRDKGTPEIFRQEQRNGVQGLSSSGATFLSSSLASGTTIKFRFHVVVEDEAVRPYSRSSEATVVITVSDENDEAPIVEIREVREDIEQKANGVSGPTGNFNFLSVTENKPIGTAVATLQAYDPDFEGTDHVECRLKTSNFSLVQTSNQQNPIMMVPGSVAYHLQTAIELDREVTPVQLVPISCIDTAGHLTERNFSVYVLDENDNPPRFVHNTFHMQVWENMSPGTQLQRMENVQSSVHSNLLYHHPYFTAVDSDTGANADVFYQLIENGMNATTFKIDPKTGTITTTVSFDREAVDHYTLYALAIDHGIPPLTSTSTVKITVLDVNDNAPQFGSVEYTFHLAENQPRATQVGQVTATDLDSDIYGPIHYFVGDESDATNFRIDKMTGVIRCRQALDREKQARYVFTVLAKDTNVHSSNSKSLSSLQLTGTCTVTVLIDDENDNWPVFVNPNSTANTLAVAVDETLGHKLAYIQATDADDGENALITYSIRSGNTNGLFGLDSTTGLLYLSGLFRGTSTSDHDSLTKNVTVNLAGDTRVDVSPALAGPSFHMLTLEACDQGKHPKQKCTLFSNLKILINNRLDGDVDTMENDSQGGQI 995          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A4S2LQP7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005535 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 6.663e-88
Identity = 278/940 (29.57%), Postives = 413/940 (43.94%), Query Frame = 1
Query:   97 GTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKN---------------KINSDG----------CKIDIQI-ILGGSLTIH----------------EIQIEVIDTNDNIPYWNS--DSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTR------FFKLVETA-DNLYIQNSLMLDSETTSKFTLHLYA---SNPGIDR--------SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSN----KINNKAIEYFIMKSVTGEIVVRKPLDYDRG----------MRN------------------------FFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQ------NNKIS------NQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQ----------FQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD--------------------FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNI---PIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK----------------------TGNSNLDVEYF----STHVIKLKVCDSGNQP--KCTVFHPLYVNLTSDYPINTHVLENTKKEKKI 2388
            G   AD  S     G   EF SVLN     V+   +  D    RL+  + IDRE +C   ++               K+ S G          C I +++ +  G+  I                  +++ + D NDN PYW        V F DGDL G R+T+P A DLD+ +   + Y L   T        F L++ A + +Y+  +  +D E    +   L A   SNP  D+        +S+L+I V I DINDN PLF +P+F+ N P+PE  P+ + VL+L+ATD D+G+NG F F          I   A +YF ++S  G+IVVR+PLD DR            RN                        F F V+VED A  PYS SSEA V +TV D NDE P ++   ++       N +       N  +V+EN P  T V  +   D DF   D V CR     F L   S ++           + + T    DRE      V I C D A H+   N ++ +LD+NDN P F  ++ +  ++ENM  GT L  ++ S    I +N   H+    A + D                    FKI+   GT+ +  SFDRE      L     D G    +S   + I ILD++DN   F   ++ FH++EN    T VG V A DLD +    I Y + +  +   F IDK +G++     LDREK  RY   V+A D+N+     +   S        V + IDDENDN+P+ + PN T N L  ++ +     +  I +TD+D GEN  + Y + + +++ +F +  T+GL++L                        G++ +D+       S H++ L+ CD G  P  KCT+F  L + + +        +EN  +  +I
Sbjct:   61 GKSQADTQSKKDGWGELFEF-SVLNSGHTGVNAVEVTKDG---RLLVARRIDREQLCPGSQSVGSPLDSVYSMKYVSKLTSQGSHSSTASSSHCIITLKMSVFSGAAKIKVSGVKSSKADNPQAILTVRLLIDDINDNAPYWPGHLKRFQVVFRDGDLAGERRTLPPAADLDAGLNGRLSYELVPTTHSDKGSETFSLIDHAMEGIYLCATKQIDREEREAYQYILKAIDRSNPENDQMPSEESRFTSTLVIDVHIEDINDNTPLFVQPIFTPNAPVPETTPVGTTVLILNATDADAGINGAFHFGFSREHAWLPIEIYAKQYFDIRS-NGQIVVRRPLDVDRDRSTQEIFRQEQRNGVQGHSSSGATFLSSGLASGTTIKFRFHVVVEDEAVRPYSRSSEATVVITVSDENDEAPIVEIREVREDIEQKTNGVPGPTGNFNFLSVMENKPIGTAVATLQAYDPDFEGTDHVECRLKTPNFSLLQTSNQQNPILMVSGAVTYHLQTATELDREVTPVQLVPISCIDTAGHLTERNFSVYVLDENDNPPRFVHNTFHMQVWENMSPGTQLQ-RMESVQSSIHSNLLYHHPYFTAVDSDTGANADVFYQLIENGINATTFKIDPKTGTITTAVSFDREAVDHYTLYALAIDHGIPPLTSTSTVKITILDVNDNAPQFGSVEYTFHLAENQPRATQVGQVTATDLDSDIYGPIHYFVGDESDATNFRIDKMTGIIRCRQALDREKQARYVFTVLAKDTNVHSSNSKSLSSLQLTGTCTVTVLIDDENDNWPIFVNPNSTANTLAVAVDETLGHKLAYIQATDADDGENALITYSIRSGNTNGLFGLDSTTGLLYLSGLFRGTSMSDHDSRTKNVTVNLAGDTRVDMSPALVGPSFHMLTLEACDQGKHPKQKCTLFSNLKILINNRLDGEVDAMENDNQSGQI 994          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: G7Y8R9 (Protocadherin-11 X-linked OS=Clonorchis sinensis OX=79923 GN=CLF_102916 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 7.869e-87
Identity = 283/939 (30.14%), Postives = 414/939 (44.09%), Query Frame = 1
Query:   97 GTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKN---------------KINSDG----------CKIDIQI----------ILG-------GSLTIHEIQIEVIDTNDNIPYWNS--DSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTR------FFKLVETA-DNLYIQNSLMLDSETTSKFTLHLYA---SNPGIDR--------SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSN----KINNKAIEYFIMKSVTGEIVVRKPLDYDRG----------MRN------------------------FFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQN------NKIS------NQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTRE----------QFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGK-----------------LRSFDKDIDNNSQVHYYLHE--ASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNI---PIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK----------------------TGNSNLDVEYF----STHVIKLKVCDSGNQP--KCTVFHPLYVNLTSDYPINTHVLENTKKEKKI 2388
            G   A+L S   + G   EF SVLN     V+   +K D    R++  + IDRE +C   ++               K+ S G          C I +++          I G           I  +++ + D NDN PYW        V F DGD  G R+T+P A+DLDS +   + Y L   T        F L++ A + +Y+  +  +D E    +   L A   SNP  D+        +S+L+I V I DINDN PLF +P+F+ N PIPE  P+ + VL+L+ATD D+G+NG F F              A +YF ++S  G IVVR+ LD DR            RN                        F F V+VED A  PYS SSEA V +TV D NDE P ++   ++       N +S      N  +V EN P  T V  +   D DF   D V CR   S F L   S ++           + + T +  DRE      V I C D A H+   N ++ +LD+NDN P F  ++ +  ++ENM  GT L                      + D D   N+ V Y L E   +   FKI+   GT+ +  SFDRE      L     D G    +S   + I +LD++DN   F   ++ FH++EN    T VG V A DLD +    I Y + +  +   F IDK +GV+     LDREK  RY   V+A D+N+     +   S        V + IDDENDN+PV + PN T N L  ++ +     +  I +TD+D GEN  + Y + + +++ +F +  T+GL++L                        G++ +DV       S H++ L+ CD G  P  KCT+F  L + + +    +   +EN  +  +I
Sbjct:   62 GKSQAELQSKKDDWGDLFEF-SVLNSGHLGVNSVEVKKDG---RVLVARRIDREQLCLGSQSVGSPLDSVYSVKFVPKLTSQGSHSSMASSSHCIITLKLSVFSRAAQTKITGIKSSKADNPQAILTVRLLIDDINDNAPYWPGHLKRFQVVFRDGDPIGERRTLPPAVDLDSGLNGRLIYELVPTTHSDKNSGTFSLIDHAMEGIYLCATKQVDREEREAYQYILKAIDHSNPDDDQMPSEESRFTSTLVIDVHIEDINDNTPLFVQPIFTPNTPIPETTPVGTTVLILNATDADAGINGAFHFGFSREHAWLPTEIYAKQYFDIRS-NGHIVVRRSLDVDRDKGTPEIFRQEQRNGVQGLSSSGATFLSSSLASGTTIKFRFHVVVEDEAVRPYSRSSEATVVITVSDENDEAPIVEIREVREDIEQKANGVSGPTGNFNFLSVTENKPIGTAVATLQAYDPDFEGTDHVECRLKTSNFSLVQTSNQQNPIMMVPGSVAYHLQTAIELDREVTPVQLVPISCIDTAGHLTERNFSVYVLDENDNPPRFVHNTFHMQVWENMSPGTQLQRMENVQSSVHSNLLYHHPYFTAVDSDTGANADVFYQLIENGMNATTFKIDPKTGTITTTVSFDREAVDHYTLYALAIDHGIPPLTSTSTVKITVLDVNDNAPQFGSVEYTFHLAENQPRATQVGQVTATDLDSDIYGPIHYFVGDESDATNFRIDKMTGVIRCRQALDREKQARYVFTVLAKDTNVHSSNSKSLSSLQLTGTCTVTVLIDDENDNWPVFVNPNSTANTLAVAVDETLGHKLAYIQATDADDGENALITYSIRSGNTNGLFGLDSTTGLLYLSGLFRGTSTSDHDSLTKNVTVNLAGDTRVDVSPALAGPSFHMLTLEACDQGKHPKQKCTLFSNLKILINNRLDGDVDTMENDSQGGQI 995          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A0R3W274 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3893 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.003e-86
Identity = 253/786 (32.19%), Postives = 367/786 (46.69%), Query Frame = 1
Query:  343 IHEIQIEVIDTNDNIPYW--NSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLS-DP----------TRFFKLV--ETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRS---------------SSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSN----KINNKAIEYFIMKSVTGEIVVRKPLDYDR-----------------------GMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQID-------------------FYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVL---NSMSTR--------------------EQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTIL----TGKLR-----SFDKDIDNNSQVHYYLHEASN--KDFKINTHEGTLISLRSFDREERSS--LNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD-ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFL--------KTGNSNLDVEYFST-----------HVIKLKVCDSGNQPKCTV 2304
            +++++I ++D ND  P+W  N     +EF DGD  G R+++P AIDLD    + I Y +  DP          +  FKL+  ++  +LY+Q    +D E TS + L L A++ G+D+S               S+L + V + DINDN P F++P+F+ + P+ E  P+ S+VL L ATD DSG NG F F    N     I+  A   F ++   G ++VR+PLD DR                       GM  F FKV+V D A   Y+ SSEA VN+ V D NDE P I                      A  ++  ++   V EN P +T V  I  +D+DF   DE  C   N  F L      STR                     Q+ I T    DRE      + I C+D+A H +  N T+LI D ND+ P F  + + + + EN P GTIL     G LR     + D D+  N  + Y   E S   ++F IN     + +   FDREE      N+    + +G    +  G + +++LD++DNP  F ++ + F I+EN    T VG V A DLD +  + Y + N  +  +F ID+ SG L T   LDRE    Y  KV+  DS         K   + A V + ++DENDN PV I PN T N L  ++ Q     +  I + D+D G+N  + Y ++  +S  +F I   SGL+FL        +  NS+   E  +            HVI L+ CDSG +P+CTV
Sbjct:  160 VYQLRITILDVNDQAPFWPENLQRHVIEFRDGDPAGKRQSLPLAIDLDQGENARISYRIEHDPLDEPSAEEWDSLPFKLIHDQSDGSLYLQTEREIDHEVTSSYKLVLKATD-GVDKSLPDSLIPERFLRQHTSTLALTVVVQDINDNDPKFTQPVFTPDRPVSEATPVGSIVLRLKATDADSGENGAFHFGFAPNVGWRSIDKLAQHLFDVRP-NGNVIVRRPLDVDRRWKLVDDLKKSPNSDLFGRDNVKGME-FSFKVVVVDEADSRYARSSEATVNIVVMDENDEAPVIGVIRPATSGECIKSLGKPTGIAAGLSSAQTSYACVFENAPVDTFVATIQVSDMDFCGEDEHECVLDNKNFTLIAEEHASTRLSANQLAHVFNSQALKGPGVSQYAILTAATLDREATPFQQIQILCSDRANHQSVHNITVLIGDINDHKPQFAKEVMTYQVPENSPPGTILKPVSVGLLRNSMSLATDGDVGKNEMIKYSFVEGSRTAENFSINPLTAAISTRIPFDREENRKYVFNILAVDQADGGNALTGTGTVEVMVLDVNDNPPAFAQETYTFQIAENLPRGTRVGQVTAFDLDDQGPVSYCLSNDHDALVFQIDRTSGELFTRRPLDREDQSNYTFKVLVRDSATSSGGVEKKTYTATATVTVVLEDENDNSPVFILPNATANTLTVAVSQTLGHKLAVIIANDADEGDNGRVTYKIKAGNSLNLFSIDPQSGLLFLADSLSRFNEASNSSSADEAVTARAIQLSTQPTVHVITLEACDSGVEPRCTV 942          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 211.846 bits (538), Expect = 2.038e-56
Identity = 205/726 (28.24%), Postives = 331/726 (45.59%), Query Frame = 1
Query:  235 TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC-RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTS-DYPINTHVL 2361
            T   IDRE +C     + +    +I++ I+      + +I+I V DTNDN P + S  IN+   +  L   R  IP+A D D    S   Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN P+F +     +  IPE  P+ + V+ L ATD D G N E  +   + +++      F + S TG I V++PLD +    N    V+  D +    S S+ A V + V DVND  P ID   I +   +    + E  P NT +  I  +D D + N +V C    +  F L ++    Q+ + T+ + D E   ++   I  +D       +N+T L+    +++           +   + EN      LT  + + D+D   N+++ Y L   ++  F ++   G L + R FDRE++     TV   D G     S+  + + ILD +DN   FT + F F +SEN    + VG +   D D  EN +V  SILN   +  F++D ++GV+ +N   DRE+   Y   V A DS  P   + +K       V I + D NDN P++I+P    +     L   P   + ++++ D D+G N  L Y + N ++  +F+I   +G + L+                K    DSG        H L VN++   YP + H L
Sbjct:   88 TSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVH--IPESSPVGTSVVQLQATDADVGANAEIKYMFGT-QVSPATRRLFALNSTTGLITVQRPLDREE-TANHKLSVLASDGS----SSSARATVTINVTDVNDNAPNIDLRYIIS-PTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDN-QYLLETSALLDYEGTKEYIFKIVASDSGKPS--LNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLT-TITATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNEN--FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAK-------VTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEE---------------KPTEADSG-------LHRLVVNISDLGYPKSLHTL 766          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 211.46 bits (537), Expect = 2.691e-56
Identity = 205/726 (28.24%), Postives = 331/726 (45.59%), Query Frame = 1
Query:  235 TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC-RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTS-DYPINTHVL 2361
            T   IDRE +C     + +    +I++ I+      + +I+I V DTNDN P + S  IN+   +  L   R  IP+A D D    S   Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN P+F +     +  IPE  P+ + V+ L ATD D G N E  +   + +++      F + S TG I V++PLD +    N    V+  D +    S S+ A V + V DVND  P ID   I +   +    + E  P NT +  I  +D D + N +V C    +  F L ++    Q+ + T+ + D E   ++   I  +D       +N+T L+    +++           +   + EN      LT  + + D+D   N+++ Y L   ++  F ++   G L + R FDRE++     TV   D G     S+  + + ILD +DN   FT + F F +SEN    + VG +   D D  EN +V  SILN   +  F++D ++GV+ +N   DRE+   Y   V A DS  P   + +K       V I + D NDN P++I+P    +     L   P   + ++++ D D+G N  L Y + N ++  +F+I   +G + L+                K    DSG        H L VN++   YP + H L
Sbjct:   88 TSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVH--IPESSPVGTSVVQLQATDADVGANAEIKYMFGT-QVSPATRRLFALNSTTGLITVQRPLDREE-TANHKLSVLASDGS----SSSARATVTINVTDVNDNAPNIDLRYIIS-PTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDN-QYLLETSALLDYEGTKEYIFKIVASDSGKPS--LNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLT-TITATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNEN--FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAK-------VTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEE---------------KPTEADSG-------LHRLVVNISDLGYPKSLHTL 766          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 210.69 bits (535), Expect = 6.153e-56
Identity = 218/782 (27.88%), Postives = 350/782 (44.76%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFK-NLGITTEFVSVLNQRD-FKVSHFG-IKFDSGILRLITLKN-IDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIV--EDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXX----XXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            VL+L     L       + V E       I +L +D   NL    +  S L  +  +K      ++ ++    + T  N IDRE +C       N   C  +I++ ++      + +I+  + D NDN P + S  IN+   +      R  +P+A D D  +     Y L      F L  +ET +      L +Q +L  D ET   F + +   + G   +SS+ ++QVT+ D+NDN P+F       N  +PE+ P+ + V  L ATD D G N +  F   SN+I+     +F + S TG I V++PLD +    N   K+IV   D +  P    S A V + V DVND +P ID   I N  ++    + EN P NT +  I   D D + N +V C + +           +QF + T    D E   ++ + I  +D       +N + ++L        N P F    +   + EN   GT L  K+ + D D  +N+ + Y L   +   F I+   G L   +  DRE++   + TV   D G+    S   + +++ D +DN   FT  ++ F++ EN  +   VG +   D D  +N IV  SI+N K++  F+ID  +GV+  N   DRE+   Y   V A DS +           S A V I + D NDN PV + P+  ++         P   + ++++ D+D+G N  L Y +       +F I +T+G + L+   +N D      H + +KV D G QP+
Sbjct:   51 VLILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCS---GVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNL--DRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN--VPENAPMGTSVTQLHATDADLGSNAQIHFSF-SNQISPATKRHFAIDSSTGLITVKQPLDRES---NPVHKLIVLASDGSATP----SRATVIVNVTDVNDNVPSIDTRYIMN-PVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPP--LNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLI-KITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDN--FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGL-------IQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQ---GLHRLVVKVKDLG-QPE 800          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 208.764 bits (530), Expect = 3.221e-55
Identity = 217/786 (27.61%), Postives = 348/786 (44.27%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFK-------NLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKN-IDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIV--EDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXX----XXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            VL+L     L       + V E       I +L +D          L    +F  V    D  +    ++ ++    + T  N IDRE +C       N   C  +I++ ++      + +I+  + D NDN P + S  IN+   +      R  +P+A D D  +     Y L      F L  +ET +      L +Q +L  D ET   F + +   + G   +SS+ ++QVT+ D+NDN P+F       N  +PE+ P+ + V  L ATD D G N +  F   SN+I+     +F + S TG I V++PLD +    N   K+IV   D +  P    S A V + V DVND +P ID   I N  ++    + EN P NT +  I   D D + N +V C + +           +QF + T    D E   ++ + I  +D       +N + ++L        N P F    +   + EN   GT L  K+ + D D  +N+ + Y L   +   F I+   G L   +  DRE++   + TV   D G+    S   + +++ D +DN   FT  ++ F++ EN  +   VG +   D D  +N IV  SI+N K++  F+ID  +GV+  N   DRE+   Y   V A DS +           S A V I + D NDN PV + P+  ++         P   + ++++ D+D+G N  L Y +       +F I +T+G + L+   +N D      H + +KV D G QP+
Sbjct:   51 VLILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPL----VRVEASTGEIFTTANRIDRERLC---SGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNL--DRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN--VPENAPMGTSVTQLHATDADLGSNAQIHFSF-SNQISPATKRHFAIDSSTGLITVKQPLDRES---NPVHKLIVLASDGSATP----SRATVIVNVTDVNDNVPSIDTRYIMN-PVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPP--LNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLI-KITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDN--FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGL-------IQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQ---GLHRLVVKVKDLG-QPE 800          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 205.682 bits (522), Expect = 2.977e-54
Identity = 213/783 (27.20%), Postives = 348/783 (44.44%), Query Frame = 1
Query:   19 VLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFK-NLGITTEFVSVLNQRD-FKVSHFG-IKFDSGILRLITLKN-IDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRF---FKLVETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIV--EDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXX----XXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            VL+L     L       + V E       I +L +D   NL    +  S L  +  +K      ++ ++    + T  N IDRE +C       N   C  +I++ ++      + +I+  + D NDN P + S  IN+   +      R  +P+A D D  +     Y L           ++ET +      L +Q +L  D ET   F + +   + G   +SS+ ++QVT+ D+NDN P+F       N  +PE+ P+ + V  L ATD D G N +  F   SN+I+     +F + S TG I V++PLD +    N   K+IV   D +  P    S A V + V DVND +P ID   I N  ++    + EN P NT +  I   D D + N +V C + +           +QF + T    D E   ++ + I  +D       +N + ++L    ++           +   + EN   GT L  K+ + D D  +N+ + Y L   +   F I+   G L   +  DRE++   + TV   D G+    S   + +++ D +DN   FT  ++ F++ EN  +   VG +   D D  +N IV  SI+N K++  F+ID  +GV+  N   DRE+   Y   V A DS +           S A V I + D NDN PV + P+  ++         P   + ++++ D+D+G N  L Y +       +F I +T+G + L+   +N D      H + +KV D G QP+
Sbjct:   11 VLILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLC---SGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNL--DRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN--VPENAPMGTSVTQLHATDADLGSNAQIHFSF-SNQISPATKRHFAIDSSTGLITVKQPLDRES---NPVHKLIVLASDGSATP----SRATVIVNVTDVNDNVPSIDTRYIMN-PVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPP--LNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLI-KITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDN--FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGL-------IQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQ---GLHRLVVKVKDLG-QPE 761          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.889 bits (481), Expect = 4.162e-50
Identity = 211/819 (25.76%), Postives = 343/819 (41.88%), Query Frame = 1
Query:   55 KSMLKFKVDEGVQVGTEIADL-------------TSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIIL-----GGS-LTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPT------RFFKLVET-----------------ADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFI-MKSVTGEIVVRKPLDYDR-GMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISN-QFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLN------------FYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-----FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVF------TKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILN----PKNDYIFLI-DKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSI-FQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            +  L ++VDE V VG  I DL                   L + T  + ++N+   ++S             + L+ +DRE +C  E +   S G    +Q+       G S L + ++Q+ V D ND+ P + +  +NV   + +  G R  +P AID D+   S   Y +S  +        F LVE+                      ++    LD E    + L L+  + G  + S S+L+ + +VD NDN P+F  P  +R   I E   + + V+ L A D D+G NG  ++   + K+ + A +  + +   TG + VR     DR  M      V+  D   L  S S+   V + + D ND  P  +  A+Q   + +    ++EN P  T V  I  +D D   +  V  R         +   + QF + TT + D E+  ++ VS+   D+      ++K L ++    +     P  +N              L EN P+GT++   L + D D   N  + + L E +  +     F +N   G L      DRE+R    L+V   D G+ +R ++  + + +LD +DN   F      T   + F + E + + T VG+V   DLDE       LN       D+I    D   GV+ T   LDRE   +Y + V A DS  P   A+S + +    V I + D NDN PVI  PN      +   F P    +   + + D D+G+N   +Y +   +   IF ++  SG + L    S+LD      H + ++V D G 
Sbjct:   26 QGALLYEVDEEVLVGYVIGDLRQSNLLCVCFFPPAPHVSPLPLHTPSLCIVNELSGELS-------------VALR-LDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDP-PTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHT-KLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQL--SRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTP--KLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVL-NLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRP---ALSASCR----VSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLD---EGLHRLVVRVRDRGG 813          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 159.844 bits (403), Expect = 1.837e-40
Identity = 204/823 (24.79%), Postives = 356/823 (43.26%), Query Frame = 1
Query:  241 KNIDREVICEYEKNKINSDGCKIDIQIIL-----GGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRF----FKLVETADN---LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAI----EYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNS--FFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHM--NYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG--NQPKCTVFHPLYVNLTSD--------------YPINTHVLENTKKEK---KIFTAFWILTSIITVSLLTAFITGSILLYLKIRSNQAKIIVNMFEDHRNIKPNCRRKKFQNS 2568
            + +DRE +C     +   D C +D+Q+ +     G    + E++I V D NDN P + +  + V   +    G R  I  A D DS       Y L  SDP         + ETA+     Y+     LD E    + ++L A + G    S S ++++ + D NDN P+F +     N  IPE+ P+ + V+ L A+DRD+G N E  +R+ ++     +       F +   +G + V   L+ +    +  +++I+      P  + + A V +TV DVND  P I+   I    ++    + E +  N  V  I  +D D   N  V C   N    F L  ++   Q+ + T    D E ++++ V I+  D         ++ T+ +LD NDN P F   +    + EN   G  L   + + D+D+D N+++ Y+L   +   F ++   G +      DRE++++ + T+  +D+G         + + +LD++DN   F+  +F F+++EN   ++ VG V   D DE     +  SIL   N  +F ID  SG++ +N   DRE+   Y ++V A D   P+  +  K       V I + D NDN P+++ P  N T+  +       P   + ++ + D+D+  N  L Y +   + H +F I    G + L      L   +   H + ++V D G   Q        ++VN T +               P++T V    ++E+   K+     +L  ++ V+L+          Y   R      IV      +      + KK  N 
Sbjct:  100 RKMDREALC---GGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQ--AEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREE---SPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVA-PVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLI-TVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVK-------VVIHVMDINDNSPIVLMPPSNTTYKFVVPRTL--PGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLM---EPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENATYIEWLIAGSLQTPLDTDVAGFGRREQEDNKVLLLAAVLAGVLGVALIVLLGVLVHRCYCNRRKGGGGGIVRAKHGGQEWLSPTQEKKHSNG 900          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 151.754 bits (382), Expect = 6.323e-38
Identity = 171/680 (25.15%), Postives = 305/680 (44.85%), Query Frame = 1
Query:   64 LKFKVDEGVQVGTEIADLTSDFKNLGITTEFVS----VLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILG-GSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRF-FKLVETADNLYIQNSLM---LDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGE--FSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINK--TLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTH------EGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKF-----VFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYL---DREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDN 2010
            +K+ + E    GT +  L+ D +  G   E  S    ++ + DF + H  ++   G +    +  IDRE  C    + +     + D+   L  G   +   ++E++D ND+ P +    ++VE  +    G R  +  A DLD    +   Y+L +  RF   L    D       ++   LD E   ++TL L A + G   RS + L+++T++D NDN P+F++   S N  + ED    +V+L L+ATD D G NGE  +SF   S+ ++ +    F +   TG++ ++  LD++    N  +++ ++     P S+ +   V + V D+ND  P+I    I  ++    F V E     + VG +  +D+D  EN  V C  L        +  R+ + + T    DREQ   +F+ +E +D         +  T+ +LD+NDN+P F   +    L EN   G  +T  + ++D D ++N  + Y + E+      ++T+       G + +LR  D E  +SL   V   D+G     +   + + I+D +DN  V T         V  +  ++ +  +V  V+A D D      + Y I+      +F I++  G + TN+           R+ + V+  D   P   A+S    + A +EI++    D 
Sbjct:   31 VKYALYEEQPAGTLVGRLSDDLQ--GRVAEHPSRHFRLMRRDDFSLVH--VEEADGTVSAREV--IDREQQCGQAPSCV----IRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQ--TSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSF---SSPVDAEVRRLFQLDPKTGKLSLKGQLDHEL---NSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVF-VSEGAAYESFVGLVTVSDIDSAENGLVACH-LRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVT-TVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSP---ALS----ATAAIEIRVGAHGDG 682          

HSP 2 Score: 80.8777 bits (198), Expect = 8.311e-16
Identity = 129/571 (22.59%), Postives = 229/571 (40.11%), Query Frame = 1
Query:  667 QVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTV-------IFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDK--------DIDNNSQVHYYLHEASNKDFKINTHEG--TLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSILNPK------NDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS-----IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            +V ++DIND+ P F++     +  I E + + + V +  A D D G N   ++ +D N+    A+      +   E+VV+  LD ++    +  ++   D    P S ++   V +TV D ND  P    +A    + S    V E+    T++  +   DVD   N EV    + SF        R  FQ+             D E   ++ +SI+  D        +  +L+    D +       L+F +       T+   +  +++         DID+        H   +  FK+  +     +++  S DRE+ +   L +   D G   R +     + +LD +DN   F +  +   + EN+     V +V A D D      I Y+++  +      + Y+  I+  SG +     LD E +     +V A D  +P    +  N    A V ++I DENDN PV+  P     R    + + P  +     +  + + DSDS  N  L Y +   +   +F+I+R  G VF    +        + H + + V D G+
Sbjct:  123 EVELLDINDHAPDFARSEM--HVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQ-EGEYTLQLTAWDGGDPPRSGTT--LVRITVLDSNDNSP---VFA----QTSCNVTVREDATPGTVLLTLNATDVDEGPNGEV----VYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLV-HVEDINDNAPEIKLDFIMQSR--GDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVS-INPSSGAIYALRPLDYEAMTSLTFQVQARDDGVP---PLVTN----ATVSVRIVDENDNAPVVTHPPL---RNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGS 663          

HSP 3 Score: 75.485 bits (184), Expect = 3.286e-14
Identity = 112/451 (24.83%), Postives = 190/451 (42.13%), Query Frame = 1
Query: 1063 IQNNKISNQFAVLENTPKNTLVGFI---MTNDVDFNENDEVFCRSLNSFFVLN------SMSTREQFQIYTTVIFDREQQDKHFVS------IECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGT--ILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGT-------LISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYI---FLIDKFSGVLTTNSYLDREKVDRYFIKVVAFD---SNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQ-----IYSTDSDSGENQTLIYGMENEDSHKIFKI--HRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK 2295
            +    I+ ++A+ E  P  TLVG +   +   V  + +        + F +++      ++S RE        + DREQQ     S      + CT        ++  + +LD ND+ P F    ++  + E++  GT   L G   + D D+  N+   Y+L E  N+ F +     T       L+     DRE+     L +   D G+  RS    + I +LD +DN  VF +      + E++   TV+ ++ A D+DE     +VYS  +P +  +   F +D  +G L+    LD E    Y I + A D   S+IP   A  K       V + ++D NDN P I       +R +       E + ++     +  +D DS EN  +   +     H  FK+  +R   +V     NS+LD E  + + + L+  D G  P+
Sbjct:   24 LGTTAITVKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFSLVHVEEADGTVSARE--------VIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEG---ARDLDVGGNALRAYHLDE--NERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIP---AHCK-------VLVHVEDINDNAPEIKLDFIMQSRGDTVFVS--EGAAYESFVGLVTVSDIDSAENGLVACHLRG---HPHFKLLPYRDDYVVVT---NSSLDREQMADYFLVLEASDGGTPPR 443          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 2.563e-36
Identity = 167/667 (25.04%), Postives = 284/667 (42.58%), Query Frame = 1
Query:  340 TIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFS---RNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYH----MNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLH----------EASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFT-HNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCD 2277
            + ++++I V D NDN P +    + +E  +    G      +A D D    + + Y++   +    +V+ A  + ++ S  LD E  + + L + AS+ G   + + L  V + D NDN P FS+  +S     +  P+     +V+  + A D DSG  GE ++ +  ++ ++ A   F +  VTG + V +PLD  R  R  +   ++   A     L++ A + + V D ND  P     ++QN+ ++ +  V E+ P  T +  I   D D   N E+   S++S       +     Q+      DRE+Q  + + +  +D+A H    ++   +  LIL D +++   F    +    E+ P G ++   +++ D D   NS V Y L            A    F +NT  G +  +R  DRE R S  LTV   D+G    +S   + + + D +DN   F + ++   I+E+    T V  + A D DE     + Y I +      F +D   G L     LDRE+   Y + V A D   P            A V + + D ND  P      +T H R N    Q P   I Q+ + D D G +  + Y     +    F +     +  L++    LD E    HV+ +   D
Sbjct: 1498 SFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGV-LRASRRLDREERASYLLTVRASD-GTHATDARL-SVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLD--RESRACY---VLRARATDGGGLAATARLYVNVLDANDNAP-----SVQNDSLAAE--VPEDAPPGTSLLRISATDDDEGVNAELEF-SISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVA-TVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPAR-------SDTASVRVTLSDVNDCSPAFQLSPYTVHARENT---QGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRS----LDREAQPQHVLIITATD 2133          

HSP 2 Score: 145.206 bits (365), Expect = 1.479e-35
Identity = 197/740 (26.62%), Postives = 317/740 (42.84%), Query Frame = 1
Query:   70 FKVDEGVQVGTEIADLTSDFKNLGITTEFVSVL-NQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKI-NSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADN-LYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVV-----RKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQF-------QIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI--LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEA-SNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILN--PKNDYIFLIDKFSGVLTTNSYLDREKVDRYF-IKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKT 2214
            F V E V  GT +  +++   +L     ++ V  +QR      F I++  G  R+ T   IDRE    Y+   + NS G   +  +    S+ +H       D N++ P ++  S  V   + +    R     A D DS     + Y + +     K     D  LY++    LD ET  +++L + A + G++  SSS+ + VT++D+NDN PLF+   +  +    E+  + S+V  + ATD D+G NG  ++  +  ++N      F + S TG I       R+ L    G  +F F V+  D    P  L   A V + V DVND  PQ         K   Q +V E+    T +  +  +DVD   N  +        + +N  +   +F       QI      DRE+   + + +  TD        + T+ +  LD+NDN P F    L+    E+   G +L   L + D+D   +  V Y +    ++  F I+   G++   R  D E +    L V  ED G   RSS   + + + D +DNP  F        I EN  I T V +V A D D +    + YSI    P   + F ID  SG + T + +DRE     F + V A D  IP+    S    ++  V + + DENDN P  + P      L   L       +  + ++D D  EN  + Y +   D+  +F++ R +G++   T
Sbjct:  665 FVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQR----GSFSIEWSGG--RIFTANAIDREEQAFYQLRVVANSGGVAGEASV----SVLVH-------DVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVR--YELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFH--FCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN------FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGG-RPKPLQDRATVQVFVQDVNDNPPQF-------AKSVYQASVSESASNLTQLLRVTASDVDEGVNGALR-------YAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLI-TLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAH-FTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRS----ALKNVTVLVTDENDNAPRFVTPTAI---LVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETST 1353          

HSP 3 Score: 141.354 bits (355), Expect = 2.588e-34
Identity = 196/773 (25.36%), Postives = 331/773 (42.82%), Query Frame = 1
Query:   82 EGVQVGTEIADLTSDFKNLGITTEF-VSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSD-GCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSD--PTRFFKLVETADNLYIQNSLM--LDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFF-FKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQI--DFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQF-------QIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDR------YFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPE--KSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP---KCTV 2304
            EG   G+ + D+T+   + G+  +   S+++  D     F +   +G++   T   +DREV      N    D G +         SLT+      ++D ND  P +         ++  LPG+     +A D D     T+ YN     P ++ ++    D+L  + + +  LD E   ++ L + A + G     S+  + V + D+NDN P+F    +  +  I E+ P  + V  ++ATD D G NG   +++ +          F + +VTG +  R  LD  R  R  +  +V   D   L     S A V +TV D  D  P    D Y+         F V EN    TLVG +  + +D N          N  +++ S   R  F       +I+T    DRE+Q  + + +   +        + ++L+ D N++ P F   S    + E+ P  +     +R+ DKD   N +V Y + E +  + F I   +G L      DRE R   +LTV   D G    SS   +++ +LD++DN  +F    +VFH  E   + ++VG+VQA D D  +   + YS   P+ +  F +D  +G + +    DRE + R      +   VVA D   P      K  +  A V++ + D NDN      P F  +   AS+ +       + ++ ++D D G N  L Y +   +    F +  ++G + L     +LD E  +++ + +   DSG  P    CTV
Sbjct:  352 EGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL--GWFSVDESTGLV--TTDGKVDREVASSVVLNISAQDQGAQPKTAYT---SLTV-----TLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRL-DSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFAS--ILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR-----FQVNAVTGAVSTRVSLD--REERAVYQLQVTALDGGHL--RARSPAIVTITVADAQDTPPTFARDDYS---------FVVFENVAPGTLVGSVSASTLDLN---------ANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRV-VANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFF-SVRATDKDSGKNGEVKYEIGEGNGGEKFGI-FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN--FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRP------KPLQDRATVQVFVQDVNDN-----PPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLL---GSLDREETASYTLVVSATDSGTSPLAASCTV 1063          

HSP 4 Score: 133.65 bits (335), Expect = 6.084e-32
Identity = 159/674 (23.59%), Postives = 284/674 (42.14%), Query Frame = 1
Query:  349 EIQIEVIDTNDNIPYWNSDSI-NVEFMDGDLPGIRKTIPTAIDLDSS-------VFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRS-SSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSL-----NSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXX---XSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAV--DLDENTIVYSILNP----KNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDN----FPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            E+++ V D NDN P +    +  V F +    G +  + TA+D D          +  +  N        + V     L++  +  LD E    + L + A + G  R    L + VT+ D NDNPP F KP +  +  + ED P+ + +  L    R     G  +   D                 TG +  R+PLD++   R +   +   D    P S  + A + L   DVND  P I F  +     +   +V E+    T+   +   D D    +     S+        FVL++        +      DRE+   + ++I  +D    +       L++  ND + +       +    L E  P+G+ +   + + D D   N+++ Y +   ++   F ++   G + +    DRE  SS+ L +  +D+G   +++   + + +LD++D P +FT+ K+V    ENS+    V SV A   DL EN  V    +P    +   +F +D  +G +TT   LDRE+++ Y + V A D   P   + +K       V + + D NDN    +PV  F +   N       +P   ++  + +TD D G N T+ Y +   D+ + F+++  +G V  +    +LD E  + + +++   D G+
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRAS--VAEDSPVGAALRDLLHRGR-----GPLAVPFDPK---------------TGMVSTRQPLDFE-ARRQYTLSLRAADGGNPPLSGRATAVIQLL--DVNDNDPAIRFVYLP--PAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVK-DVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAK-------VTVVVGDLNDNHPVFYPVQYFASILEN-------EPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR-FQVNAVTGAVSTRV---SLDREERAVYQLQVTALDGGH 635          

HSP 5 Score: 131.724 bits (330), Expect = 2.341e-31
Identity = 172/726 (23.69%), Postives = 303/726 (41.74%), Query Frame = 1
Query:  196 FGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIP-----YWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSV----FSTIFYNLSDPTRFFKLVETADNLYI-QNSLMLDSETTSKFTLHLYASNPG--IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVG--DVNDEIP---QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV-------FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY--LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT-IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
              + FD     + T + +D E   +Y  +   +DG        L G  T     I+++D NDN P     Y    + +    +   PG    + T  D DS       S      ++   F         L + + +  LD E    + L + AS+ G  + RS++  + V + D+ND+ P F+   ++    + E  P  S V  ++A D DSGLN +  + I    ++   + +F +   TG +     +D +    +    +  +D    P +    A+ +LTV   DVNDE P   Q  + A            +EN+     V  +   D D  EN  V               F L+S++ +    + T    DRE+ +++ + ++  D+          + ++  + ND +     + ++  + EN P GT +T  + + D D   N  V Y L       F++N   G + +  S DREER+   L V   D G+++  S   + I + D  D P  F +D + F + EN    T+VGSV A  LD N  + Y I++      F I+   G + T + +DRE+   Y ++VVA    +  E          A V + + D N++ PV    ++    ++ +  +P     F + +TD DSG+N  + Y +   +  + F I    G ++++     LD E    + + +   D+G +P
Sbjct:  166 LAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPP----LSGRATA---VIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAA--LSEGAPAGSYVKDVTAMDADSGLNAKLRYSI----VSGNDLGWFSVDESTGLVTTDGKVDREV-ASSVVLNISAQDQGAQPKT----AYTSLTVTLLDVNDEPPLFTQTKYVAT----------AVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGK----VTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVT-TVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGE----------ASVSVLVHDVNNHAPVFDRASY---EVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIF-PDGQLYVRY---ELDRETREEYSLTVSAMDTGVEP 841          

HSP 6 Score: 120.939 bits (302), Expect = 5.163e-28
Identity = 133/567 (23.46%), Postives = 233/567 (41.09%), Query Frame = 1
Query:  664 IQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMR-NFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVD---FNENDEVFCRSLNSFFVLNSMSTRE-QFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGN---VKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKND------------YIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLF--QPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKC 2298
            +++++ D+NDNPP+F+ P       + E+     V+  LSATD D G N   ++ + S          F++ + +G  V+R     DR  R ++   V   D        +++A +++ V D ND  P+   +A   +   +  A  +      ++G ++  D D   F E       S +S +   +         +  T   DRE +  + +    TD           + +LD NDN P    DSL   + E+ P GT L  ++ + D D   N+++ + +     +      ++G L   R+ DRE +S  NL V V D       + SS   + +++ D++DN   FT  +      E+S +  VV +VQAVD D     Y       D              F ++  +G +     LDRE    Y + V+A D   P          S A + + + D NDN      P F      A++   +PP   + ++ + D D G N  L Y + + D    F++    G + +      LD E  +++ + ++  D G   + 
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELE--VEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEG-----AFVVDAASG--VLRASRRLDREERASYLLTVRASDGTH-----ATDARLSVAVRDANDNSPRFSRHAYSFDVAED--AAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLL-RISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL-APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPL-------TSTATLAVTVGDANDN-----APRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVA---RPLDRERTASYELAVRARDGGGPARS 2035          

HSP 7 Score: 100.908 bits (250), Expect = 7.395e-22
Identity = 123/525 (23.43%), Postives = 215/525 (40.95%), Query Frame = 1
Query:   94 VGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLS--DPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHL----YASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNG--EFSFRID---SNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDE----VFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXX--XXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVED 1617
            +GT +A   +D    G  T  ++     D+    FG+   +G L +   + +DRE    Y      +DG         GG      + + V+D NDN P   +DS+  E  +   PG      +A D D  V + + +++S  DP   F +    ++  +  +  LD E  S + L +     A +P    SS++ + + + D+NDN P F+ P   R+   PED P+ +VV  + A D DSG N   E++   D              F + +VTGE+ + + LD +   +++   V+  D    P  L+S A + +TVGD ND  P+         +   + A+ E+ P  T V  +   D D   N E    +        F L+ +       +      DRE+   + +++   D          ++ +   + ND            +  EN     +L  ++ + D D+ ++ QV Y     ++      + +G +  LRS DRE +    L +   D
Sbjct: 1641 IGTVLAG-DADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVT--RPLDRESRACYVLRARATDG---------GGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAV---GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP---RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDRE-ARQSYALTVLAVDKGRPP--LTSTATLAVTVGDANDNAPRFP-------RREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPV----LGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 8 Score: 69.707 bits (169), Expect = 3.089e-12
Identity = 62/237 (26.16%), Postives = 107/237 (45.15%), Query Frame = 1
Query: 1651 IHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS----IFQIYSTDSDSGENQTLIYGME-NEDS---HKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNL 2328
            + I + D++DNP VF   +    + EN+    V+ ++ A D D+     + YS+L+  ++  F++D  SGVL  +  LDRE+   Y + V A D            + + A + + + D NDN P   F    ++   A    P  K+    I  + + D+DSG    + Y +  +EDS      F +H  +G + +      LD E  + +V++ +  D G          LYVN+
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLS-GSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG----------THATDARLSVAVRDANDNSPR--FSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNV---TRPLDRESRACYVLRARATDGGG---LAATARLYVNV 1719          

HSP 9 Score: 62.7734 bits (151), Expect = 3.550e-10
Identity = 79/321 (24.61%), Postives = 127/321 (39.56%), Query Frame = 1
Query: 1453 SFDKDIDNNSQVHYYLHEASNKDFKI--NTHEGTLISLRS--------------FDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDS----GENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP---KCTVFHPLYVNLTSDY 2340
            + D+D+  N   H+         +KI     EG L+  R                DRE   S  L V  ED G+ +R  +  +++ + D +DNP  F K  +   ++E+S +   +      DL        +   +       D  +G+++T   LD E   +Y + + A D   P    +S    ++    I++ D NDN P I F        +AS+ +   P      +  TD+DS    GE    I G  NE  H +       GL  LK   S LD E    + + +   D+G +P     T    +YVN  +D+
Sbjct:   48 AVDRDVGPNGVNHHA--------YKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDL--------LHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNP---PLSGRATAV----IQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGG-NERGHFVLHAPGVPGLRVLKVA-SQLDRERIPMYNLTILASDNG-KPVARSATASLVVYVNDVNDH 337          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 9.216e-29
Identity = 172/682 (25.22%), Postives = 302/682 (44.28%), Query Frame = 1
Query:  331 GSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGE---IVVRKPLDYDR-GMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVD----FNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIEC------TDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGT-ILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISL-RSFDREERSSL------NLTVYVEDEGNVKR--SSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSILN--PKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS--IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            GS  +H   I +I+ NDN P ++    NV   +    G       A DLD+ VF  + Y+ SD +  F L + A  L I  +  LD E T +FT+ + A + G  + ++  +++ ++D+NDN P+F +  +        D  +  VV V  ATD DS  N + ++ I    +   A   +   +V+G    + + + LDY++         ++  D    P + +  A V   V D ND  P  D       + S   A+ EN      V ++   D D    + +   ++    ++ F +N+ S      I +T + DRE   ++ + +         DQ   +  +N TLL ++DND      P ++   + EN P GT I T  + + D D++ N  + Y + +  N  ++IN   G + +     DRE+ + +      ++ V   D G+  R  ++   + +++ D++DN   F    +   + E    N+ +  V A D DE     + YS+    P+ D  F +D  +G++TT   LDRE V  Y +++VA D   P   A+S    S   + + + D NDN      P F   R   SL +   +   +  +  TD+DSG N  L + +   +    F +    GLV       +LD E  +++ + ++  D+G
Sbjct:   12 GSARVH---ITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSL-DPASGL-ISVAAALDFEATPRFTVTVMARDGG-GQETAGRVRINLLDVNDNTPVFQRDSYV-GTARENDNSLTPVVRV-RATDEDSPPNNQITYSI----LPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVE--VFDENDNSPIFD-------RNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSG----DITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVT--IVENTPGGTDIFT--VSAADPDLNENGTLVYAI-DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPD--FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTP---ALS----STTTLSLVVLDVNDN-----APTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVV---SLDRETKASYSLVIEAIDNG 646          

HSP 2 Score: 119.013 bits (297), Expect = 2.428e-27
Identity = 163/689 (23.66%), Postives = 293/689 (42.53%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYW-NSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLP-YSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLV----GFIMTNDVDFNENDEVFCRSL---NSFFVLNSMSTREQFQIYTTVIFDRE--QQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDID--NNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPK-----------NDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHK-----IFKIHRTSGLVFLKTGNSNLDVEYFSTHVI-KLKVCDSGNQPKCTVFH 2310
            + + V D ND  P++  S    ++  +G  PG R     A D DS +   + Y++   DP   F +     +L ++  + LD ET + + L + A + G    +S+L + V ++D++DN P+F       N  + E   + ++V  + A+D + G N     +       N     F   S TG + V +PLD +R +  +   + V D+   P Y+      + +T+ D ND  P         ++++ +  + EN+P  T++    G I  +D DF  N  +    L   +++F+++    R    +      DRE     +  ++I   D       +   + +LD NDN P F   S   ++ EN P+       +++ D+D+   +   V Y +    N  F I+   G ++++   D E R    L V   D+     ++   + + + +  D  + F+   +   +SE +V  TVV  V A  +    +  +  +IL  K           +D   LI    G +TT + LDRE  D Y + V++ D   P E      NK  A V + + DENDN P     + T   +  S    P   +  +++TD D+G N T+          +     I  I   SG+  +    ++  VE  S  ++ ++   D G+ P+ T F+
Sbjct: 1268 VSVHVADVNDVTPWFLRSYEGPIDVSEGQ-PGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLN--LPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGE-RAFYADSQTGLVYVNRPLDRER-VAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVF-------SQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDR--DRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGG-PREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRES--AAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADF-VEKTSQFILFRIVALDGGSPPRSTTFN 1938          

HSP 3 Score: 115.931 bits (289), Expect = 1.915e-26
Identity = 167/688 (24.27%), Postives = 291/688 (42.30%), Query Frame = 1
Query:  328 GGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGD---LPGIRKTIPTAIDLDSSVFSTIFYNL---SDPTRFFKLVETADNLYIQNSLMLDSE-----TTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSG-----------LNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVF--CRSLNSFFVLNSMSTREQFQIYTTVI-FDREQQDK-HFVSIEC-----TDQAY--HMNYINKTLLILXXXXXXXXXXXXSLNFYL--YENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEA-SNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS--IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLK 2268
            GG  T   ++I ++D NDN P +  DS      + D    P +R     A D DS   + I Y++   S  + +F +  +     +  +  LD E     T S   + L   +P ++ + + +++V   D NDN P+F +  +S    IPE+I   + VL ++ATD D             L G   FRI++   +  +      ++V+  I++ + +D   G           D        +  A VN+T+ DVND  P           +     ++ENTP  T +  +   D D NEN  +       N F+ +N+ S +    I TT +  DRE  +   F S+        D+         + T+ +L  + ND       L + L   E +P+ + L  ++ + D D   N  V Y +  A    DF+++   G + +L   DRE  ++  L +   D G    SS   + +V+LD++DN   F   +    + E+   ++VV S+   D D      + + I     D  F +    G++ T   LDRE    Y + + A D+      A S+   +  L ++ + D NDN P+     F       S+ +   +   I Q+ +TD D G N  + Y + + +    F ++ +SGL+    G + LD E  + H ++++
Sbjct:  109 GGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVR---ATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEV--FDENDNSPIFDRNSYSI--AIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDG----------NDQK------TGIATVNITLLDVNDNDPAW-------RDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGK----IRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLF-QVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNG----PAGSRRTGTTTL-DVLVLDVNDNRPL-----FLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLI--SRGATPLDRETVALHALQVE 749          

HSP 4 Score: 115.161 bits (287), Expect = 3.362e-26
Identity = 151/577 (26.17%), Postives = 252/577 (43.67%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDG-DLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSL-------MLDSETTSKFTLHLYAS-----NPGIDRSSSLLIQVTIVDINDNPPLFSK----PL-FSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFF-FKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEN--------DEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINK-----TLLILXXXXXXXXXXXXSLNFYLYENMPSGTILT---GKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTL-ISL-RSFDRE--ERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENS-VINTVVGSVQAVD-----LDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEA 1947
            + I + D NDN P + + +  V   +G    G+     TA D D    + + Y +           TA    I N          LD E ++   L +  +     +P    +S+  + V + D+ND  P F +    P+  S  +P P        +    A+D+DSGLNGE  + I      N+    F++    G++ VR+ ++ DR  + F+   ++ +D    P  L+S   V + V DV+D  P +      N  +S   AVL       +V  +  +D +   N           FC    +F+     +  +   +Y     DRE+  ++ +++   D   + +Y  K      + ILD+NDN P F   +    + EN P+GT+LT   G + + D D   N+ + Y L   S+  F I+   G + ++L +  DRE      L LT+ V+D G  +R++   + + +LD++DN   F       H+ ENS  + T V  V+A+D      D  T+ YSI +  ND  F ID+ +G++ T + +D E    Y + VVA D   P   A
Sbjct: 1158 VLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGN-------TAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPR-------IATFMASDQDSGLNGELEYSIIDGDPRNE----FVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPP--LNSTLTVGVRVLDVHDNDP-VFLNLPANASLSEAAAVL------AIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFY-----ADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGG--RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGND-TFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTA 1699          

HSP 5 Score: 103.219 bits (256), Expect = 1.609e-22
Identity = 153/585 (26.15%), Postives = 250/585 (42.74%), Query Frame = 1
Query:  619 LYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRI--DSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP--QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQI-----YTTVI----FDREQQDKHFVSIECTDQAYHMNYINKTLL----ILXXXXXXXXXXXXSLNFYLYENMPSG-TILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVED--EGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSG-VLTTNSYLDREKVD------RYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            L+A+    +   S  + +T+++ NDN P+FS PL+  N  + E+  + + V+ + ATD D+G+ G+ S+    DS+K        F +   +G I V   LD++   R F   V+  D         +   V + + DVND  P  Q D Y              EN    T V  +   D D   N+++      ++ +L + +    F I     Y  V      D E+     +S+           +N T+     + D+NDN P F  +S +  + EN+ +G T+L       D+  +       Y  E S + F+IN   G + S    DRE  S   L V   D  +GN +++    ++I +LD++DN   +    +   I EN+   T + +V A D D N   T+VY+I +P N + + I+  SG + TT   LDRE ++         I V   D   P   A +      A V + + D NDN P  +   +    L      P   ++FQ+ +TD D G N  + Y M        F++   +GL+   T    LD E  + + ++L   D G
Sbjct:    1 LFANETSGEHWGSARVHITLINENDNRPIFSLPLY--NVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDK--------FSLDPASGLISVAAALDFEATPR-FTVTVMARDGG----GQETAGRVRINLLDVNDNTPVFQRDSYV---------GTARENDNSLTPVVRVRATDEDSPPNNQI------TYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQ-FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI-DPPNPF-YRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATAS-----ATVTVLLQDVNDNEPSFVGLPYALQVLEG---LPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLI---TTLVQLDREAVAAYQLRLVATDRG 541          

HSP 6 Score: 75.0998 bits (183), Expect = 5.826e-14
Identity = 90/344 (26.16%), Postives = 149/344 (43.31%), Query Frame = 1
Query: 1411 ENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNK-DFKINTHEGTLISLR--SFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSIL--NPKN----DYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVII-------FPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVC--DSGNQPKCTVFHPLYVNLTSDYPI------NTHVLENT 2370
            E  P   I T    + D+D   N ++ Y + +   + +F I+  +G L   R    DRE ++  NLT+  +D G    +S   + + +LD+ DN  VF        +SE + +  +V  V+A D +E     ++L  +P +    +  F  D  +G++  N  LDRE+V  Y + +   D+  P   + ++ +  I +V I   DENDN PV          P  + N    ++   P      IY++D+D G N TL Y +    S   F I R  G V +  G   LD E      ++L +   D G +          +++  + P         HVLEN+
Sbjct: 1294 EGQPGPRIAT--FMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDN--PDNPSYARKDSDIMIVTIL--DENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGP------IYASDADFGVNATLAYSLLG-GSSAYFLIDRDRGNVSMALGQG-LDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENS 1623          

HSP 7 Score: 72.0182 bits (175), Expect = 5.639e-13
Identity = 123/531 (23.16%), Postives = 224/531 (42.18%), Query Frame = 1
Query:  340 TIHEIQIEVIDTNDNIP-YWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLY-IQNSLMLDSETTSKFTLHLYA---SNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPL-DYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTR--EQFQIYTTV-------IFDREQQDKHFVSIECTDQAYHMNY-INKTLLILXXXXXXXXXXXXSL--------NFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKIN-THEGTLISLRSFDREERSSLNLTVYVEDEGN-------------VKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILN 1809
            T   + + V+D NDN+P + +     V  ++   PG       A D D+     + + +         +  +D +  +     +D ET + +TL + A    NP +  S S +++V + D+ND  P F  P+  +   + E + + S V  + AT+   G N +++++I    I   A   F + + +G +   + L  Y+R    F    +  DH   P  L  +A + + V DVND  P   F    N  + N   + E  P    +  ++  D D  +N  V      SF     + +R  E F+I  T          DRE Q  + + +  +DQ   ++Y   + L ++ D+ +D       L        +F + E+ P GT +     + D D+  N+ V+Y++  A N+  K N +  G L+ L   DRE      + V      N              K  +   + + + D++D   VFT  ++   ++ ++ + + +  ++AVD D   N+IV Y IL+
Sbjct: 1935 TTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPL--SGSAIVRVLVDDVNDERPAFLAPV--QTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAG--IGKNA---FTVHATSGLVTSTRLLKSYER----FNLTAVATDHGRPP--LWGQAGLYVEVLDVNDHRPV--FVLPPNGTVVN---ITEVMPVVIRIVEVLAVDGDEGQNGAV----RYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFI-AAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRILS 2440          

HSP 8 Score: 69.707 bits (169), Expect = 3.173e-12
Identity = 77/283 (27.21%), Postives = 122/283 (43.11%), Query Frame = 1
Query:  229 LITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSIN-VEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSD------PTRFFKLVETADNLYIQNSLMLD-SETTSKFTLHLYASNPGID--RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMR-NFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP 1044
            + T   +DRE    Y    ++ DG   +   +L      + + + V D NDN P + + S   VE  +   PG   T+  A D D+    T+            P ++  +++    + I +    D  E TS+F L    +  G    RS++  + V ++D+NDN P+F  P       +    P  ++V  + ATD D+G NG+ +FRI+S   +  +I         G I V    + DR  R  +   V+  D    P  LS  A V + V DVNDE P
Sbjct: 1785 ITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAY-VYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAP-GTLVASVWATDADAGPNGQVTFRIESGGGDKLSI-----GPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPP--LSGSAIVRVLVDDVNDERP 2058          

HSP 9 Score: 63.1586 bits (152), Expect = 2.840e-10
Identity = 72/325 (22.15%), Postives = 139/325 (42.77%), Query Frame = 1
Query:   70 FKVDEGVQVGTEIADLTS----DFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASN---PGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVG 1023
             +V EG+   + +  +T+    +  N  +T    + L + DF++       D+    + TL  +DRE +  Y+   + +D     +        +   + + V+D NDN P ++     V  M+              D DS + + + + ++   +  +      +  ++  + LD ET + ++L + A +    G  R+ +  + V ++D+NDN PLF +   S    +PE++   +++L + ATD D G+NG   +RI S   +        + +V+  ++ R     DR          V  HA     L  EAF N +VG
Sbjct:  467 LQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQL-------DAATGLITTLVQLDREAVAAYQLRLVATDRGTPALS-------STTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEG--SYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGN-----FLVNVSSGLISRGATPLDRET--------VALHA-----LQVEAFNNDSVG 757          

HSP 10 Score: 56.9954 bits (136), Expect = 2.035e-8
Identity = 73/314 (23.25%), Postives = 125/314 (39.81%), Query Frame = 1
Query: 1435 LTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTL--ISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDY--------IFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIY------GMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNL 2328
            L   + + D D   N QV + +         I   +G +      + DRE R++  L V   D GN   S    + +++ D++D    F        + E+  + + V +V+A    EN   Y   N K  Y         F +   SG++T+   L  +  +R+ +  VA D   P            A + +++ D ND+ PV + P      +N +   P    I ++ + D D G+N  + Y      G+ + D    F+I+ TSG++   +    LD E  + + + L   D G         PL V L
Sbjct: 1972 LVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKAT---EN---YKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL--KSYERFNLTAVATDHGRPPLWGQ-------AGLYVEVLDVNDHRPVFVLPP-NGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWES-FRINATSGII---STARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVL 2265          

HSP 11 Score: 54.299 bits (129), Expect = 1.307e-7
Identity = 70/280 (25.00%), Postives = 120/280 (42.86%), Query Frame = 1
Query: 1411 ENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFK------INTHEG-TLISLRSFDREERSS--LNLTVYVEDEGNVKRSSKGFIHIVILDMDDN-PIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYIFLIDKFSGVL--TTNSYLDREKVDRYFIKVVAFD-SNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLV 2202
            E+   GT+LT  L + D+D  +N  V    H  +           I    G T++ +   D  E++S  +   +   D G+  RS+   + +++LD++DN PI  +   +   + E     T+V SV A D D      + + I +   D +  I    G++     + +DRE    Y + VVA D  N P+  +        A+V + +DD ND  P  + P  T + L +         +  + +T++  G N    Y +     +  F +H TSGLV
Sbjct: 1851 ESAAPGTLLT-VLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLS-IGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGS--------AIVRVLVDDVNDERPAFLAPVQTVSVLES---LSVGSFVATVKATENYKGHNTKYTYKIAGIGKNA-FTVHATSGLV 2116          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 177.178 bits (448), Expect = 2.661e-45
Identity = 202/724 (27.90%), Postives = 337/724 (46.55%), Query Frame = 1
Query:  190 SHFGIKFDSGILRLITLKNIDREVICEY----EKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIP--TAIDLDSSVFSTIFYNLS--DPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSL-LIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVF---CRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNF--YLYENMPSGT-ILTGKLRSFDKDIDNNSQVHYYLHEASN-KDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE-NTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDS-NIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCT 2301
            S F I   SG++ +   K +DRE    Y       +  S G  +            +   I V+D NDN P +N  S   + +  +LP I +T+   TA D D    + + Y LS  D ++F   V  A  L +     LD E  + ++L + A + G    S++  I +TI D+NDN P FS+  ++    + E+    S +L + A+D D+G NG  ++ I S    N     F + S TG I V   +D +  + ++   +  +D    P+   S AFV +TV D ND  P    +A  +N+ S  + + E     + V  +   D D   N +VF    R   S F +N+M       +      +RE    + ++I  +D+   M   +K L ++ ++ ND     +S ++   + EN    T +LT  + + D D+  N+ + Y +   ++ K FKIN+  G +++    D EE+S   L V   D    K ++K  + I +++++D    FT+  +   + ENS  +T V  V A D D   ++ YSI+  K+   F ID+ SG+++T   LDRE V  Y I+V   D+ N P+         ++  V IKI DENDN      P F  +  ++S+ +   P    F++ +TD+D G N  + Y +   D+   F I  +SG++ L      LD E  ST+ + ++  D G  P+ +
Sbjct: 1040 SSFKIDQSSGLISV--AKRLDRETTANYTLVVRATETGSQGESV-----------YNNATIRVLDVNDNAPVFNPGSY-AKSLHENLP-IGQTVAKVTATDRDEGENAKVTYELSVGDTSKF--EVNPATGL-VTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLT--VTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNA----FRIDSTTGRITVVGVVDRE-ALASYNLTISAKDSGVPPW--VSTAFVAITVADENDNSP---IFA--SNETS--YGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAM----NGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLT--VAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPL--------SNLTWVTIKILDENDN-----SPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA---FMIGASSGVITLA---QPLDRENKSTYDLAIQARDHGTPPQAS 1701          

HSP 2 Score: 173.711 bits (439), Expect = 3.223e-44
Identity = 215/776 (27.71%), Postives = 345/776 (44.46%), Query Frame = 1
Query:   58 SMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASN---PGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVG----FIMTNDVDFNENDEVFCRSLN-----SFFV-LNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI-LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRS-FDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNL 2328
            S+ K  V E V VG+ +  LT+   ++GI       L   D   S+F +    G++R  T    DRE    Y+      DG          G  T+   +IE++D NDN P ++S        +    G      TA D D+   + + Y+ +           A    +  S  LD E  S + L L  ++   P +  +S LLI V   DINDNPP+FS   +     + E+ P  + V   SATDRDS  NG   F I   K N+  +  F +   TG I + K  DY+   R +   V   D   +P    + A V + + DVND  P    ++  N   S Q       P++T++G     +   D+D      +  R ++     +F +  NS S R   ++      DRE    + + +E  D        +  + I L D +++   F     F + E+   G  + G++ + D D  +N  V Y L +  N D F INT  G LI+L++  D E+++   +TV  +D G   RSS   + +++ D++DNP  F K  +   + EN      V  V A D D      I YSIL+   +  F +D+F+G +TT   LDRE +  Y + + A D ++    A +  N SIA       DENDN P    P    +R N S   P    + Q+ +TD D G N  + Y + + +    F++   SG++ ++   S LD E   ++ + +K  D+G+ P+ ++   ++V++
Sbjct:  171 SVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD--TSYFTVD-SQGVIR--TKGAFDRETKASYQVALRAQDGGSPS----RSGQATV---EIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVN--DINDNPPVFSPSAYQSR--VKENTPAGTQV---SATDRDSSTNGALVFGI--IKGNDDGV--FTIDGSTGIISIAKSPDYENKTR-YDLTVQARDRG-VPVKYDT-AQVTIFIEDVNDHSP---VFSPSN--YSKQI------PESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSEL------DRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQI-GQVAATDADDSSNGDVRYALSD--NTDVFSINTSTG-LITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIA-------DENDNQPTFTGP----SRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVR---STLDRETIPSYTLVVKASDAGS-PQQSITASIHVSV 884          

HSP 3 Score: 164.081 bits (414), Expect = 3.118e-41
Identity = 177/664 (26.66%), Postives = 300/664 (45.18%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQI-------YTTVIFDREQQDKHFVSIECTDQAYHMNYINKTL--LILXXXXXXXXXXXXSLNFYLYENMP-SGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTV 2304
            + I + D NDN P +    +     +   PG +     A D D S    + Y LSD T  F  + T+  L I     LD E  +++ + + A + G   RSS  +++V + D+NDNPP F+K L++    + E++     V  ++ATD DSG NG+ S+ I S   N      F M   TGEI  R PLD +  + ++   +  +D + + +  ++   VN+++ D ND  P             ++F + E++P  T VG +   D D   N  V        + + S +    FQ+             DRE    + + ++ +D       I  ++   +LD NDN P F     +  + E+     T+L  K+   DKD  +N  +   L    + +F I++  G ++S    D E  ++  LTV   D G+  +S+   + I I++++DN   F     V  I E+  INT V  + A D D   + + I+       F ID+ SG+++    LDRE    Y + V A ++    E     NN +I ++++     NDN PV     F       SL +  P  +++ ++ +TD D GEN  + Y +   D+ K F+++  +GLV  K     LD E  +++ +++   D G   +  V
Sbjct:  569 VTIALQDINDNSPIFQGPYV-FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFS-INTSTGL-ITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCT--VGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMA----FAMDRFTGEITTRVPLDRET-IASYSLTINADDGSLVRFMAATT--VNISIADENDNQPTFTG--------PSRFNISEDSPTGTRVGQLTATDRDIGPNGAVT-------YAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVE--DKDEGSNGAITLSLSGEGSDNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVY--NNATIRVLDV-----NDNAPV-----FNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK-FEVNPATGLVTTK---RPLDREDQASYSLRVTAMDHGKPSQSAV 1186          

HSP 4 Score: 163.31 bits (412), Expect = 6.265e-41
Identity = 179/690 (25.94%), Postives = 320/690 (46.38%), Query Frame = 1
Query:  328 GGSLT---IHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSD----PTRF----------FKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTI--VDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRI---DSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV----FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLY---ENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIV-YSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDS-GENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
            GGS +     +++I +I+ NDN+P + S            P    +IP  + +++ V   +  N +D    P  F          FK+ +++    I  +  LD ETT+ +TL + A+  G  +  S+    TI  +D+NDN P+F+   ++++  + E++PI   V  ++ATDRD G N + ++ +   D++K        F +   TG +  ++PLD +    ++  +V   DH     S S+ A + LT+ D+ND  PQ        ++      V ENT   + +  ++ +D D   N  V       +  + F ++S + R    I    + DRE    + ++I   D      +++   + +   D +      + N   Y   E +  G+ +   + + D+D  +N+QV Y +       F IN   G L   +  +RE   +  LT+   D G+   +S   + +V+ D++DNP VF    ++  + ENS  +T V +V A D D   N ++ YSI++  ++  F I+  SGV+ T + LD E+  +Y ++V A DS     +  +K N +I ++ +     ND     I P FT     AS+ +  P   S+ ++ ++D DS G     I G ++ D    F I + SG++        LD E  S + I+++V D+GN P
Sbjct:  972 GGSPSKSATAQVKITIINVNDNVPSFVS------------PAQVTSIPEDVAINTHV---VKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSG--LISVAKRLDRETTANYTLVVRATETG-SQGESVYNNATIRVLDVNDNAPVFNPGSYAKS--LHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK--------FEVNPATGLVTTKRPLDRED-QASYSLRVTAMDHG--KPSQSAVAAITLTINDLNDNSPQF-------SQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGR----ITVVGVVDREALASYNLTISAKDSGVPP-WVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRV-AVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS-----KYTAKTNVTIRVINL-----ND-----ITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDK---FSIDQRSGIISTA---DVLDRELVSLYAIQVRVTDAGNPP 1596          

HSP 5 Score: 142.124 bits (357), Expect = 2.164e-34
Identity = 186/774 (24.03%), Postives = 329/774 (42.51%), Query Frame = 1
Query:   82 EGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEND----EVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP----------------KCTVFHPLYVNLT 2331
            E + +G  +A +T+  ++ G   +    L+  D   S F +   +G++   T + +DRE    Y       D  K     +   +LTI+++       NDN P ++     +   +    G       A D D+     + Y++   +    F++  T   + +    ++D E  + + L + A + G+    S+  + +T+ D NDN P+F+    S    I E + I S V V++ATDRD G N +  + I     +      F + ++ G + V+K ++ +  +  +   +   D    P  ++S+  + + V DVND  P         N  S   +V EN+ ++T V  +  +D D   N      +   +    F +NS S      I TT   D E++ ++ + +  TD  Y     N T+ +++ ND  P F   +    + EN P+ T +  K+ + D+D  +   + Y +    + D F I+   G + +    DRE  S   + V V D GN   S+  ++ I ILD +DN   F    +   I ENS  ++    + A D DE T      N   +  F+I   SGV+T    LDRE    Y + + A D   P +        S   + + + D ND+ P+I   N +  R +    QP E  + +I ++D+D+G N  L + + + +   +F +  T+G +  K     LD E  + + +++ V D GN                   C  F P   N+T
Sbjct: 1110 ENLPIGQTVAKVTATDRDEGENAKVTYELSVGD--TSKFEVNPATGLV--TTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDL-------NDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVG--VVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYG--IDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS-----AFAINAMNGVLTVKKEINRET-VPTYTLTIRASDRGS-PM-MTSDKELTVVVNDVNDNPPVF-------NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTS----GVIMTTTPLDFEEKSQYGLEVTATDSKYTAK-TNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVV-KVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQ-------ASSITIRVTVIDINDHRPLI---NSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKV---PLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVT 1832          

HSP 6 Score: 141.739 bits (356), Expect = 3.599e-34
Identity = 173/662 (26.13%), Postives = 291/662 (43.96%), Query Frame = 1
Query:  349 EIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLL-IQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV----FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI-LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPE-----KSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQ 2289
            ++ I + D ND+ P ++  + + +  +  + G      TA DLDS     + Y L            A++  I+ S  LD ETT  ++L + A + G    SS   + + + DINDN P+F  P   R   + E       +  ++ATD D   NG+  + +  N       + F + + TG I ++  LDY++  + +   V  +D    P S SS   V + V DVND  PQ         K      V EN      V ++   D D   N ++       + N  F ++    R   +I T V  DRE    + ++I   D +        T+ I + D +++   F     F + E+ P+GT + G+L + D+DI  N  V Y +   +  + F+++   G L    + DRE   S  L V   D G+ ++S    IH+ +LD++DN   F K  F   I E++ +++ V  V+  D DE +   I  S+    +D  F ID  +G + + + LD E    Y + V A D   P + A        A V+I I + NDN P  + P        A +   PE       + ++ +TDSD      L + +   ++   FKI ++SGL+ +      LD E  + + + ++  ++G+Q
Sbjct:  463 QVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFR---VSESSSPGHQIGQVAATDADDSSNGDVRYALSDN------TDVFSINTSTGLITLKTQLDYEKKTQ-YMVTVTAKDGG-TP-SRSSLTVVKVMVDDVNDNPPQF-------AKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMD----RFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRV-GQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN-FTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSAT-------AQVKITIINVNDNVPSFVSP--------AQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVA---KRLDRETTANYTLVVRATETGSQ 1077          

HSP 7 Score: 134.42 bits (337), Expect = 6.457e-32
Identity = 162/583 (27.79%), Postives = 262/583 (44.94%), Query Frame = 1
Query:  586 DSETTSKFTLHLYASNPGIDR--SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDH---AFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV---FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKT--LLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEA-SNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIF-----QIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCD 2277
            D E+ S++ L + A +   +R      ++ + + D NDN P F  PL S    I E+ P   V +V +ATDRDSG N   ++ + S +  NK    F+M S TGEI    PLD++    ++  ++   D     F+P          +TV DVND  P   F+A+   K      V E+    ++V  +   D+D   N  +         S+F ++S     Q  I T   FDRE +  + V++   D          T  + ILD NDN P F        + E++  G  +   + + DKD  NN+ + Y      +N  F ++   G +   RS D E+RSS  L + V D G+   +    + I + D++DNP VF+   +   + EN+   T    V A D D +T   +V+ I+   +D +F ID  +G+++     D E   RY + V A D  +P++          A V I I+D ND+ PV    N++         Q PE ++       + +TD DSG    L Y + + +    F I   SG + +   +S LD E   ++ ++++  D
Sbjct:   29 DRESESRYRLTVLAQD-AANRCHKGRTVVVIDVKDENDNAPEF--PLNSYVFNIRENTPAAQVAIV-TATDRDSGTNAAITYSLFSGE--NK----FMMNSKTGEIRTVTPLDHET-KDSYTMRISAFDGKHTTFVPL---------ITVDDVNDNAP---FFALSVYKT----GVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDS-----QGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMV-TVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVK-------YDTAQVTIFIEDVNDHSPVFSPSNYSK--------QIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRV---SSELDRETTPSYSLQVEARD 557          

HSP 8 Score: 90.1225 bits (222), Expect = 2.928e-18
Identity = 141/579 (24.35%), Postives = 260/579 (44.91%), Query Frame = 1
Query:   70 FKVDEGVQVGTEIADLTSDFKNLGITTE-FVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVI--DTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV-FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAY--HMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD 1779
            + +DEGV +G+ +A +T+  ++ G   + F S++       S F I   +G+L +   K I+RE +  Y      SD          G  +   + ++ V+  D NDN P +NS S      +            A D D    + + Y++   +  + FK+  T+    I  +  LD E  S++ L + A++      +++ I+V  +++ND  P F++  ++ +  + E+ P ++ V+ +SA+DRDS   G  S+ I   K ++K    F +   +G I     LD +  +  +  +V V D    P  LS+  +V + + D ND  P+ D         S   ++LEN+  ++    +   D D   N  + +  S N  F++ + S      I      DRE +  + ++I+  D       + I   + ++D ND+ P     SL   + EN P  T +  ++ + D D   N+++ + L    +K  F ++   G + +    DRE+++   L + V D+GN   SS   + I ++D DDN   F   ++   ISE+      +  V A D+D
Sbjct: 1315 YGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRG---DTSAFAINAMNGVLTV--KKEINRETVPTYTLTIRASD---------RGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSG--VIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRV--INLNDITPAFTQQNYTAS--VRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDK----FSIDQRSGIISTADVLDREL-VSLYAIQVRVTDAGNPP--LSNLTWVTIKILDENDNSPKFD-------SSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASS----GVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVM-RILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 9 Score: 69.3218 bits (168), Expect = 6.168e-12
Identity = 70/266 (26.32%), Postives = 121/266 (45.49%), Query Frame = 1
Query: 1522 FKINTHEGTLISL-RSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFP---VIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKC 2298
            F I++  G++ +  R FDRE  S   LTV  +D  N     +  + I + D +DN   F  + +VF+I EN+     V  V A D D  T   I YS+ + +N   F+++  +G + T + LD E  D Y +++ AFD          K+   + L  I +DD NDN P   + ++    +  +           + Q+ + D D G N  L Y + + D+   F +  + G++  K      D E  +++ + L+  D G+  + 
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPA-AQVAIVTATDRDSGTNAAITYSLFSGENK--FMMNSKTGEIRTVTPLDHETKDSYTMRISAFD---------GKHTTFVPL--ITVDDVNDNAPFFALSVYKTGVYEDVAVGSI------VRQLTAVDLDVGINARLSYSLVSGDT-SYFTVD-SQGVIRTKGA---FDRETKASYQVALRAQDGGSPSRS 252          

HSP 10 Score: 56.225 bits (134), Expect = 7.011e-8
Identity = 53/182 (29.12%), Postives = 85/182 (46.70%), Query Frame = 1
Query: 1795 YSILNPKNDYIFLIDKFSG-VLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLF----QPPEKSIFQIYSTDSDSGENQTLIYGM---ENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPL 2316
            YSI++  +  +F ID  +G + TT    DRE   RY + V+A       ++A ++ +K   +V I + DENDN P   FP      LN+ +F      P   +  + +TD DSG N  + Y +   EN+     F ++  +G +   T    LD E   ++ +++   D     K T F PL
Sbjct:    1 YSIMDGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLA-------QDAANRCHKGRTVVVIDVKDENDNAPE--FP------LNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENK-----FMMNSKTGEIRTVT---PLDHETKDSYTMRISAFDG----KHTTFVPL 155          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 170.629 bits (431), Expect = 3.241e-43
Identity = 203/722 (28.12%), Postives = 329/722 (45.57%), Query Frame = 1
Query:  178 DFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVI--DTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLD---SSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLL--IQVTIVDINDNPPLF-SKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQI-------YTTVIFDREQQDKHFVSIECTDQAYHMN---YINKTLLILXXXXXXXXXXXXSLNF-YLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCD 2277
            D +V+ F +   +G  ++ T + +DRE    Y  + + +DG         G S  + + Q+ VI  D ND  P ++ +  +V  ++ DLP +  ++ T I  D       S I Y +    + F L +    L + + L  D E T +  LH+ AS+ G ++S   +  I++ ++D+NDN P+F ++  F   + +PE +PI SVV  + A D D G NG+  ++I    +N      F +   TG I   + LD++   R +  +V   D        S +  V + V D ND  P  D    +N  I+    + EN P NT V  I  +D D   N  ++       + ++S S R  F+I        TT   DRE+  ++ + +  TDQA+      Y   TL I+  + ND      S N  Y+ E+ P    +T  + + D D      V Y +       F ++   G L  + S D E+     L +   D G+   +S    ++V++D++DNP  FT+D F+  +SEN    T V  V A D D  +   + YSI +      F IDK SG++ TNS LDREK D YF+ V A   + P   + +        V I + D NDN P  I P  T      S    P + I+ +   D D G N  ++Y + + ++   F I R++G +   T    LD E  +++ + ++  D
Sbjct: 1056 DTQVAQFIVDKQTG--KITTSQVLDREAKASYVFSIVATDG---------GSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVT-VNEDLP-VGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPL--DREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTF---KTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKI----VNGNTDGTFKINETTGVISTLRALDFEVTNR-YVLRVSATDMGKKQQKTSYQ-LVTIYVEDANDNRPTFD----KNPIIT---WIYENVPINTNVTTIKAHDDDSGLNSRIW-------YTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVT-SITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTS-------VRINVMDRNDNPPKFISPVVTLKVPENS----PARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTT---KLDRETKASYQLSVQAKD 1724          

HSP 2 Score: 132.109 bits (331), Expect = 3.258e-31
Identity = 176/683 (25.77%), Postives = 318/683 (46.56%), Query Frame = 1
Query:  307 IDIQIILGGSL---TIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLS---DPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTP-KNTLVGFIMTNDVDFNENDEV--FCRSLNSFFVLNSMSTREQFQIYTTV-IFDREQQDKHFVSIECTDQAYHMNYINKTLL---ILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEA-SNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEG-NVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNK--SIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP 2292
            + +Q   GGS    +   ++++V+D ND  P + + S     ++   P        A D+DS     I Y      D ++F   +     ++I++ L  D E   ++ L + A + G  R SSS  ++V + D+NDN P F +  ++    + E+ P+ + +  +SA+D D G NG  ++R D+       +  FI+   TG+I   + LD +    ++ F ++  D    P    ++  V + V DVND  P+        NK S    V E+ P  ++L+  I T+D     N ++     +    F LN ++      + T V   DRE   +H + +  +D+  + +    T +   +LD NDN P F  ++    + E +P G+++   L + D D  +N +V Y +    ++  FKIN   G + +LR+ D E  +   L V   D G   +++S   + I + D +DN   F K+  +  I EN  INT V +++A D D    + I Y+I +      F I+  +G++ T   +DRE++  Y +KV A D      +A ++ ++  + A ++I I D NDN P  +  N T+   +    +P    +  I + D D+G+   + Y + + D+ K F +   +G++ L     +LD E    + + +   D G+ P
Sbjct:  880 LPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFG--LRNGGKIFIKSKL--DREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFF--VKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQ------VAQFIVDKQTGKITTSQVLDRE-AKASYVFSIVATDGGSSPRVDKTQ--VTVIVRDVNDCSPK-----FSKNKYS--VTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVT-----GVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVL-AVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATD------QAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMED----EPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK-FSLDLKTGVLKLI---GSLDYEDVPQYTLHISATDLGSPP 1520          

HSP 3 Score: 129.413 bits (324), Expect = 2.260e-30
Identity = 173/705 (24.54%), Postives = 295/705 (41.84%), Query Frame = 1
Query:  241 KNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLY-------IQNSLMLDSETTSKFTLHLYA-SNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMST-----REQFQIYTTVIFDREQQDKHF-VSIECTDQAYHMNYINKTL--LILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRS-FDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSD-SGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGN 2286
            + +D EV   Y      +DG         GG      + + + D NDN P ++  S +VE+ +    G       AID DS  F+         TRF      AD ++       I  + +LD ET   + L + A    G D  +  ++ +T++D+ND PP+FSK  +  N  I E     SV+  + A  RD G N E  + I     +N      ++ + TG + ++  +D+++ + + +  V  +D    P  L   A V + V D+ND  PQ            N  ++L   P++T +G        F+ +  V  R   SF +L++  T          +  T + D     + + + ++  D           L   ++D ND  P F   S   ++ E  P  + +  ++ + D D   N ++ Y      +   K     G  I ++S  DRE+    NL V   D G  +RSS   + +++ D++DN   F +  + F + EN  + T +G+V A D DE +   + Y          F++DK +G +TT+  LDRE    Y   +VA D         S        V + + D ND       P F+ N+ + ++ +  P   S+  + +TD D  G N  + Y +      K F +++ +G++ L    S LD E    H++ +   D G 
Sbjct:  557 RTLDHEVQSSYTFQVAATDG---------GGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAI--------TRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEY--NFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDN-----IVLINSTGTLYLQSEVDHEK-IPSLYLTVQAKDKGTPP--LFGYANVTIAVIDINDNSPQF-----------NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRV--SFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNII-EVVATDVDSGENGRISYAFDSKVDTS-KFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ--FIVDKQTGKITTSQVLDREAKASYVFSIVATDGG-------SSPRVDKTQVTVIVRDVND-----CSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVA--GPKAFSLNQVTGVLTLV---SPLDREVTHRHILHVVASDKGG 1200          

HSP 4 Score: 128.642 bits (322), Expect = 4.259e-30
Identity = 201/805 (24.97%), Postives = 341/805 (42.36%), Query Frame = 1
Query:   76 VDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHE---IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRK--TIPTAI------DLDSSVFSTIFYNLSDPTRFF--KLVETADNLYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSL--NSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISL-RSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKT----GNSNLDVEYFSTHVIKLKVCDSGNQPK-CTVFHPLYVNLTSDY-PI------NTHVLENTKKEKKI 2388
            + E + VGT I  +++  K++G   E    +       + FGI   +G+        I   V  +YE  +      K + +   G S  +     ++IEV+D NDN P      I+V +  G    + +  TI T +      D DS     +   L     +F  K     D   I     LD ET   F L     + G   R++    ++ + D+ND  P F +  +     + E+  +N++V +++A D+D G N E  + I +   +   + +F +   +G I     LD ++ +      V+V D    P S +    VNLT  D ND  P         N+ S   ++ EN+P  + V  ++  D D  EN  +    L  N+ F L+      +  +  +   D E Q  +   +  TD           + + D NDN P F P S +   +EN   G  +  +L++ D+D      +  ++ E  N D   +     LI+L +  DRE + +  LTV   D G     +K  ++I +LD++D P +F+K ++ F I E+S   +V+G V A+  D+ T   +VYSI     D I LI+  +G L   S +D EK+   ++ V A D   P        N +IA+++I     NDN      P F  + +   L +  P   + + +   D+DSG    + + + + +   +F +   +G + L      GNS        ++ + ++  D G+ P+  T    L V   +DY P+        HVLE T  +  I
Sbjct:  181 IPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGV--------IVNNVRLDYEAKRSYLIVVKAEDK---GSSHQLSSSAIVRIEVLDVNDNNPV-----IHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETR--VWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQ-IPQVVLTVLVHDRGSPPLSDNCSVIVNLT--DSNDNDPYF-------NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDP----RKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSIC-QLKAIDRD-SPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINS-TGTLYLQSEVDHEKIPSLYLTVQAKDKGTP--PLFGYANVTIAVIDI-----NDN-----SPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLS-NPGTLFNLDSNTGALSLTKLIDYGNS------ARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNI 931          

HSP 5 Score: 119.398 bits (298), Expect = 3.105e-27
Identity = 183/763 (23.98%), Postives = 323/763 (42.33%), Query Frame = 1
Query:   70 FKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILR----LITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTR------FFKLVETADNLYIQNSLMLDSETTSKFTL----HLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQID--FYAIQ---NNKISNQF----AVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLL---ILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSIL-NPKNDYIFLIDKFSGVLTTNSYLDREKVDR-YFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKL 2265
            ++V E   +GT++A ++    + G   E    L   D    +F +KFD  +L     +   +++DRE    +    +  D  K D         T    +I V D ND  P ++  +      +         I  A+D D    S + Y +++ T       +F +  ++    I  +  LD E   +  L    H   S P  D  S   + V + D NDN P F++   S N  + E+ P  S V+ L A D D G N    + I +          F +    G +   + LD++    ++ F+V   D        S  A V++++ D+ND  P  D   Y+++   N +I        A+  ++PK  +  FI    ++    DEVF    +    L  +              DRE QD + ++++  D     + +NK ++   +LD ND  P F     NF + E+  + +++ G + +  +D   N++V Y + + +  +  +    GTL      D E+  SL LTV  +D+G         + I ++D++DN   F     +  + E++ I     +V   D D      + +S+L NP    +F +D  +G L+    +D     R Y + V A D   P          S A++E+K+ D ND  PV    ++T + L  +   PP+ +I ++ +TD DSGEN  + Y  +++     F + R  G +F+K+     D+E ++  VI +
Sbjct:  289 YQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGD---GYFSMKFD--VLNDESIIAVGQSLDRETHDHFFLKAVCID--KGDPP-----RTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSG--MITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCS---VIVNLTDSNDNDPYFNQS--SYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP------FFLDPRKGLVTNSRTLDHEV-QSSYTFQVAATDGG----GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFI----IEQGNADEVFSVDGSGLITLAKL-------------LDRETQDNYLLTVKAVDGG-GQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVI-GHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGT--LFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRS-------STAMLELKVVDVNDYSPVFGNWSYTAHVLETT---PPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL-RNGGKIFIKSKLDREDIEEYNLKVIAI 989          

HSP 6 Score: 114.005 bits (284), Expect = 1.281e-25
Identity = 152/630 (24.13%), Postives = 276/630 (43.81%), Query Frame = 1
Query:  463 TAIDLDSSVFSTIFYNLSDPTRFFKL-VETADNLYIQNSLMLDSETTSKFTLHLYASNPGID---RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP--QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDRE-QQDKHFVSIECTDQAY--HMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDID--NNSQVHYYLHEASNKD--FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVF-TKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSY--LDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRL-NASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCT 2301
            TA D DS   + + Y++       K  ++    L + NS+ LD E    + L ++A+  G+    R SS  +++ ++D NDNPP F  P+ +    +PE+ P   ++  L+  D D G N +  + I S   +      F +   TGE+     LD +       +++ V+     P   ++ A + + + D ND  P  Q   Y+           + E TP  T +  +  +D D   N  +     N  + + S+ +R    +Y+   F+   +Q+ +F  I   DQ     M  +   + I D N++ P F       +++ N  +  ++T  + + D D D   N +V Y L ++ N    F + ++ G++ +   F    +    L +  ED G+      G + IVI ++ D+P  F  +      I ENS + + + +V+A    +  + YSI++      F +D F+GV++  S   LD E    + + +VA       +  +S N   I  ++I + D NDN P     N       +   F+P  + + ++ +TD DSG N  + Y +   +   +F I  T+G +   T    LD E  ++  + ++  DSG  PK T
Sbjct: 1564 TAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSI-LDREKKDTYFLTVHAT--GVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLK--VPENSPAR-LIYTLTVQDLDYGNNTKVLYSIMSGNTDGA----FTIGRSTGELSTTTKLDRETKAS---YQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYS---------STISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGI-VYSAARFETSIKQEYNFFCI-AKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVT-MVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATP-----QGWVSLNGYMI--LDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKP--RFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEI---TTAKLLDRETTASFDLVIRGTDSGIPPKST 2156          

HSP 7 Score: 113.235 bits (282), Expect = 2.347e-25
Identity = 184/748 (24.60%), Postives = 336/748 (44.92%), Query Frame = 1
Query:   82 EGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLP-GIRKTIPTAIDLDSSVFSTIFYNLSDP-TRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSL-LIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVF----CRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTD--QAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN-----TIVYSILNPKNDY-IFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTD--SDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVC 2274
            E V + T +  + +   + G+ +     ++ +  + +HF I  ++G+++  T   IDRE I EY   K+ +       Q  L  + T+   +I + D NDN P + S   N+ ++  D P   + T  TA+D D+     + Y +  P T  F L      L +  SL  D E   ++TLH+ A++ G    +S  L  V +VD+NDNPP F++ LF     + E+ P  + V+ ++A DRDSG N E ++ I S       ++ F +   +G IV    LD  R  ++ +F  +       P+ +SS + V + V D ND  P+     +          V EN+P   L+  +   D+D+  N +V       + +  F +     R   ++ TT   DRE +  + +S++  D    Y+  + N T+ I D NDN P F     +  + E  P GT +   L + DKD  +N  + Y L   +   + I++  G + S   F+   +   N     +D+G   + +   + I I D +++   FTK  +  HI  N+  + +V  V A D D +      + Y + + KN   +F+++  +G + T++        R+ + ++A D   P         +   +V+I I +  D+ P   F N T  R++      PE S    Y T   + +  +  + Y + + +  + F +   +G++ + + ++   ++Y ST   +L + 
Sbjct: 1341 ENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPR-AHFKINSETGLIQ--TTHPIDREEISEYSL-KVRATDQAFTEQDRLYNTATL---KIIIQDLNDNAPKFVSR--NLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSL--DYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGT--VSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGV----EMDKFSIDKHSGLIVTNSILD--REKKDTYFLTVHATGVSYPFRVSSTS-VRINVMDRNDNPPKFISPVVT-------LKVPENSPAR-LIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIG----RSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSIL-NLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPL-------RGYGIVQIVIGNIQDDPPR--FLNQTPARVSI-----PENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADA---LDYESTKNFRLHLV 2038          

HSP 8 Score: 95.5153 bits (236), Expect = 7.217e-20
Identity = 144/632 (22.78%), Postives = 256/632 (40.51%), Query Frame = 1
Query:  565 IQNSLMLDSETTSKFTLHL--YASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGE-----IVVRKPLDYDR-GMRNFFFKVIVED------HAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTT-------VIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYL---YENMPSGTILT--GKLRSFDKDIDNNSQVHYYLHEAS---NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKND----YIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPI 2346
            I    +LD E  S + L +  +++ P      S  + V + D+NDN P F +   ++      D      ++   A D D G N   S+ I S  + N   +    +   G+     +V    +  DR  + ++   +   D      H FL  S        +TV D ND  P+        + +S    + EN    T +  +  +D D   N E+       + +      +  F I+ T       V  D E +  + + ++  D+       +  ++ ++  D +       +++ L   Y+   + TI T   ++   D D   N +V+  L       +  F +   E  +   +S DRE      L     D+G+  R+++    I + D++D    F +  +   + EN+ +NT+V  V AVD D    + +VY+I N        + F ID  SG++TT + LDRE++ +  + V+  D   P    +S N   I    + + D NDN P      F  +  NASLF+  P    + Q+ + D D GEN  ++Y +   ++   F +    GLV   T +  LD E  S++  ++   D G +      H    +L  + P+
Sbjct:   14 ITTKTVLDREKVSAYNLTIVEFSTPP-----KSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI---AVDSDFGSNSTQSYTIVSGNVGN-VFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLS--------ITVEDTNDNKPEF-------SNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEI------QYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSP---PLSDNCSVI----VNLTDSNDNDPY-----FNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP--FFLDPRKGLV---TNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPV 598          

HSP 9 Score: 94.3597 bits (233), Expect = 1.319e-19
Identity = 176/799 (22.03%), Postives = 317/799 (39.67%), Query Frame = 1
Query:   55 KSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDS--SVFSTIFYNLSDPTRFFKL-VETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSL----LIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKP--LDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV----FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLN-FYLYENMPSGTILTG---------------------------KLRSFDKDIDNNSQVHYY--LHEASNKDFKINTHEGTLISLRSFDREERSS-LNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVD----LDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCT 2301
            +S+    + E    GT I +LT+  K+ G     V  L+   + V  + I   +GI+   +    +  +  EY    I  D  +          + I  ++I++ D N++ P +      V            T+ TA D D+  S    + Y L D      L V  ++   ++ S    +    +  L++ A + G   S  L    ++Q+ I +I D+PP F     +R   IPE+  + S +  + A    +  + + ++ I S    NK   +++    TG I V     LDY+   +NF   ++     ++  SL+    +++ V D ND  P     A   + +  Q A      K   V  +   DVD   N +V    +  +    F ++S +     +I T  + DRE      + I  TD        N  + ++  + ND     D L+   + E+  +G ++T                            ++ + D+D  +N+Q+ Y   +  +   D+KI+   G + + R+ D   R S + + V   D+G   + +  ++ I+I         F    +   + EN+++ T V +V+  D    L    I Y+I   +N   F I + SGV++ N  LD E   R+ + V A D   P +            V I + D ND  PV     F  +   A   +  P    +  + + D DSG N  + + +++ D    F I R +G++  +     LD E   TH + ++  D G+ P  T
Sbjct: 1752 QSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGV--YSIDSRTGIV--YSAARFETSIKQEYNFFCIAKDQGQ-------DPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHG---SPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVS-IPENSKVGSYITTVRAR---ASSDAQVTYSIISG---NKGRAFYV-DPFTGVISVASADALDYES-TKNFRLHLVATPQGWV--SLNGYMILDINVIDRNDNSP-----AFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTG----EITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPK----FELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNI---ENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVR-------VPVYINVSDVNDEKPV-----FGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRA---LDHETIKTHHVSVRATDEGSPPMHT 2494          

HSP 10 Score: 82.4185 bits (202), Expect = 6.906e-16
Identity = 77/275 (28.00%), Postives = 133/275 (48.36%), Query Frame = 1
Query: 1411 ENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNK-DFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVF-TKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDRE--KVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSI----FQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLV 2202
            E +P GTI+   + + DKD   N +V + +    +K  F I+   G + + R+ D E   + +++V   DEG+    +   + I +LD++DNP VF         + EN  +N+ +  + A D D      + ++++      +FLIDKFSG LTTN   D E   V +Y + + A D+  P    +S N     +V +  +DE D       P+F  NR++     P    I     Q+ +TD DSG+   + +   N  S+ + K++ T+G++
Sbjct: 2418 EGIPVGTIVV-NVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNP---PLSSN--ITIIVNVADEDEYD-------PSF--NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNAL-KMNATTGII 2676          

HSP 11 Score: 80.4925 bits (197), Expect = 2.704e-15
Identity = 160/710 (22.54%), Postives = 299/710 (42.11%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLL-IQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDS--GLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVG-FIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQF-QIYTTVI-------FDREQQDKHFVSIECTDQAY-HMN-YINKTLLILXXXXXXXXXXXXSLNFYLYENMPS-GTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT-------------------------------IVYSILNPKNDYI-FLIDKFSGVLTTNSYLDREKVDRYF-IKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLI-YGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLT 2331
            I I + D NDN P +     +    +   PG      TA D DS     I Y LS+ T     +++   + + ++   ++    ++     A + G D   +++ +++ I D N++ P F+K  +  +  I  +   +++V +++ATD D+    NG+ ++R+D +K    +   F+++S TG +            R+  + +I EDH   P  L     V + +G++ D+ P          +  NQ     + P+N+ VG +I T     + + +V      ++ +++    R  +   +T VI        D E      + +  T Q +  +N Y+   + ++D NDN P F P ++   L E+  +       K+ + D D   N +V Y +   +    F I++  G + + +  DRE  +S +L +   D G   +S+   + +V+ D++DNP +F     V +I E++    VV SV A D D+ +                               I YS     +D I + ID  +GV++    +D    D +  I V A D  +P + A+         V I I  E    P    P++       ++      S+  +  TD+ +G     I Y +EN +    F+I + SG++ +   N  LD E     ++ +   D    P   V  P+Y+N++
Sbjct: 1736 ITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGI-VYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVH--IFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSK---NSTSLFVVESNTGSVRTSAGFSNPPQGRHALY-IIAEDHGSPP--LRGYGIVQIVIGNIQDDPP----------RFLNQTPARVSIPENSKVGSYITTVRARASSDAQV------TYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEV-NIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRAL-------VYVRIIITRE----PKFELPSYFGKVPENAMMG---TSVLTVRVTDNAAGLPLGRISYNIENSN---YFRIGQRSGVISV---NKPLDYETKRRFLLVVSAIDD-TAPSKPVRVPVYINVS 2398          

HSP 12 Score: 72.0182 bits (175), Expect = 1.137e-12
Identity = 100/367 (27.25%), Postives = 158/367 (43.05%), Query Frame = 1
Query:  739 IPEDIPINSVVLVLSATDRDSGLN-GEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP---QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQ-------IYTTVIFDREQQDKHFVSIECTDQA---YHMNYINKTLLILXXXXXXXXXXXXSLN-FYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERS--SLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN 1785
            +PE+  + + VL +  TD  +GL  G  S+ I+++        YF +   +G I V KPLDY+   R       ++D A    S      V + V DVNDE P   Q  + A        Q++  E  P  T+V  +   D D   N  V       +F + S   +  F        I T    D E    H VS+  TD+     H + ++ T+ +LD NDN P F     N   + EN+P  + L  ++ + D+D   N+++ + +   + +  F I+   G L +  +FD E  +    +LT+   D GN   SS   I + + D D+    F +  + F +  N+ I   VG V A D D  
Sbjct: 2313 VPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSN-------YFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTA---PSKPVRVPVYINVSDVNDEKPVFGQSGYMA--------QWS--EGIPVGTIVVNVSAADKDSGANGRV-------WFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTD-VSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLY-EINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSG 2650          

HSP 13 Score: 63.929 bits (154), Expect = 2.745e-10
Identity = 66/278 (23.74%), Postives = 112/278 (40.29%), Query Frame = 1
Query:  352 IQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDR-GMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVF 1179
            + I V D ND  P +       ++ +G   G      +A D DS     +++ +                 I+    LD ET     + + A++ G     + + + + ++D+NDNPP+F  P    +  + E++P+NS +  ++ATDRDSG N   SF +    I       F++   +G +      DY+   +  +   +   D    P S +    VN     V DE    D Y    N++  +F V  N      VG +   D D  +   VF
Sbjct: 2393 VYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVP-GPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTV----IGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVN-----VADE----DEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVF 2656          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO41005 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5N5])

HSP 1 Score: 164.081 bits (414), Expect = 2.887e-41
Identity = 197/771 (25.55%), Postives = 353/771 (45.78%), Query Frame = 1
Query:   52 SKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVS--VLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPG----IDRSS---SLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQI--DFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMST----REQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLY----ENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEA-SNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDY-----IFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ--PPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            S+++    + E    GT +  ++++  ++G +   VS  VL+  +    +F I   +G +   T + +DRE I  +      SDG  +         +++ ++ + V+D NDN P +   S N   ++  LPG    I +A+D D  +   I Y +++       +  A +  +Q +  LD E  SK +L + AS+ G     D SS   ++ + + ++D NDN P+  K  ++ +  IPE+  +   ++ L+ TD+DSG N    + + S          F++ +VTG + + K LD++     F   + V DH   P SL    FVN+TV +VND  P    D Y    ++    FAV      + +VG +  +D+D + ++   C  L  + + NS       ++   +      DRE    +  S+   D   +   +N T++ ++  D +        + Y      +  P  T+L  K+R+ D D+ +N+ V Y +    +   F ++   G +  +   +RE+ +S  LTV   D G V R S   + I ++D++DN  V   D     + EN      V  V   D DE      + N + +Y      F +D F+G++TT   LDRE +  Y + V A +SN       S + +    V + + D ND+      P+FT  R   S  +  P   ++F++ + D D G N  + Y +  E+S  +F+I+ T+G+V L    S+LD E  + + ++++  D G
Sbjct:  430 SRALYSSPIYENEPPGTFVIQVSANDSDIG-SNAMVSYAVLSDAEGHYQYFKINAKNGTI--TTSRRLDRENITTFRLRVTASDGAPLSTI-----RVSVVDVVVTVLDINDNSPEFVRPSYNFSVIETALPGAILGIISAVDRDKDLNGNIVYIITEGNVEGSFIIGARSGLLQLNHTLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVCDKVYYTIS--IPENTSVGQSLIHLNCTDQDSGENAHLLYHMVSGH------SKFVVDNVTGIMSLNKLLDFEEKPTVFTVAIEVIDHGRPPLSLV--VFVNVTVDNVNDNYPSFGQDNYTFWISE--GDFAV-----DHAIVGVVSAHDLDADSSNCPLCGKL-QYTLGNSTGPFAIDKDTGVLRAVGSLDREGIKNYTFSVIAQDSIPNRPLVNVTMVTVNLLDVNDNDPVFDRDVYTANVSEDASPGLTVL--KIRAVDNDLASNANVSYSIVSGNTGAAFHVDNVTGEIKLVSKLEREKITSYTLTVGSADGGAVPRRSTALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKVVTTDPDE------VHNGRVEYNLTSDAFRVDPFTGIITTTRALDRESIPAYNLMVTARNSN-------SSDMEVNCSVHVIVMDTNDH-----TPSFTMARYYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMGEES--LFRINYTTGIVTLV---SSLDRENKAQYQLEVEARDRG 1149          

HSP 2 Score: 149.058 bits (375), Expect = 1.749e-36
Identity = 181/643 (28.15%), Postives = 289/643 (44.95%), Query Frame = 1
Query:  583 LDSETTSKFTLHLYASNP----------GIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDR----GMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEN-----------DEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYL---HEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVK--RSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHN-RLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFST-HVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWI 2406
            LD E  +++ L++ ASNP          G+  S+  ++ V ++D +D P  F+   +S +  IPE+  + SVV+ + A D D  +N   ++ ID        +  F + ++TGEI +   LD +      +R   +  I +DH        +E  +  TV DVND IP            S    V EN    T V  +   D+D   N            E      +   ++N    RE+  +Y+  +  RE +         T   +H N +  T+++ D+NDN P F     +  +YEN P GT +  ++ + D DI +N+ V Y +    E   + FKIN   GT+ + R  DRE  ++  L V   D   +   R S   + + +LD++DN   F +  + F + E ++   ++G + AVD D++    IVY I     +  F+I   SG+L  N  LDRE V ++ ++V A D         S  N +I  V I + D NDN PV     +T +   N S+ Q    S+  +  TD DSGEN  L+Y M +   H  F +   +G++ L   N  LD E   T   + ++V D G  P   V   ++VN+T D     +V +N     +    FWI
Sbjct:  173 LDFEQMTQYKLNISASNPLTNDTVIPKNGL--SNWTMVTVNVLDADDLPVRFNN--YSYSASIPENAAMGSVVMQVHAKDLDKSINAPVTYAIDKET---NPLRMFNIANITGEITLNGSLDRETIAEYRLRILAYCTIYQDH--------TEVLI--TVTDVNDNIPLFTLP-------SYNTTVNENAAIGTYVIQVQAEDIDQGVNASFIYEIAYAGHEFVIGEHSGIIIVNGTLDREKKDLYSITVIARETE---------TSAGFHSN-VTITVMLRDENDNSPIFSRALYSSPIYENEPPGTFVI-QVSANDSDIGSNAMVSYAVLSDAEGHYQYFKINAKNGTITTSRRLDRENITTFRLRVTASDGAPLSTIRVSVVDVVVTVLDINDNSPEFVRPSYNFSVIETALPGAILGIISAVDRDKDLNGNIVYIITEGNVEGSFIIGARSGLLQLNHTLDREVVSKHSLRVTASDRGGEFMADGSSLNTTIN-VTINVLDSNDNIPVCDKVYYTISIPENTSVGQ----SLIHLNCTDQDSGENAHLLYHMVS--GHSKFVVDNVTGIMSL---NKLLDFEEKPTVFTVAIEVIDHGRPPLSLV---VFVNVTVD-----NVNDNYPSFGQDNYTFWI 762          

HSP 3 Score: 138.658 bits (348), Expect = 2.840e-33
Identity = 195/783 (24.90%), Postives = 337/783 (43.04%), Query Frame = 1
Query:  196 FGIKFDSGILRLITLKNI----------DREVICEYEKNKINSDGCKIDIQIILGGSLTIH----EIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC----RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHM--------NYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVE--DEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISEN--SVINTVVGSVQAVDLDENT--------IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQP-KCTVFHPLYV-NLTSDYPINTHVLENTKKEKKIFTAFWILTSIIT 2424
            + I  ++  LR+  + NI          DRE I EY             ++I+     TI+    E+ I V D NDNIP +   S N    +    G       A D+D  V ++  Y ++     F + E +  + +  +L  + +     T+    +       S++ I V + D NDN P+FS+ L+S   PI E+ P  + V+ +SA D D G N   S+ + S+       +YF + +  G I   + LD +  +  F  +V   D A L     S   V +TV D+ND  P+         + S  F+V+E      ++G I   D D + N  +       ++   F++ + S   Q         DRE   KH + +  +D+              IN T+ +LD NDN P          + EN   G  L   L   D+D   N+ + Y++    +K F ++   G +   +  D EE+ ++  TV +E  D G    S   F+++ + +++DN   F +D + F ISE   +V + +VG V A DLD ++        + Y++ N      F IDK +GVL     LDRE +  Y   V+A DS IP    +     ++ +V + + D NDN PV     +T    N S    P  ++ +I + D+D   N  + Y + + ++   F +   +G + L    S L+ E  +++ + +   D G  P + T    +YV ++  + P+  H  +  +  + +    +++  + T
Sbjct:  259 YAIDKETNPLRMFNIANITGEITLNGSLDRETIAEYR------------LRIL--AYCTIYQDHTEVLITVTDVNDNIPLFTLPSYNTTVNENAAIGTYVIQVQAEDIDQGVNASFIYEIAYAGHEFVIGEHSGIIIVNGTLDREKKDLYSITVIARETETSAGFHSNVTITVMLRDENDNSPIFSRALYS--SPIYENEPPGTFVIQVSANDSDIGSNAMVSYAVLSDA--EGHYQYFKINAKNGTITTSRRLDREN-ITTFRLRVTASDGAPLSTIRVSVVDVVVTVLDINDNSPEF-------VRPSYNFSVIETALPGAILGIISAVDRDKDLNGNIVYIITEGNVEGSFIIGARSGLLQLNH----TLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVCDKVYYTISIPENTSVGQSLI-HLNCTDQDSGENAHLLYHMVSGHSK-FVVDNVTGIMSLNKLLDFEEKPTV-FTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKLQYTLGNSTGP--FAIDKDTGVLRAVGSLDREGIKNYTFSVIAQDS-IPNRPLV-----NVTMVTVNLLDVNDNDPVFDRDVYT---ANVSEDASPGLTVLKIRAVDNDLASNANVSYSIVSGNTGAAFHVDNVTGEIKLV---SKLEREKITSYTLTVGSADGGAVPRRSTALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKVVTT 994          

HSP 4 Score: 112.079 bits (279), Expect = 5.055e-25
Identity = 168/667 (25.19%), Postives = 294/667 (44.08%), Query Frame = 1
Query:  142 ITTEFVSVLNQR-DFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSS--SLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNS-MSTREQFQIYTTVIFDREQQDKHFVSIECTDQA---YHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD----FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLI----------DKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ 2070
            +TT+   V N R ++ ++    + D     + T + +DRE I  Y       +    D+++    + ++H I   V+DTND+ P +      +   +    G       A+D D  + + + Y L      F++  T   + + +SL  D E  +++ L + A + GI  S+  S  I + + D+NDN P F+   +  N    +   + ++V+ L   D+D  +N +  + I     +N     F + + +G I     LD +   R +   V+  D      +++S   V + V DVND  P I      NN         ENTP  +LV  +  +D+D   N  V   + + + V +   S +   +I      DRE Q++       TD     ++ + ++  +LI D+NDN+P F P   +  + EN PS  ++  ++ + ++D          L + S+ D    F I+   G + + +  DRE  S  +LT+  EDEG   R + G++ I + D +D   V  + + +  +SEN+ I + V S+ AVD D+ +   I YS+ N      F I           ++ G++ T   LDRE+ D Y I V A D           N+ +   + ++I D NDN PV     F    +N SL +
Sbjct:  992 VTTDPDEVHNGRVEYNLTSDAFRVDPFTGIITTTRALDRESIPAYNLMVTARNSNSSDMEV----NCSVHVI---VMDTNDHTPSFTMARYYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMGEESLFRINYTTGIVTLVSSL--DRENKAQYQLEVEARDRGIPESNANSTTILIRVGDVNDNRPTFTHAHYDGNVLEGQVGAVAAIVVAL---DKDEEINADIVYSIIGGNTDNS----FAINNKSGSIYTLLHLDRETTDR-YILTVLASDRG--EPAMNSSTNVTIHVNDVNDNKPNI-----TNNP--GVVVTRENTPPGSLVYILSASDLDEGSNARV---AFSGYAVPDGKFSIKPNGEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDILIADENDNNPVFDPVHYSVNISENGPSEEVIV-QVNASERDEGK------LLFKISSGDPGGYFTIHNVTGVISTRKPLDREMVSRFDLTITAEDEGRPSRMALGYVTIFVNDENDFAPVIEQCEQLVSVSENAHIGSAVASINAVDKDDPSNTKITYSVGNSA----FNITTQRLPFSSGSRYRGIIITAGLLDRERQDNYNITVTASDG----------NHIATCNIIVRITDVNDNSPV-----FNQTTMNISLHE 1603          

HSP 5 Score: 107.842 bits (268), Expect = 9.459e-24
Identity = 163/641 (25.43%), Postives = 275/641 (42.90%), Query Frame = 1
Query:  196 FGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL---SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQF--------QIYTTVIFDREQQDKHFVSIECTDQA----YHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEAS-NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVI------LDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENT-IVYSILNPKNDYIFLIDKFSGVLTTNSYLD-REKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFT 2040
            F I F+ G++RL   + +D E + +Y+ N   S+    D  I   G      + + V+D +D    +N+ S +    +    G       A DLD S+ + + Y +   ++P R F +      + +  S  LD ET +++ L + A        + +LI VT  D+NDN PLF+ P  S N  + E+  I + V+ + A D D G+N  F + I        A   F++   +G I+V   L  DR  ++ +   ++           S   + + + D ND  P I   A+ ++ I       EN P  T V  +  ND D   N      ++ S+ VL+      Q+         I T+   DRE      + +  +D A      ++ ++  + +LD NDN P F   S NF + E    G IL G + + D+D D N  + Y + E +    F I    G L    + DRE  S  +L V   D G    +    ++  I      LD +DN  V  K  +   I EN+ +   +  +   D D  EN  ++Y +++  +   F++D  +G+++ N  LD  EK   + + +   D   P    +S     +  V + +D+ NDN+P     N+T
Sbjct:  158 FDIDFNKGVIRL--ARELDFEQMTQYKLNISASNPLTNDTVIPKNGLSNWTMVTVNVLDADDLPVRFNNYSYSASIPENAAMGSVVMQVHAKDLDKSINAPVTYAIDKETNPLRMFNIANITGEITLNGS--LDRETIAEYRLRILAYCTIYQDHTEVLITVT--DVNDNIPLFTLP--SYNTTVNENAAIGTYVIQVQAEDIDQGVNASFIYEI------AYAGHEFVIGEHSGIIIVNGTL--DREKKDLYSITVIARETETSAGFHSNVTITVMLRDENDNSP-IFSRALYSSPI------YENEPPGTFVIQVSANDSDIGSN------AMVSYAVLSDAEGHYQYFKINAKNGTITTSRRLDRENITTFRLRVTASDGAPLSTIRVSVVDVVVTVLDINDNSPEFVRPSYNFSVIETALPGAIL-GIISAVDRDKDLNGNIVYIITEGNVEGSFIIGARSGLLQLNHTLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVCDKVYYTISIPENTSVGQSLIHLNCTDQDSGENAHLLYHMVSGHSK--FVVDNVTGIMSLNKLLDFEEKPTVFTVAIEVIDHGRP---PLSL----VVFVNVTVDNVNDNYPSFGQDNYT 759          

HSP 6 Score: 107.071 bits (266), Expect = 1.705e-23
Identity = 154/613 (25.12%), Postives = 262/613 (42.74%), Query Frame = 1
Query:  214 SGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPG---IRKTIPTAIDLDSSVFSTIFYNL-SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNP-GIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNEN--DEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAY-HMNY-INKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVK-RSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVI 2022
            +G ++L++   ++RE I  Y     ++DG  +  +       +   + I V+D NDN P    D+  V  ++ +LP    + K + T  D D      + YNL SD  R            I  +  LD E+   + L + A N    D   +  + V ++D ND+ P F+   +  +   PE  P+ S +  + A D D G+N E  + +   +        F +   TG + +   LD +   + +  +V   D   +P S ++   + + VGDVND  P         N +  Q   +            +  D + N +    +   + ++ F +N+ S      IYT +  DRE  D++ +++  +D+    MN   N T+ + D NDN P    +       EN P G+++   L + D D  +N++V +  +   +  F I  + G ++   S DRE ++         D G     SS     I+I D +DN  VF    +  +ISEN     V+  V A + DE  +++ I +      F I   +GV++T   LDRE V R+ + + A D   P   A+         V I ++DEND  PVI
Sbjct:  918 TGEIKLVS--KLEREKITSYTLTVGSADGGAVPRR-------STALVIIYVMDVNDNSPVCLHDTQTVRLLE-NLPAGHFVVKVVTT--DPDEVHNGRVEYNLTSDAFRVDPFTG-----IITTTRALDRESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMARYYIS--TPETTPVGSTLFRVRAVDGDDGINAEVRYTLMGEE------SLFRINYTTGIVTLVSSLDRENKAQ-YQLEVEARDRG-IPESNANSTTILIRVGDVNDNRPTFTHAHYDGNVLEGQVGAVAAIVV------ALDKDEEINADIVYSIIGGNTDNSFAINNKSG----SIYTLLHLDRETTDRYILTVLASDRGEPAMNSSTNVTIHVNDVNDNKPNITNNPGVVVTRENTPPGSLVY-ILSASDLDEGSNARVAFSGYAVPDGKFSIKPN-GEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDILIADENDNNPVFDPVHYSVNISENGPSEEVIVQVNASERDEGKLLFKISSGDPGGYFTIHNVTGVISTRKPLDREMVSRFDLTITAEDEGRPSRMAL-------GYVTIFVNDENDFAPVI 1484          

HSP 7 Score: 100.138 bits (248), Expect = 2.279e-21
Identity = 170/724 (23.48%), Postives = 321/724 (44.34%), Query Frame = 1
Query:  196 FGIKFDSGILRLITLKNIDREVICEYEKNKINSD-GCKIDIQIILGGSL-TIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNL-SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLL-IQVTIVDINDNPPLFSKPLFSRNEPIPE-DIPIN-SVVLVLSATDRDSG-----LNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDR-GMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVG-----DVNDEIPQID---FYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLN----FYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYST-DSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSG 2283
            F I   SG+L+L     +DREV+ ++      SD G +    +  G SL T   + I V+D+NDNIP  +     +   +    G         D DS   + + Y++ S  ++F  +V+    +   N L+   E  + FT+ +   + G    S ++ + VT+ ++NDN P F +  ++    I E D  ++ ++V V+SA D D+      L G+  + +        +   F +   TG  V+R     DR G++N+ F VI +D      S+ +   VN+T+      DVND  P  D   + A  +   S    VL+           + ND+  N N      S N+    +  +   + ++ +    +RE+   + +++   D          T L++    +     P  L+      L EN+P+G  +  K+ + D D  +N +V Y L   ++  F+++   G + + R+ DRE   + NL V   +  +        +H++++D +D+   FT  ++     E + + + +  V+AVD D+     + Y+++  ++  +F I+  +G++T  S LDRE   +Y ++V A D  IP      ++N +   + I++ D NDN P      FTH   + ++ +    ++  I    D D   N  ++Y +   ++   F I+  SG ++      +LD E    +++ +   D G
Sbjct:  586 FIIGARSGLLQL--NHTLDREVVSKHSLRVTASDRGGEF---MADGSSLNTTINVTINVLDSNDNIPVCDKVYYTISIPENTSVGQSLIHLNCTDQDSGENAHLLYHMVSGHSKF--VVDNVTGIMSLNKLLDFEEKPTVFTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTF--WISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKLQYTL------GNSTGPFAIDKDTG--VLRAVGSLDREGIKNYTFSVIAQD------SIPNRPLVNVTMVTVNLLDVNDNDPVFDRDVYTANVSEDASPGLTVLKIRA--------VDNDLASNANVSYSIVSGNTGAAFHVDNVTGEIKLVSK--LEREKITSYTLTVGSADGGAVPR--RSTALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVV-KVVTTDPDEVHNGRVEYNL---TSDAFRVDPFTGIITTTRALDRESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMARYYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMGEES--LFRINYTTGIVTLVSSLDRENKAQYQLEVEARDRGIP------ESNANSTTILIRVGDVNDNRPT-----FTHAHYDGNVLEGQVGAVAAIVVALDKDEEINADIVYSIIGGNTDNSFAINNKSGSIYTLL---HLDRETTDRYILTVLASDRG 1254          

HSP 8 Score: 62.7734 bits (151), Expect = 5.567e-10
Identity = 72/278 (25.90%), Postives = 126/278 (45.32%), Query Frame = 1
Query: 1447 LRSFDKDIDNNSQVHYYLHEASNKD--FKINTHEGTLISLRSFDREERSSLNLTVYVEDE-------GNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDY-IFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNF-THNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVE 2238
            + + D D +  +Q   Y   + N+D  F I+ ++G +   R  D E+ +   L +   +             S+   + + +LD DD P+ F    +   I EN+ + +VV  V A DLD++    + Y+I    N   +F I   +G +T N  LDRE +  Y ++++A+     I +  ++       V I + D NDN P+   P++ T    NA++       + Q+ + D D G N + IY +     H+ F I   SG++ +   N  LD E
Sbjct:  131 MSATDMDAEEINQRVNYAIVSGNEDGIFDIDFNKGVIRLARELDFEQMTQYKLNISASNPLTNDTVIPKNGLSNWTMVTVNVLDADDLPVRFNNYSYSASIPENAAMGSVVMQVHAKDLDKSINAPVTYAIDKETNPLRMFNIANITGEITLNGSLDRETIAEYRLRILAY---CTIYQDHTE-------VLITVTDVNDNIPLFTLPSYNTTVNENAAI----GTYVIQVQAEDIDQGVNASFIYEIAYA-GHE-FVIGEHSGIIIV---NGTLDRE 389          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 156.377 bits (394), Expect = 3.016e-39
Identity = 170/629 (27.03%), Postives = 286/629 (45.47%), Query Frame = 1
Query:  193 HFGIKFDSGIL--RLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSL-----LIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQD----KHFV-SIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISE-NSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSN-IPIEEAMSKNNKSIALVEIKIDDENDNFPV 2019
             F +   +G++  R+    ++D E    Y  + I +D           G  ++ E+ I V+D NDN P +   SI     +    G      TA D DS +   IF++++  +     +  +D + ++ S  LD E  + + L++ A    ID S S       + VT+ D+NDN P F+KP F  N  + E + + SV++  +ATD D G N   ++ +        +   F + S TG + + +PLD +   + + F V    HA     L S   VN+ +GD ND  PQ  F  +Q      Q  V++ TP  T+V  +   D D   N  V      +  +L  +   +   I T+   DREQQ      H+V ++  TD      + +  LL +   D +      + + Y   + ENMP GT +T  + + D+D   NSQ+ Y L    +  F I    G +   ++ +RE + + ++T+   D G    SS   +H+ +LD++DNP VFT   +   +SE N+     V  V A D D      + Y+I++     +F I++ +GV+ T   L+RE  D Y + V+A D   +P  +           +++ + D+NDN P+
Sbjct:  272 QFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGT-------GHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGV-VRVSGSLDREAKAVYVLNVSA----IDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAF--NVDVSEGVAVGSVIVNATATDPDQGSNAAITYSM--------SYPGFAINSNTGSVTITRPLDRET-KQAYSFTV----HARDGGGLESNVAVNVEIGDENDNSPQ--FPTVQY-----QTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTY----AILILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGV-TQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVT-MVTARDEDSGINSQIMYSL-TGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALG-MFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMD--------FGTIDVHVIDKNDNTPI 850          

HSP 2 Score: 107.842 bits (268), Expect = 5.519e-24
Identity = 169/692 (24.42%), Postives = 285/692 (41.18%), Query Frame = 1
Query:  217 GILRLIT----------LKNIDREVICEYEKNKINSDG----CKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAI-----DLDSSVFSTIFYNLSDPTRFFKLVETAD-NLYIQNSLMLDSETTSKFTLHLYASN-PGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRN-FFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVY-----VEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLV 2202
            G+ R +T            N+DREV   Y      +DG     +  I I L          + ++D NDN+P ++         +   PG+   + ++I     D++S+       N SD  +F     T      +     LD E T+ +T H+ A++  G    S   + + ++D NDN P F     S    I E   I   V  ++A D DSGLNG   F I+S        ++ I +S   + VVR     DR  +  +   V   D ++ P        V +T+ DVND  P+    A  N  +S   AV       +++      D D   N  +        F +NS +      +  T   DRE +  +  ++   D     + +   + I D+NDN P F        + +  P GTI+   + + D+D+ NN  V Y +       F I    G + +    DRE++S   L  Y     V D G  + +S   ++I + D +DN   F + ++   + EN  + T V  V A D D      I+YS+     D +F I+  +G +     ++RE  + Y + + A D   P+  + +K       V + + D NDN PV  F +  + R  +       + + Q+ +TD+D   N  + Y + +  +  +F I+ T+G++
Sbjct:  160 GLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIAL----------VRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPS--SIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEG----KFEIGRS---DGVVRVSGSLDREAKAVYVLNVSAIDGSYSPR--EGYGTVTVTLQDVNDNTPKFTKPAF-NVDVSEGVAV------GSVIVNATATDPDQGSNAAITYSMSYPGFAINSNTG----SVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVL-AVNAEDRDVGNNGHVTYAILILP---FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTG--GDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAK-------VHVHVLDVNDNPPV--FTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMH-GALGMFTINETTGVI 803          

HSP 3 Score: 106.686 bits (265), Expect = 1.307e-23
Identity = 146/611 (23.90%), Postives = 254/611 (41.57%), Query Frame = 1
Query:  388 PYWNSDSINVEFMDGD-LPGIRKTIPTAIDLDSSV-----FSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVT-----GEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNT---LVGFIMTNDVDFNENDEVFCRSLNSF----FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAY--HMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGM 2148
            P +   S N  F +G    G+      A D D        +S +  N+ DP          +   I+ +  L+ + T  + L + A++ G+   S++  + + + D+NDN P+F+   +S    + E+ P+ + +L ++ATD DSG N   ++ + +         + + ++VT     G I V   LD  R + +F+   I      +P S ++ A   + + D ND +P+               ++ EN+       +   IM  D D   N +V  R LN      F +N  +     ++      D E+   +   +   DQA   H +     + +LD NDN P F P S+   + E    G  +  ++ + D D   N ++ + ++  S   F+I   +G +    S DRE ++   L V   D     R   G + + + D++DN   FTK  F   +SE   + +V+ +  A D D+ +   I YS+  P     F I+  +G +T    LDRE    Y   V A D        +  N      V ++I DENDN P   FP   + + +     P    +  + + D D G N  + Y +
Sbjct:    1 PVFTPASYNATFTEGSSTRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTT--VFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGD------SHGLFRAVTKVSNHGTIEVAGNLD--REVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTG-------SIQENSGPGVPVQMASSIMATDRDIESNADVRYR-LNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVA-RVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG----FAINSNTGSVTITRPLDRETKQAYSFTVHARDGG-----GLESN----VAVNVEIGDENDNSPQ--FPTVQY-QTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI 576          

HSP 4 Score: 89.3521 bits (220), Expect = 2.836e-18
Identity = 89/334 (26.65%), Postives = 149/334 (44.61%), Query Frame = 1
Query: 1390 SLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEA------SNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIF-LIDKFS--GVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ---P--PEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK-TGNSNLDVEY---FSTHVIKLKVCDSGNQPKC-TVFHPLYVN 2325
            S N    E   +  +L   +++ D D   N  V Y + +       SN DF ++ + G + + R+ +R++  S NLT+   D G    S+   + IV+ D++DN  VF    +   + ENS + T +  V A D D      + YS+    +  +F  + K S  G +     LDRE  D Y + + A D  +PI         +IA+  ++I D NDN      P F+H R   S+ +   P  P +    I +TD D   N  + Y +   DS + F ++  +G++  + +   +LD E    ++ HVI      +G++     V H L  N
Sbjct:    7 SYNATFTEGSSTRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISR------TAIAIALVRILDRNDN-----VPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQ-FAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDAN 328          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 155.221 bits (391), Expect = 1.796e-38
Identity = 211/774 (27.26%), Postives = 347/774 (44.83%), Query Frame = 1
Query:  193 HFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQI-ILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLS--DPTRFFKLVETA----DNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRN-FFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDF-YAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNS-------------FFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY---LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKD-FKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE---NTIVYSI--LNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDN----FPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLD--VEYFSTHVIKLKVCDSGNQ--PKCTVFHPLYVNLTSDYPI------NTHVLENTKK 2376
             FG   ++G++   T   IDRE   +            I +Q+  L  S     +Q++V D NDN P + +    +   +         I TA D D+    T+ Y ++  D T  F L  TA      L +     LD ETT  + L++ A++ G        LI +TI+D ND+ P+F++  +  +  I E+      +L +SA DRDSG NG+  + ID + I + +I  F + S TG I  ++ LD++  ++N + F VI  D   +P S +  A V + V D ND  PQ+   Y   +N   ++    EN+  NT + +I+  D D N N +   +  N              +F+        Q Q       DRE    + +++  TD+          +LI   + ND      S N Y   + E   +G+ +  +L + D D  +N  V Y +   ++   F+++   G + + +  DRE+ SS+ +T+  +D G+  ++    + + I+D +DN   F K  +   ISE + I   V  V A D+D      I Y I   + + + +F ++  +GVL T S LDRE    Y   V+A D   P  + MS        VE+ I D NDN    +PV  F +   N       +PP K + Q+ +TD+D G N  + Y +   +++  F I  ++G++      ++LD  VE F + +I  K  D GN+   K  V +   +N   + P+      N  V EN  K
Sbjct:   41 QFGFNSNTGVIS--TTARIDRETTTQ------------ISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGS--IAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSI--FDLDSSTGVIRTKQNLDFE--VKNSYTFNVIASDGG-VP-SKNDLATVTINVLDTNDNSPQLKITYLPPHN--GDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFI--------QLQ----KPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTS-NAYTANISELAQNGSYVL-QLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDP--QLMSS-----VKVELTISDINDNAPVFYPVEYFASIMEN-------EPPGK-LLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTL---ASLDHEVEEFFSLIISAK--DGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPK 756          

HSP 2 Score: 146.362 bits (368), Expect = 1.201e-35
Identity = 196/763 (25.69%), Postives = 334/763 (43.77%), Query Frame = 1
Query:  190 SHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDG---CKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAI------DLDSSVFSTIFYNLS--DPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSL-LIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCR------SLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQA--YHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHY-YLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN-TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPIN-------THVLENTKKEKKIF 2391
            S F +   +G++R  T +N+D EV   Y  N I SDG    K D+  +           I V+DTNDN P      +     D  +      I T I      D DS+  S     ++  D    FK VE     +IQ    LD E    + L L  ++ G+   S+L  + + + D+NDN P F+   ++ N  I E     S VL L+ATD D G NG  S+ I         + +F +   +G +   KPLD ++ + +    +  +DH   P + S+   V +T+ D ND  P+         K S +  + E       V  +   DVD  +N  +          +N  F LN+ +      ++T    DRE +  +  ++   D      M+ +   L I D NDN P F+P      + EN P G +L  ++ + D D   N+ + Y  +   +N +F I++  G + +L S D E     +L +  +D GN   +    +++ +L+  DN  VF  + + F + EN    T+VG V A   D+N +I Y+I++     +FL+D   G++  N  +DRE+  +Y + V+A    +    A        A V I++ D NDN P     +   +     L     + ++   + D D+G+N  + Y +   ++  +  I+ TSG++ L    ++ D   ++  V+     DSG+ P+ +    +++ L+ ++P         THVL +     + F
Sbjct:  254 SIFDLDSSTGVIR--TKQNLDFEVKNSYTFNVIASDGGVPSKNDLATV----------TINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFK-VEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTAN--ISELAQNGSYVLQLNATDPDEGDNGTVSYSI----TGGNDLGWFQVDFQSGLVTTAKPLDREQ-VSSVTITITAQDHGSAPKTGSTT--VTVTIIDGNDNKPRF-------MKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGV----LWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL--QVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQ-------ATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVG---QVVYNAAAVDLDAGKNGLVRYQL-TSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVL---ASDSGSPPQHSTMT-IHITLSINHPPKFTLSSYVTHVLASQPLSYQFF 966          

HSP 3 Score: 133.265 bits (334), Expect = 1.325e-31
Identity = 170/642 (26.48%), Postives = 280/642 (43.61%), Query Frame = 1
Query:  340 TIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFF-FKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFA-VLENTPKNTLVGFIMTNDVDFNEND----EVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI----LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRS-FDREERSSLNLTVYVEDEGNVKR-SSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD--ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLF--QPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKT 2214
            T+  + I+V D NDN P + S++      +    G       A D D     T+ Y+++             +  +  +  LD E  S  T+ + A + G   ++ S  + VTI+D NDN P F K  +     I E   I + VL +SATD DSG NG  ++ I S+      +  F + + TG +  +  LD  R  ++ + F V+ +DH      L S   V LT+ D+ND  P   FY ++       FA ++EN P   L+    T D D   N     ++   + N  F ++S +      I T    D E ++  F S+  + +     Y  KT ++    L+  DN P F  +  NF +YEN+P GT L G++ +  KD   N  + Y +      +  +    G +I +    DREE++   L V +   G VK  S++  ++I +LD +DN   F+    +  I    ++  VV +  AVDLD  +N +V   L    + +  I+  SGV+     L      +Y ++V+A DS  P + +    + ++++          N P    P FT +     +   QP     F + + D DSG+N  L Y +   +   +F I     L   K+
Sbjct:  407 TLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGT--ISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGL--FELNTQTGVLWTKSQLD--RETKSLYSFTVLAKDHG--DPQLMSSVKVELTISDINDNAPV--FYPVE------YFASIMENEPPGKLLQVTAT-DADEGTNAVISYDIIGGNNNGNFSIDSSTGV----ISTLASLDHEVEE--FFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGT-LVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAV-IARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI----------NHP----PKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKS 1007          

HSP 4 Score: 116.701 bits (291), Expect = 1.849e-26
Identity = 199/830 (23.98%), Postives = 338/830 (40.72%), Query Frame = 1
Query:   55 KSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSH-FGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSS-SLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQ---------IDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSI----ALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLK-------TGNSNLDVEY--------FSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVSLLTAF 2445
            KS  K  + EG  +G  +  +++   + G        ++  D +V+  F +   +G+L   T   +DRE    Y    +  D    D Q+     ++  ++++ + D NDN P +         M+ + PG    + TA D D    + I Y++            +    I     LD E    F+L + A + G   ++ + ++ VT+++  DN P+F   ++  N  + E++P  ++V  + AT +D   NG  S+ I S    N     F++ S  G I +   +D +   + +   VI       P  LS++A VN+ V D ND  PQ         ID   +    + N  AV  +  KN LV + +T+    N    ++  S +    L    T      YT  +   +       S         +N+  K  L                 FY+               + D+D   N Q+ Y + + + +        G L   +S  +  + S +L V   D G    S+   + I I D +D+  +F  + F F ++ENS   T+VG++ A  LD +    IVYS+++ ++   F +D  SG +TT   LDRE+     IK    +  I   EAM  N+ +I    A+V + + D NDN PV     +    +  S    P   +F+I + D+D G+N    Y + +      F I+ ++G + L        T + NL V+         +ST  I++ V DS +Q          VN+T D  I + V+     +K I     I  SI   +L   F
Sbjct:  532 KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLW--TKSQLDRETKSLYSFTVLAKDHG--DPQL-----MSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQV-TATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMY--NFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTN----LFLVDSTGGIIKINGDMDREEKAQ-YLLAVIARVGTVKP--LSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS----NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVV--------------AVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESH--FAVDVRSGQITTRVRLDREE----LIKNTGSNVYIMQAEAM-YNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYA---ITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMF 1312          

HSP 5 Score: 109.768 bits (273), Expect = 2.694e-24
Identity = 164/674 (24.33%), Postives = 274/674 (40.65%), Query Frame = 1
Query:   67 KFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKI---------NSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV----FCRSLNSFFVLNSMSTREQFQIYTTVIFDREQ----QDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTIL-TGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPI----VFTKDKFVFHISENSVINTVVGSVQAV----DLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYF-IKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDEN 2004
            +F V E    GT +  L +   +   T + V  L   +   SHF +   SG  ++ T   +DRE + +   + +         N    K D  I++          + V D NDN P ++     +   +  LPG       A+D D    +  FY+L   T   K    +    +  S  LD ETTS + L + A++    +  S+  I++T+ D ND  P+F +  ++ N  I ED  I S+V+ L+A+D+D G NG   + I     N      F ++S TG ++V K LD++   + +   +  +DH  +P  LSS   V + V DVND  P      +          V EN      VG    +D D   N  +    + ++ +  F +NS +     +I T    D E     +D   + +  TDQ        K++ +            +S  F       +G+ L    + + D D ++N +V Y +   +N  F ++   G L  +     +  +   LT+   D G   R ++  + +      + PI     F+   +   ++EN V  T V +V A      L+ N I Y + +  +   F + K +GV+ T   +DRE +   F + V A D   P     S      A V I + D N
Sbjct: 1056 RFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSE---SHFAVDVRSG--QITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVI----------VTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVN--ITEDALIGSLVINLNASDKDIGQNGLIKYSIS----NGNLAAMFDVESATGRLIVAKSLDFET-TQLYELTITAQDHGLIP--LSSTVNVTVNVLDVNDNAPLFPTQPV-------TLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATC----EITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITV-----QVTDENDNSPGFVSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQI-PDNPTIYQLTIQASDGGQPSRQTQTVVSV----FKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGN-IEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSS------ATVTITVQDVN 1677          

HSP 6 Score: 76.6406 bits (187), Expect = 3.191e-14
Identity = 140/602 (23.26%), Postives = 256/602 (42.52%), Query Frame = 1
Query:  466 AIDLDSSVFSTIFYNL--SDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDR-SSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKV-IVEDHAFLPYSLSS----EAFVNLTVGDVNDEIPQID--FYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVF-----CRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFY--LYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEAS-NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENT---IVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKV----DRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSG 2196
            A+D DS     +FY++   +    F +      LYI+ SL+        + L + A++ G+   S+S+ + + I D ND+  LF    F     + E+    ++V  L A   D     +  + + S++       +F +   +G+I  R  LD +  ++N    V I++  A   Y+ ++    +A V +TV D+ND  P      YAI  +++S     L  +P    V  I   D D  +N + F        ++ FF+ +S       +++ +   DRE    + + ++ TD +    Y    + I   + ND        ++   + E+   G+++   L + DKDI  N  + Y +   +    F + +  G LI  +S D E      LT+  +D G +  SS   + + +LD++DN  +F        + EN      VG   A D D  T   I +S+ +      F ++  +  +TT + +D E +    D + + V+A D   P         KSI    +++ DENDN P  + P        +SL      ++  I + D D   N  + Y + + + +  F +H ++G
Sbjct:  970 AVDQDSGKNGQLFYSIPQGNEEGLFGIFP-GGKLYIRKSLL--QALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRF--AVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSE------SHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAM--YNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELS-----LPGSP----VFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTG-----ELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVI-NLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSP----KLSTRKSIT---VQVTDENDNSPGFVSPPAA--AAGSSL------NVMTITAEDPDRNSNGKVTYSIISGN-NGYFNLHPSTG 1527          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 202.601 bits (514), Expect = 1.820e-53
Identity = 216/789 (27.38%), Postives = 364/789 (46.13%), Query Frame = 1
Query:  211 DSGILRLI--------TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVI--DTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNE---PIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC-RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK-----CTVFHPLYVN--------------LTSDYPINTHVLENTKKEKKIFTAFWILTSIITVSL 2433
            DS ++R++        T   IDRE +C    +      C  +I++++  +     I+I++I  DTNDN P + S  IN+   +  L   R  IP+A D D+   S   Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN     KP+F  N+    IPE+ PI + V+ L ATD D G N E  + +   +++      F + S +G I V++PLD +    +    V+  D +  P    + A V + V DVND  P ID   I +  I+    + E  P NT +  I  +D D + N +V C    +  F L ++    Q+ + T+ + D E   ++   I  +D       +N+T L+    +++           +   + EN      LT  L + D+D   N+++ Y L   ++  F ++   G L + R FDRE++     TV   D G     ++  + + +LD +DN   FT + F F +SEN    + VG +   D D      I  SILN  ++  F++D FSGV+ +N   DRE+   Y   V A DS  P   + +K       V I + D NDN P++I+P    +     L   P   + ++++ DSD+G N  L Y + + ++  +F+I   +G + L+   +  D+     H + + + D G  PK       VF  LYVN               T + PI+ ++ E+++ +   +  F I+ + +T +L
Sbjct:   72 DSPLVRVLGNTGEIFTTSNRIDREKLCP--GSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDN-----KPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHY-VFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKL-SVLASDGSSSP----ARATVIINVTDVNDNPPNIDLRYIIS-PINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDN-QYLLETSALLDYEGTKEYNFKIVASDSGKPS--LNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLT-TLSATDEDSGKNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILN--DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAK-------VTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDI---GLHRLVVNISDLG-YPKSLHTLVLVF--LYVNDTVGNSTLIYDLIRRTMETPIDRNIGESSEPQSDDY--FPIMVAFVTGAL 822          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 201.83 bits (512), Expect = 6.071e-53
Identity = 216/789 (27.38%), Postives = 364/789 (46.13%), Query Frame = 1
Query:  211 DSGILRLI--------TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVI--DTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNE---PIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC-RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKC-----TVFHPLYVN--------------LTSDYPINTHVLENTKKEKKIFTAFWILTSIITVSL 2433
            DS ++R++        T   IDRE +C    +      C  +I++++  +     I+I++I  DTNDN P + S  IN+   +  L   R  IP+A D D+   S   Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN     KP+F  N+    IPE+ PI + V+ L ATD D G N E  + +   +++      F + S +G I V++PLD +    +    V+  D +  P    + A V + V DVND  P ID   I +  I+    + E  P NT +  I  +D D + N +V C    +  F L ++    Q+ + T+ + D E   ++   I  +D       +N+T L+    +++           +   + EN      LT  L + D+D   N+++ Y L   ++  F ++   G L + R FDRE++     TV   D G     ++  + + +LD +DN   FT + F F +SEN    + VG +   D D      I  SILN  ++  F++D FSGV+ +N   DRE+   Y   V A DS  P   + +K       V I + D NDN P++I+P    +     L   P   + ++++ DSD+G N  L Y + + ++  +F+I   +G + L+   +  D+     H + + + D G  PK       VF  LYVN               T + PI+ ++ E+++ +   +  F I+ + +T +L
Sbjct:   72 DSPLVRVLGNTGEIFTTSNRIDREKLCP--GSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDN-----KPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHY-VFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKL-SVLASDGSSSP----ARATVIINVTDVNDNPPNIDLRYIIS-PINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDN-QYLLETSALLDYEGTKEYNFKIVASDSGKPS--LNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLT-TLSATDEDSGKNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILN--DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAK-------VTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDI---GLHRLVVNISDLG-YPKSLHTLVLVF--LYVNDTVGNSTLIYDLIRRTMETPIDRNIGESSEPQSDDY--FPIMVAFVTGAL 822          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 201.445 bits (511), Expect = 8.394e-53
Identity = 216/789 (27.38%), Postives = 364/789 (46.13%), Query Frame = 1
Query:  211 DSGILRLI--------TLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVI--DTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNE---PIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFC-RSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXX----XXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKC-----TVFHPLYVN--------------LTSDYPINTHVLENTKKEKKIFTAFWILTSIITVSL 2433
            DS ++R++        T   IDRE +C    +      C  +I++++  +     I+I++I  DTNDN P + S  IN+   +  L   R  IP+A D D+   S   Y L +    F L  VET +      L +Q +L  D E    + + +   + G   +SS+ ++QVT+ D+NDN     KP+F  N+    IPE+ PI + V+ L ATD D G N E  + +   +++      F + S +G I V++PLD +    +    V+  D +  P    + A V + V DVND  P ID   I +  I+    + E  P NT +  I  +D D + N +V C    +  F L ++    Q+ + T+ + D E   ++   I  +D       +N+T L+    +++           +   + EN      LT  L + D+D   N+++ Y L   ++  F ++   G L + R FDRE++     TV   D G     ++  + + +LD +DN   FT + F F +SEN    + VG +   D D      I  SILN  ++  F++D FSGV+ +N   DRE+   Y   V A DS  P   + +K       V I + D NDN P++I+P    +     L   P   + ++++ DSD+G N  L Y + + ++  +F+I   +G + L+   +  D+     H + + + D G  PK       VF  LYVN               T + PI+ ++ E+++ +   +  F I+ + +T +L
Sbjct:   72 DSPLVRVLGNTGEIFTTSNRIDREKLCP--GSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDN-----KPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHY-VFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKL-SVLASDGSSSP----ARATVIINVTDVNDNPPNIDLRYIIS-PINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDN-QYLLETSALLDYEGTKEYNFKIVASDSGKPS--LNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLT-TLSATDEDSGKNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILN--DNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAK-------VTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDI---GLHRLVVNISDLG-YPKSLHTLVLVF--LYVNDTVGNSTLIYDLIRRTMETPIDRNIGESSEPQSDDY--FPIMVAFVTGAL 822          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 194.126 bits (492), Expect = 3.284e-51
Identity = 184/674 (27.30%), Postives = 322/674 (47.77%), Query Frame = 1
Query:   10 MKCVLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGI----KFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRF-FKLVETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCR-SLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTL--LILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFK------INTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDN-PIVF------TKDKFVFHISENSVINTVVGSVQAVDLD---ENTIVYSILNPKNDYIFLIDKFSG-VLTTNSYLDREKVDRYFIKVVAFDSNIPI 1938
            M CV+      +  S + +++ + E V+ GT + +     K+LG+     S L  R +++   G       D     L   + IDRE +CE  +       C I+++I+L   L +H + IEV+D ND+ P +  +   +E  +   PG R  +  A D D+  FS   Y LS    F   + +T ++     L IQ S  LD E   +  L L A + G   +S  + I V ++D+NDN P+FS+ ++S    + E+ PI S VL ++A+D D G NGE  +   SN +N K +++F + + TGEI V   +DY+     +   +   D A  P  L+S+  V +++ DVND +P+I+  +  +       +V E++   T V  I  ND D   N +V C     + F L+       + + T    DRE+Q ++ +++   D     +   KT+  +I D NDN+P F      FY  E    G +L   +++FD D   N+++ Y++    N + K      IN+  G +++L+SFD E   +    V   D G+   SS   +++ ILD +DN P++          + V  I  N     +V  V+A D D      +++S+    +  +F +D+++G + T  S+ + ++ +   + +V  + N+ +
Sbjct:   16 MSCVVAAC--LWSVSAAQIRYSIAEEVKEGTAVGNTA---KDLGLDK---SSLKVRRYRIGSGGTDSLFHVDQTDGFLYVSQQIDREEVCERTRT------CVINVKIVLENPLEVHHVIIEVLDINDHSPTFAENETRLEISETVFPGTRILLKPARDPDAGPFSIQQYTLSSNDHFRLDIKDTGEDGKIPVLIIQKS--LDREACERHMLVLTAIDGGKPPKSGEVTIIVNVLDVNDNAPVFSRDVYSVT--LEENSPIGSTVLKVNASDLDEGRNGEVVYSF-SNSVNPKFLKFFEINANTGEITVIGSIDYEE-RDKYQIDIQASDKAVAP--LASQKGVVISIIDVNDNVPEIEITSFSS-------SVPEDSKPGTTVALISINDQDSGLNGKVVCSVDGETPFNLSPSVQDRMYSLVTKSQLDREKQSQYSITVVAKDAGQPAHSSEKTINVVISDVNDNNPEFSIRPYIFYASEGNEPGAVLF-SIKAFDHDESENARITYHIVRDGNDNSKLVSFLNINSDSGEVVALKSFDFESVKTFQFYVVATDSGSPPLSSNVTVNVFILDQNDNAPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQQVTDHSLFALDRYTGQIRTLRSFTETDEAEHKLLILVKDNGNVSL 659          

HSP 2 Score: 100.138 bits (248), Expect = 3.345e-21
Identity = 154/586 (26.28%), Postives = 261/586 (44.54%), Query Frame = 1
Query:  670 VTIVDINDNPPLFSKPLFSRNE---PIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMK-SVTGE------IVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIP--QIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEV---FCRSLN----SFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI--LXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSF-DKDIDNNSQVHYYLHEAS--NKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFL-----IDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKS-----IFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSG-----------------LVFLKTGNSNLDVEYFSTHVIKL 2265
            + ++DIND+      P F+ NE    I E +   + +L+  A D D+G      + + SN       ++F +    TGE      ++++K LD +   R+      + D    P S   E  + + V DVND  P    D Y++          + EN+P  + V  +  +D+D   N EV   F  S+N     FF +N+ +     +I      D E++DK+ + I+ +D+A       K ++I  +D NDN P     S +  + E+   GT  T  L S  D+D   N +V   +   +  N    +     +L++    DRE++S  ++TV  +D G    SS+  I++VI D++DN   F+   ++F+ SE +    V+ S++A D DE+    I Y I+   ND   L     I+  SG +      D E V  +   VVA DS  P    +S N      V + I D+NDN PVI++P  + N     + + P        + ++ + D+D G N  L++ ++    H +F + R +G                 L+ L   N N+ +   +T ++KL
Sbjct:  122 IEVLDINDH-----SPTFAENETRLEISETVFPGTRILLKPARDPDAGPFSIQQYTLSSN-------DHFRLDIKDTGEDGKIPVLIIQKSLDREACERHMLVLTAI-DGGKPPKS--GEVTIIVNVLDVNDNAPVFSRDVYSV---------TLEENSPIGSTVLKVNASDLDEGRNGEVVYSFSNSVNPKFLKFFEINANTG----EITVIGSIDYEERDKYQIDIQASDKAVAPLASQKGVVISIIDVNDNVPEIEITSFSSSVPEDSKPGT--TVALISINDQDSGLNGKVVCSVDGETPFNLSPSVQDRMYSLVTKSQLDREKQSQYSITVVAKDAGQPAHSSEKTINVVISDVNDNNPEFSIRPYIFYASEGNEPGAVLFSIKAFDHDESENARITYHIVRDGNDNSKLVSFLNINSDSGEVVALKSFDFESVKTFQFYVVATDSGSP---PLSSN----VTVNVFILDQNDNAPVILYP-VSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQQVTDHSLFALDRYTGQIRTLRSFTETDEAEHKLLILVKDNGNVSLSATATVIVKL 669          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 191.43 bits (485), Expect = 8.246e-50
Identity = 195/725 (26.90%), Postives = 321/725 (44.28%), Query Frame = 1
Query:  247 IDREVICEYEKNKINSDGC--KIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKL--VETADN-----LYIQNSLMLDSETTSKFTLHLYASNPG-IDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXX----XXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDEN---TIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFP--NFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIY-------GMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKC----TVFHPLYVNLT 2331
            IDRE +C           C  +I++ ++      + +I+  + D NDN P + S  IN+   +      R  +P+A D D  +     Y L      F L  +ET +      L +Q +L  D E    F + +   + G   +SS+ ++QVTI D+NDN P+F       +  +PE+ P  + V  L ATD D G N +  F   SN+I++    +F + S TG I V++PLD +    +    V+  D    P    S A V + V DVND +P ID   I N  ++    + EN P NT +  I   D D +   +V C + +           +QF + T    D E   ++ + I  +D+      +N + ++L    ++           +   + EN    T L  K+ + D D  +N+++ Y L   +   F I+   G L   +  DRE++   +  V   D G+    S   + +++ D++DN   FT  ++ F++ EN  +   VG +   D D      I  SILN K++  F+ID  +GV+  N   DRE+   Y   V A D   P   + +K       V I + D NDN PV + P  N++++ +  +    P   + ++++ D+D+G N  L Y                +F I + SG + L+      D      H + +KV D G QP+     T+ H L+VN T
Sbjct:   91 IDREKLC---SGVFTEKRCYYEIEVAVLPDEIFRLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKSVTEFGLDIIETPEGDKWPQLIVQQNL--DREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVS--VPENAPTGTSVAQLHATDADWGSNAQIHFAF-SNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLI-VLASDGGSTP----SRATVIVNVTDVNDNVPAIDTRYIIN-LVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRG--TPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLI-KISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKDN--FIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAK-------VTINVVDVNDNRPVFVIPSSNYSYDLVRTTTT--PGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGAD---LGLHRLVVKVRDLG-QPESLQAITLVH-LFVNDT 782          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000006531.1 (SMESG000006531.1)

HSP 1 Score: 1749.56 bits (4530), Expect = 0.000e+0
Identity = 882/882 (100.00%), Postives = 882/882 (100.00%), Query Frame = 1
Query:   10 MKCVLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVSLLTAFITGSILLYLKIRSNQAKIIVNMFEDHRNIKPNCRRKKFQNSYSISNFAKIKMNEINQAQDNSIEIFSTDN 2655
            MKCVLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILDDNDNDPYFFPDSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVSLLTAFITGSILLYLKIRSNQAKIIVNMFEDHRNIKPNCRRKKFQNSYSISNFAKIKMNEINQAQDNSIEIFSTDN
Sbjct:    1 MKCVLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILDDNDNDPYFFPDSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAFWILTSIITVSLLTAFITGSILLYLKIRSNQAKIIVNMFEDHRNIKPNCRRKKFQNSYSISNFAKIKMNEINQAQDNSIEIFSTDN 882          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000010675.1 (SMESG000010675.1)

HSP 1 Score: 340.117 bits (871), Expect = 3.846e-102
Identity = 269/812 (33.13%), Postives = 407/812 (50.12%), Query Frame = 1
Query:  163 VLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGI-DRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVL-ENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFV----LNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIF-----TAFWILTSIITVSLLTAFITGSILLYLKIRSNQAKIIVNMFEDHRNIKPNCRRKKFQN 2565
            +LN RD  V +F +  D    +L     IDRE IC       +S  C I +++ L G+  I  I+IE+ D ND+ P W  +   V F +G+  G RK+IP + D D      I Y L   T  F LV+    LY+Q    LD E  S + L + +++ GI  +S  L ++V I+DINDN P FS  +F   + IPE +P+ SVVL L+ +D D+G NGEFSF     +  + A  YF++K   GEI+V + LDY+ G+  F FKVI++DHA L Y  SSE+ V + + D NDE PQI FY ++ N     FA++ EN P +T V  I  +D DF E+D V C + N  F     L   +   +F++ T  + DRE + + F+ I CTD   H    N T+ I D NDN P F  + ++  + ENM +GT    ++++ DKD   N  V Y +  A +  F I++  G + S    DRE ++     +   D G+ K SS     + + D +DNP++     + F + ENS  NT VG V A D D  TI YS+    +   F ID+ +GV+ T S LDRE   +Y  +  A D          K N + ++V I ++D NDN PV   PN + N ++ S  +    S+ +I + D D  E+  + Y + NE    +F + + +G ++L+        E    + + ++ CD G    CT F    +N+  +       L  TK +  +       +  I+ ++IT  L    +T  I+  L+ +S              N+KP   RK+ QN
Sbjct:   42 ILNPRDKGVQNFIL--DPISSKLSVNNRIDREAIC-----PTSSINCFIILKVTLHGTDRIVTIRIEIDDVNDHSPNWKINKHKVIFNEGEHAGSRKSIPISFDPDFGDNGQIKYTLESSTDTFILVQ-EHGLYLQTLKQLDREHKSGYKLTIISTDRGIPSKSGRLEVEVEILDINDNTPRFSTSIFRPTKIIPETMPVQSVVLKLTGSDADAGQNGEFSFSFSPTE-TSIAKSYFLVKP-DGEIIVLRQLDYESGIHKFDFKVIIKDHASLGYERSSESRVEIIISDENDEYPQIKFYPMRTNS-ETGFAIIDENKPLSTSVALIQASDKDFKESDTVTCTTDNFGFAESLSLTPTNDNNEFKLVTARMLDREMEKRIFIRIICTDSVNHKTSTNITVDIGDVNDNSPKFSDNIIHMSIKENMDAGTTTNKQVKAIDKDSGKNGFVVYSI-PAHDIPFTIDSRTGVIRSKDRLDREVKNLYQFIIVASDHGSPKLSSTVTALVHVDDENDNPVIIETSPYEFKVKENSPPNTPVGRVIATDKDNQTIFYSLDYVSDSGKFNIDRTTGVIVTKSKLDREIQHKYQFRAFATD----------KLNSASSIVMIFVEDVNDNPPVFKMPNSSLNSISLSYKEAAGFSLTKIVAEDPDDKESARIQYSVVNEKYSSLFSLDKDTGFLYLQRSLDGAHAEDRDHYSLDIEACDMGTPRMCTTFRGFKINIQRN-----GDLTKTKGQPNLLIDSSGMSENIIIALITFLLFMIMVTIFIIFLLRRKS------------RNNLKP---RKESQN 811          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000027424.1 (SMESG000027424.1)

HSP 1 Score: 311.997 bits (798), Expect = 2.775e-91
Identity = 259/827 (31.32%), Postives = 407/827 (49.21%), Query Frame = 1
Query:   64 LKFKVDEGVQVGTEIADLTSDFKNLGITTEFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICE-------YEKNK--INSDGCKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKR---SSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE----NTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRY-FIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPK--CTVFHPLY--VNLTSDYPINT--HVLENTKKEKKIFTAFWILTSIITVSLLTAFITGSILLYL 2472
            +++K+ E V + T + DL  +      +   + + N  D  V  F I  +    +L+  + IDR+ +CE       Y KN      + CKI I +       + ++ I + D NDNIP WN   I V+F+DG     + ++P A D D    + I Y+  +    F+L +T D  Y+Q    LD E    +T  L AS+ G   ++  + + V I D+NDN P+FSKP++ R + + ED  + +++  L A+D DSG+NG+F+F+  +  +      YF ++S  G ++V  PLD DRG     FKV+VED A  PYS SS+A V + + DVNDE P++    + ++  +N+  V+E+T   TL+G +   D D+N  D V C   NS F L S     +++I T + FDRE+     + I C D   ++   N ++ I D NDN P F        + EN P  T+L  KL + D   D+ S + Y++    + +F I+   G + +L SFDRE  +S  + V  +D  ++K    +    + ++ILD +DN  VFT + + FHI EN+  NT VG V+A DLDE    +++ Y +        F I+  SG +T    LDREK   Y FI  V   ++ P+     K N   + V + IDD NDN P  I PN T +  + S+       I  +Y+ D+D  +N  + Y +   +   IF I   +GL+ L     +   +    + + +  CD G +PK  CT F  L   VN   DY         E   K+K        +   + +  +T  I+ S L+ L
Sbjct:   13 IEYKIQEEVALETMVGDLYKNVFQATNSKGKLEIKNLNDRFVKCFKINMNG---QLVVARRIDRDQMCEKSTSQPIYTKNSRITPEEECKIFINVASPSLNIMTKVVITIEDINDNIPSWNLQRIEVKFIDGCKERTKVSLPPAFDKDIGQNAQIEYSFKERDLPFRL-DTEDGFYLQTLQTLDREQKESYTFTLIASDKGNPVQTGEIEVHVVIEDLNDNSPIFSKPIY-RFKAVSEDSAVGTIIGKLEASDADSGVNGKFNFKF-AEAVPEIVKHYFQIQS-DGTVIVAAPLDSDRGNNELKFKVVVEDEALRPYSKSSDATVYVYINDVNDEKPELKLIFMNHDSRTNKPFVVEHTKIGTLIGILEVTDRDYNNKDTVSCNVDNSQFALISEDRPVKYKITTNMDFDREKMTTADLRIFCRDSVGNLASSNHSINIKDINDNPPNFTKSFYVMKIKENQPVHTMLPSKLVATDP--DSESTIQYFISPEYSSNFSIDRETGIISTLVSFDREICASYTIKVIAKD--SIKEPINTGTCTVQVIILDENDNKPVFTHEFYTFHIPENNFPNTAVGIVKATDLDEQDSQSSLSYRLEYSSKTRPFKINSRSGAITAIITLDREKETFYSFIVYVEDGNDYPM-----KRNTVTSSVTVVIDDVNDNSPKFIIPNATKSSFDISIKDTVGHKIINVYAEDADVSDNSRIYYNITAGNDENIFSIDSATGLLLLSDSLQSNQQKPQPHYTLSVTACDYG-KPKQLCTTFKNLRIIVNNGEDYKYKGLDSNQEPDSKDKNTNVHHEAIIICLAIVFITLLISASALICL 822          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000067388.1 (SMESG000067388.1)

HSP 1 Score: 270.011 bits (689), Expect = 5.770e-79
Identity = 220/665 (33.08%), Postives = 346/665 (52.03%), Query Frame = 1
Query:  532 FKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRS-------LNSFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHN-RLNASLFQPPEKSIFQIYSTDSDSGENQTLIYGMENEDSHK--IFKIHRTSGLVFLKTGNSN---LDVEYFSTHVIKLKVCDSGNQPKCTVFHPLYVNLTSDY--PINTHVLENTKKEKKIFTAFWILTSIITVSLLTAFITGSILLYLKI 2478
            F+L +  + LYI+N+ MLD E  + + + + A + G   +S+ L + V I+D+NDNPP F+  +F   + + E+ P  +V+L+L A D D G NGEF+FR+  N   +  +E   +   TGE+ ++  +DYD    +F FKVIV+DHA  PYSLSSEA V + + D+NDE P I FY    +  +    +LEN+   T +G I  +D D    D+V C S       LN    + +    E F I +   FDRE + K    I CTD + H    N T++ILD NDN P F   + +FY+ EN P GT+L  ++   DKD +NN +    +    +  F I+     L S  +FDRE+ S   L +   D G+ + +S   +++ I D++DNP++ T     F+ISEN    +++G ++A D D  TI Y I N K+   F I+K SG L   + LDRE+ + + I V A DS           + +   V + + DENDN P  IF N     +++AS  + P   I +I +TD+D G N  + Y ++ + S+K  +F +   SG + L         +D   F    + ++ CD G   +CT+F  L +  T++   P +    E+ K +K  +  F      +  ++L A I+G ++L + I
Sbjct:    9 FRLFQD-NGLYIENTQMLDREKKNVYEIIIIAQDNGSPYKSNELQVTVEIIDVNDNPPKFTDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPN--TSPEVEKHFLVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEPYSLSSEAVVEIDIQDINDEFPTIAFYPRNPDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNE-FNIVSNRKFDRETESKLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEFNKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGKFTLSIESPGDSFFTIDQQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLINQFYISENKQ-RSLLGVIKATDFDNQTIYYLIDN-KSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS----------LHTASTTVTVVVVDENDNKP--IFKNMNKVIKIDAS--ESPGFKICKIVATDADHGNNGLVKYILK-KSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTF----LDIEACDQGQPNQCTIFSGLEIQWTTNRNEPASR---ESDKSKKSSYDQF------LNENVLIAAISGLLVLMIII 639          

HSP 2 Score: 68.1662 bits (165), Expect = 2.189e-11
Identity = 150/581 (25.82%), Postives = 242/581 (41.65%), Query Frame = 1
Query:  349 EIQIEVIDTNDNIPYWNSDSI---NVEFMDGDLPGIRKTIPTAIDLDSSVFSTIFYNLSDPT-----RFFKLVETADNLYIQNSLMLDSETTS---KFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSAT----------DRDS-GLNGEF--SFRIDSNKIN-------NKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQFAVLENTPKNTLVGFIM-TNDVDFNENDEVFCRSL----NSFFVLNSMSTREQFQIY-TTVIFDREQQDKHFVSIECTDQA-----------YHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYLHEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDE--NTIVYSILNPKNDY---IFLIDKFSGVL------------TTNSYLDREKVDR 1896
            ++ +E+ID NDN P + +DSI     +  +   PG    +  A+D D        + +S  T     + F LV     + I++ +  DS+ T    K  +  +A  P    SS  ++++ I DIND  P  +   + RN   P+   +N  +L  S+T          DRDS GL+     S+ +D++K+N       N+  E+ I+ +       RK   +DR   +   K+  E         S+   + + + DVND  P+        NK +  F + EN P  T++   M  +D D N N + F  S+    +SFF ++     +Q QI  + V FDREQ   H + I   D              H+  +N   +I+    N          FY+ EN     +   K   FD     N  ++Y +   S   F I  H G L    S DREE+ + ++TV   D      ++   + +V++D +DN  +F     V  I  +      +  + A D D   N +V  IL  K+ Y   +F +D  SG L             TN++LD E  D+
Sbjct:   52 QVTVEIIDVNDNPPKF-TDSIFRPEKQVFENSPPGTVILLLKAVDHDFGNNGEFTFRMSPNTSPEVEKHF-LVRPTGEVEIKSKIDYDSDKTHFEFKVIVQDHAVEP-YSLSSEAVVEIDIQDINDEFPTIA--FYPRN---PDSATMNPTILENSSTMTPIGQISVHDRDSKGLDKVHCESYFLDNDKLNPIIAIGTNEPNEFNIVSN-------RK---FDRETES---KLNAEIRCTDTSDHSTVKNLTIIILDVNDNPPEF-------NKGTYHFYIKENEPIGTMLDNRMFVSDKDSNNNGK-FTLSIESPGDSFFTID-----QQNQILKSKVTFDREQVSVHKLKILAIDHGDERLTSSCIVYVHIKDVNDNPVIITPLIN---------QFYISENKQRSLLGVIKATDFD-----NQTIYYLIDNKSQSKFSIEKHSGRLFLQNSLDREEQETHHITVTASDS---LHTASTTVTVVVVDENDNKPIFKNMNKVIKIDASESPGFKICKIVATDADHGNNGLVKYILK-KSSYKEPLFNLDSDSGDLHLAVSLHTIRPIDTNTFLDIEACDQ 580          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000034072.1 (SMESG000034072.1)

HSP 1 Score: 246.899 bits (629), Expect = 3.671e-68
Identity = 234/808 (28.96%), Postives = 390/808 (48.27%), Query Frame = 1
Query:    1 IQTMKCVLLLVNFYFLASKSMLK-FKVDEGVQVGTEIADLTSDFKNLGITTEF-VSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDG-CKIDIQIILGGSLTIH--EIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIRKTIPTAIDLDSSVF--STIFYNLSDPTRF----FKLVETADNLYIQNSLMLDSETTSKFTLHLYASNPGID-RSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPEDIPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIVVRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQIDFYAIQNNKISNQF------AVLEN-TPKNTLVGFIMTNDVDFNENDEVFCRSLN--SFFVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLILXXXXXXXXXXXXSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYL---HEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGFIHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLD------------ENTIVYSILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAMSKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQ-PPEKSIFQ----IYSTDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFSTHVIKLKVCDSGNQPKCT 2301
            I+TM  + LL+      S++M   F++ E   +GT++ ++ S F    I +E+  +V+   +F      I+  +G+ ++   K IDRE +C       N DG C   I++I   +      +++ E++D NDN P W ++ + + + +      +++I  AI  D  +   + I Y L  P       F L  + + L +     +D ET   F + + A + G    SS+L ++VT++DINDN P F + +F  N+ + E   + +++L ++A D+DS  NG  ++ ID + +     + F + S TGE+ ++KPLDYDRG +++ F VI +D A  PY LSS A V + V DVNDEIPQI+ Y      +S+++       + EN  P+ + +  I   D D ++   + C   N  SF +++ ++  + F +  +  FDRE Q    V I C D   + N  N  ++ + D +++P  F    NF + EN        G++ + DKD+  N+++ Y +      S+  F+I++  G +      DREE+   N+TV   D+G    +  G I I++ D++D P VF   ++ F I E++ +N+ VG VQA D D             +   YS+        F I K SG +   S LDRE    Y I + A +   P      +   +     I + D NDN P    P      +N SL     EKSI        +TD+D  +N  L Y +       +F +  TSG++FL        +E F    + ++VCDSG   KC+
Sbjct:   37 IKTMNAIGLLLFILIKYSQTMKNYFRITEEEPIGTDLFEV-SKFLRDKIKSEYRFTVIGDPNFS-ECISIQDKTGMTKI--KKRIDRETLC-----ADNQDGKCVKSIRLIFKNTYRKEGVDLEFEILDINDNRPMWPTNVVELLYPESTE---KQSIKLAIAYDKDIGENAMIKYYLQ-PIYHDNLNFNLENSENRLILTPKFDVDYETKRFFNITIVAEDRGRPVLSSTLNVKVTVIDINDNRPQFIQNVFHPNQAVYETTSVEAIILKVTAIDKDSEQNGRINYYIDPS-MPQFIRDQFFLDSDTGELKLKKPLDYDRGHKSYKFIVIAKDSAPAPYELSSSATVEIQVADVNDEIPQINMY-FTTPFVSDRYNGTVHINIPENMNPQQSDLAHIQIEDTDEDDKSFIDCSLDNKESFRLISDINKVKSFILSASKSFDRENQQTEHVRITCRDNGKNENSKN-IIINVTDKNDNPPKFAHKFNFNVNENTSYRNRDIGQVEAIDKDLGKNAELRYTIINVQPRSDARFRIDSFTGKMYIDAPLDREEQDHYNITVIAVDQGEPSLTGTGNILILVEDINDMPPVFETVEYRFQIPEDASVNSKVGVVQATDRDIGKNARISYHFLSDAFPYSLHRTNAFEKFQIKKDSGEIMITSKLDRETKPSYSIIIEAINVVNP------RKFSATVSATITVLDCNDNAPKFTAP------INNSLISIDTEKSIGTEIALFRATDADENKNAELTYSIVRATDPYVFNLDYTSGILFLAKK-----IEGFRKLRLTVRVCDSGLPQKCS 811          
The following BLAST results are available for this feature:
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y3.410e-5626.38protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y4.083e-5626.38protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y4.083e-5626.38protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y4.996e-5626.38protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X3.215e-5526.98protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.056e-3627.18FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-14.215e-2726.16FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.306e-2424.02CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-42.097e-2325.46Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-11.939e-2124.30Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds2.549e-4125.77gene:FBgn0284247 transcript:FBtr0078045[more]
ds2.549e-4125.77gene:FBgn0284247 transcript:FBtr0343249[more]
ft1.584e-4024.76gene:FBgn0001075 transcript:FBtr0077478[more]
stan3.730e-3925.71gene:FBgn0024836 transcript:FBtr0304900[more]
stan4.796e-3925.58gene:FBgn0024836 transcript:FBtr0304899[more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh118.586e-5528.03protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.270e-5427.17protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh94.810e-5327.28protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh94.810e-5327.28protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh94.919e-5327.24protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047804.11.088e-6028.44protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.11.313e-6027.72protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.11.454e-6027.72protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
vapa5.422e-5528.73VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000039400.12.252e-5127.69pep primary_assembly:Xenopus_tropicalis_v9.1:3:184... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdhgb77.086e-5328.02protocadherin gamma subfamily B, 7 [Source:MGI Sym... [more]
Pcdh11x1.013e-5127.42protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.274e-5127.42protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.455e-5127.42protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x5.317e-5127.42protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6KEQ9|PC11X_PIG7.425e-5827.84Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q9BZA8|PC11Y_HUMAN1.549e-5426.26Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6X862|PC11X_GORGO2.078e-5426.94Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q9BZA7|PC11X_HUMAN8.127e-5426.91Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WXV7|PC11X_PONPY1.184e-5326.86Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Y5433.971e-8933.33Protocadherin 1 OS=Echinococcus multilocularis OX=... [more]
A0A3R7HBN64.154e-8830.14Protocadherin-11 X-linked (Fragment) OS=Clonorchis... [more]
A0A4S2LQP76.663e-8829.57Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y8R97.869e-8730.14Protocadherin-11 X-linked OS=Clonorchis sinensis O... [more]
A0A0R3W2741.003e-8632.19Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh92.038e-5628.24protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh92.691e-5628.24protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh116.153e-5627.88protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh113.221e-5527.61protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh112.977e-5427.20protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.14.162e-5025.76pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh111.837e-4024.79protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.16.323e-3825.15protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.12.563e-3625.04pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006996.19.216e-2925.22pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.661e-4527.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404703.241e-4328.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410052.887e-4125.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348153.016e-3927.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.796e-3827.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.820e-5327.38protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh96.071e-5327.38protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh98.394e-5327.38protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh2aa153.284e-5127.30protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh118.246e-5026.90protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006531.10.000e+0100.00SMESG000006531.1[more]
SMESG000010675.13.846e-10233.13SMESG000010675.1[more]
SMESG000027424.12.775e-9131.32SMESG000027424.1[more]
SMESG000067388.15.770e-7933.08SMESG000067388.1[more]
SMESG000034072.13.671e-6828.96SMESG000034072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015288 ID=SMED30015288|Name=Protocadherin-11 X-linked|organism=Schmidtea mediterranea sexual|type=transcript|length=2657bp
ATTCAAACAATGAAATGCGTGCTTTTATTAGTTAACTTTTATTTCCTTGC
GTCGAAATCTATGTTGAAATTTAAAGTCGATGAAGGAGTTCAAGTTGGCA
CCGAGATTGCAGATTTAACATCCGATTTCAAAAATCTCGGAATTACGACA
GAATTCGTGAGCGTACTAAATCAGCGGGATTTTAAAGTAAGTCATTTTGG
AATTAAATTTGATAGTGGAATTTTGAGATTAATTACACTCAAAAATATCG
ACAGAGAAGTCATTTGTGAATATGAAAAAAACAAGATCAATTCCGACGGG
TGTAAAATTGACATCCAAATAATTTTAGGGGGCTCTTTGACGATTCATGA
AATACAAATTGAAGTAATTGATACCAACGACAACATTCCTTATTGGAACT
CTGACTCGATAAACGTTGAGTTTATGGACGGTGATTTGCCTGGCATCAGG
AAGACAATTCCTACAGCCATTGATCTTGATTCCTCTGTATTTTCGACAAT
CTTTTACAATTTGTCTGACCCAACTCGATTCTTCAAACTTGTTGAGACTG
CAGATAACTTATACATTCAAAACTCTTTAATGTTAGATAGTGAAACTACG
TCCAAATTTACTTTACATTTATACGCATCAAATCCTGGAATTGACAGATC
GAGTTCTCTTCTGATCCAAGTGACAATAGTTGATATAAATGACAATCCTC
CATTATTTTCCAAACCTCTATTTTCTAGAAATGAACCGATTCCCGAAGAT
ATACCGATTAATTCTGTAGTTCTCGTCCTGTCAGCAACCGACCGTGACAG
TGGATTAAATGGAGAATTTTCATTTCGCATTGATTCAAACAAAATAAACA
ATAAAGCCATTGAATACTTTATTATGAAATCTGTCACTGGTGAAATCGTC
GTCCGAAAGCCTCTAGACTACGATAGAGGAATGAGAAATTTCTTTTTCAA
AGTAATCGTTGAAGACCACGCCTTTCTCCCTTATTCTCTTTCATCAGAGG
CTTTTGTGAATCTTACTGTTGGTGACGTAAACGATGAAATACCGCAAATA
GACTTCTATGCCATTCAAAATAATAAAATTTCAAATCAGTTTGCAGTATT
AGAGAATACCCCAAAAAACACATTGGTGGGATTTATAATGACAAATGACG
TAGATTTTAATGAAAATGATGAAGTGTTTTGCAGAAGCTTAAATAGCTTT
TTTGTTTTAAATTCAATGTCAACCAGGGAGCAATTTCAAATTTATACAAC
TGTCATTTTTGATAGGGAACAACAAGATAAACATTTTGTTTCAATTGAAT
GTACGGATCAAGCATATCACATGAATTACATAAATAAAACCTTATTGATA
TTGGATGACAATGACAATGATCCTTACTTCTTTCCGGATTCCTTAAACTT
TTATCTATATGAAAATATGCCTTCCGGAACTATACTCACAGGGAAACTTA
GATCATTCGATAAAGACATTGATAACAATTCCCAAGTTCATTATTATTTA
CATGAAGCTTCAAATAAAGATTTTAAAATTAATACTCACGAAGGTACTTT
AATATCGTTGAGGTCTTTCGATAGAGAGGAAAGAAGTTCTCTAAATCTTA
CTGTTTACGTCGAAGATGAAGGTAATGTTAAAAGGTCTTCAAAAGGATTC
ATTCACATTGTAATACTTGACATGGATGATAATCCTATTGTATTTACAAA
AGACAAATTCGTTTTTCACATTTCTGAAAATTCAGTAATTAATACAGTTG
TTGGCTCAGTCCAGGCCGTGGATCTAGATGAAAATACGATTGTCTACTCT
ATTTTAAATCCGAAAAATGATTATATTTTCTTGATTGATAAATTTAGCGG
AGTTCTAACAACTAATTCTTACTTAGATAGAGAAAAAGTCGACAGATATT
TCATAAAAGTTGTCGCCTTTGATTCGAATATTCCCATAGAAGAAGCCATG
TCTAAAAATAATAAATCTATTGCACTTGTAGAGATAAAAATCGATGATGA
AAATGACAATTTTCCGGTGATTATTTTCCCCAATTTCACTCACAATCGAC
TAAATGCCAGTTTATTTCAGCCGCCTGAAAAAAGTATTTTCCAAATTTAT
TCTACCGATTCCGATTCTGGAGAAAATCAAACGTTAATCTACGGGATGGA
AAATGAAGATTCTCATAAAATTTTCAAAATTCATCGAACTTCCGGATTGG
TTTTTTTGAAAACCGGAAATTCCAATTTAGACGTCGAATATTTTTCAACC
CATGTCATAAAATTAAAGGTTTGCGACAGTGGTAACCAACCAAAATGCAC
AGTGTTTCATCCTCTGTACGTAAACCTAACCTCCGACTACCCTATAAATA
CTCATGTATTGGAAAACACCAAAAAAGAAAAGAAAATATTTACAGCATTC
TGGATATTAACAAGCATTATAACAGTTTCCTTGTTAACTGCTTTTATAAC
CGGAAGTATTTTACTATATCTAAAAATCAGGAGTAATCAAGCCAAAATTA
TCGTCAATATGTTTGAAGACCACAGAAATATAAAACCGAATTGTAGAAGA
AAAAAATTTCAAAACTCATATTCAATTAGCAATTTTGCAAAAATAAAAAT
GAATGAAATTAATCAAGCACAAGACAATTCAATAGAAATATTTTCTACTG
ACAACAT
back to top

protein sequence of SMED30015288-orf-1

>SMED30015288-orf-1 ID=SMED30015288-orf-1|Name=SMED30015288-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=885bp
IQTMKCVLLLVNFYFLASKSMLKFKVDEGVQVGTEIADLTSDFKNLGITT
EFVSVLNQRDFKVSHFGIKFDSGILRLITLKNIDREVICEYEKNKINSDG
CKIDIQIILGGSLTIHEIQIEVIDTNDNIPYWNSDSINVEFMDGDLPGIR
KTIPTAIDLDSSVFSTIFYNLSDPTRFFKLVETADNLYIQNSLMLDSETT
SKFTLHLYASNPGIDRSSSLLIQVTIVDINDNPPLFSKPLFSRNEPIPED
IPINSVVLVLSATDRDSGLNGEFSFRIDSNKINNKAIEYFIMKSVTGEIV
VRKPLDYDRGMRNFFFKVIVEDHAFLPYSLSSEAFVNLTVGDVNDEIPQI
DFYAIQNNKISNQFAVLENTPKNTLVGFIMTNDVDFNENDEVFCRSLNSF
FVLNSMSTREQFQIYTTVIFDREQQDKHFVSIECTDQAYHMNYINKTLLI
LDDNDNDPYFFPDSLNFYLYENMPSGTILTGKLRSFDKDIDNNSQVHYYL
HEASNKDFKINTHEGTLISLRSFDREERSSLNLTVYVEDEGNVKRSSKGF
IHIVILDMDDNPIVFTKDKFVFHISENSVINTVVGSVQAVDLDENTIVYS
ILNPKNDYIFLIDKFSGVLTTNSYLDREKVDRYFIKVVAFDSNIPIEEAM
SKNNKSIALVEIKIDDENDNFPVIIFPNFTHNRLNASLFQPPEKSIFQIY
STDSDSGENQTLIYGMENEDSHKIFKIHRTSGLVFLKTGNSNLDVEYFST
HVIKLKVCDSGNQPKCTVFHPLYVNLTSDYPINTHVLENTKKEKKIFTAF
WILTSIITVSLLTAFITGSILLYLKIRSNQAKIIVNMFEDHRNIKPNCRR
KKFQNSYSISNFAKIKMNEINQAQDNSIEIFSTDN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
IPR001627Semap_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 238..267
score: 25.8
coord: 329..348
score: 42.1
coord: 513..539
score: 30.05
coord: 656..673
score: 38.75
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 36..130
e-value: 0.12
score: 13.3
coord: 699..782
e-value: 0.02
score: 21.1
coord: 379..458
e-value: 0.022
score: 20.7
coord: 260..348
e-value: 1.7E-17
score: 74.1
coord: 154..234
e-value: 4.9E-10
score: 49.3
coord: 483..563
e-value: 5.9E-16
score: 69.0
coord: 587..672
e-value: 3.3E-16
score: 69.9
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 571..664
e-value: 5.9E-13
score: 49.1
coord: 247..340
e-value: 2.3E-8
score: 34.4
coord: 467..555
e-value: 1.4E-11
score: 44.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 21..124
e-value: 1.1E-7
score: 33.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 671..782
e-value: 7.3E-11
score: 44.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 349..455
e-value: 2.6E-9
score: 39.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 562..670
e-value: 3.3E-20
score: 74.6
coord: 231..348
e-value: 5.2E-22
score: 80.4
coord: 456..561
e-value: 2.6E-22
score: 81.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 126..230
e-value: 1.1E-12
score: 50.4
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 10..568
coord: 538..777
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 566..679
score: 22.958
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 696..797
score: 9.213
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 155..236
score: 15.373
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 358..460
score: 11.624
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 18..132
score: 9.476
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 247..350
score: 20.393
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 461..565
score: 21.073
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 247..345
e-value: 6.38214E-21
score: 86.2133
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 464..561
e-value: 4.37762E-20
score: 83.9021
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 24..128
e-value: 1.61983E-4
score: 39.6042
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 690..777
e-value: 4.57605E-10
score: 55.3974
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 363..456
e-value: 5.95305E-10
score: 55.0122
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 570..670
e-value: 7.95267E-23
score: 91.6061
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 155..232
e-value: 4.23291E-10
score: 55.3974
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.602
NoneNo IPR availableTMHMMTMhelixcoord: 801..823
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 224..234
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 668..774
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 343..440
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 553..679
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 230..342
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 450..566
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 120..242