Hexosyltransferase

Overview
NameHexosyltransferase
Smed IDSMED30015286
Length (bp)1091
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hexosyltransferase (SMED30015286) t-SNE clustered cells

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30015286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hexosyltransferase (SMED30015286) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30015286) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015286SMESG000064001.1 Contig2097GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015286SMESG000023690.1 Contig2097GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30015286SMESG000023690.1 dd_Smed_v4_9789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015286SMESG000023690.1 dd_Smed_v4_9789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30015286SMESG000023690.1 Contig38903newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30015286SMESG000023690.1 Contig38903uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30015286SMESG000023690.1 dd_Smed_v4_9789_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 138.272 bits (347), Expect = 2.119e-37
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   58 FLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFV-GLCLER 252          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 138.272 bits (347), Expect = 2.119e-37
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   58 FLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFV-GLCLER 252          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 138.272 bits (347), Expect = 2.119e-37
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   58 FLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFV-GLCLER 252          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 138.272 bits (347), Expect = 2.119e-37
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   58 FLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFV-GLCLER 252          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 138.272 bits (347), Expect = 2.249e-37
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   62 FLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFV-GLCLER 256          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 102.449 bits (254), Expect = 2.500e-24
Identity = 68/231 (29.44%), Postives = 114/231 (49.35%), Query Frame = 3
Query:  210 FTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGS---LKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNF 893
            F   NHT + +I      CS N  L   + S++ NF+ RQ IR+TW +    + + +   R+ FII + S++     +  E +KF D++  D  ++Y+ L LK    L +  + C  A+F  K DDD  +++  L              I G I  N  P+R+K  +W V + +YS + +PPY  G  Y+I + AV  +L  +       I+DVF TG++ +   +  +N+
Sbjct:   64 FKDQNHT-YQFITVPKKQCSNNTKLQITILSTAGNFDIRQAIRETWANPNNSEHVANNDVRISFIISKTSNEFLNFALQKEIEKFDDMIVTDLYESYELLILKVHAILSYKQSHCQLADFQLKIDDDMAVDMDGLYRSLEDKKQASINGISGIIWKNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLEEAKNYNQWIIEDVFWTGVIGKALKIKQINW 293          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 102.449 bits (254), Expect = 2.500e-24
Identity = 68/231 (29.44%), Postives = 114/231 (49.35%), Query Frame = 3
Query:  210 FTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGS---LKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNF 893
            F   NHT + +I      CS N  L   + S++ NF+ RQ IR+TW +    + + +   R+ FII + S++     +  E +KF D++  D  ++Y+ L LK    L +  + C  A+F  K DDD  +++  L              I G I  N  P+R+K  +W V + +YS + +PPY  G  Y+I + AV  +L  +       I+DVF TG++ +   +  +N+
Sbjct:   64 FKDQNHT-YQFITVPKKQCSNNTKLQITILSTAGNFDIRQAIRETWANPNNSEHVANNDVRISFIISKTSNEFLNFALQKEIEKFDDMIVTDLYESYELLILKVHAILSYKQSHCQLADFQLKIDDDMAVDMDGLYRSLEDKKQASINGISGIIWKNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLEEAKNYNQWIIEDVFWTGVIGKALKIKQINW 293          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: C54C8.3 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O02231])

HSP 1 Score: 91.6633 bits (226), Expect = 1.325e-20
Identity = 62/224 (27.68%), Postives = 111/224 (49.55%), Query Frame = 3
Query:  225 HTPFSYI-INETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETT-----RLLFIIG-RPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYF---SRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQ 866
            H  +S++ + E    S+   +L  V S + ++ RR ++R TW  + + NSE       + LF++G  P     +  +M E+K + D++  D  D Y+ LT K +  L +  +  P+ + I K D+D       LT       I+  P   + L ++ S  +  R K  +W V E  YS  K+P Y  G  YM++  A + ++  + Y  ++ ++DVF+TGI+ +
Sbjct:   58 HRNYSWLYLPEIEETSQEKDILIIVASRTDSYARRNILRQTW--MSKANSEIVANGRMKPLFLVGLTPGEYKMKKMVMQEAKLYGDIIVVDMNDNYEELTYKSLAILLYGVSKAPRYQMIGKIDEDVMFFPDKLTELYDQGFIDATPLRIYGL-KMQSGANIFRDKTHRWYVPESSYSCSKFPEYVSGMLYMVTWEAAQQIIKSTKYRDFIQVEDVFLTGILAE 278          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: C47F8.3 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:G5ECA6])

HSP 1 Score: 87.4261 bits (215), Expect = 4.925e-19
Identity = 62/204 (30.39%), Postives = 100/204 (49.02%), Query Frame = 3
Query:  282 LLTYVQSSSINFERRQLIRDTWGSLKQINSETTR-----LLFIIGR-PSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDT-FINIFSLTYFSRINLNPKEKFILGQISSNEHPI-RKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            +L  V S + NF RR ++R TW  + + NSE  +      LF +G  P  Q  +  ++ E++   D+V  D  DTY NL  K +  L +  +   Q + I K DDD  F     L    R  +N     I G +S+ E  + R K   W V E  Y+   YP Y  G  Y++++ A   +L  + +++++ ++D  ITGI+ Q+
Sbjct:   90 ILMLVVSKTKNFARRNVLRSTW--MNKENSEMMKSGRMHALFFVGLVPGDQNLKKLVLEEAEIHGDMVVVDLEDTYDNLPFKTLALLLYGTSKASQFKIIGKIDDDVMFFPDQLLPMLDRNFVNSNTLSIYGHLSTAEELVLRNKTEPWYVPETAYNCTVYPVYVMGPIYLVTKDAASLILDNANHQQFMTVEDALITGIIAQK 291          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: E03H4.11 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O17750])

HSP 1 Score: 87.4261 bits (215), Expect = 6.563e-19
Identity = 59/214 (27.57%), Postives = 104/214 (48.60%), Query Frame = 3
Query:  252 ETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETT-----RLLFIIG-RPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSR---INLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQ 866
            E    S+   +L  V S + ++ RR ++R TW  + + +SE       + LF++G  P     +  +M E+K + D++  D  DTY+ LT K +  L +  +  P+ + I K D+D       LT       I+  P   +   +I +     R K  +W V E  YS  K+P Y  G  YM++  A + ++  + Y  ++ ++DVF+TGI+ +
Sbjct:  107 EIEEASQEKDILMIVASRTDSYARRNIMRQTW--MNKSDSEIVANGRMKPLFLVGLTPGDYKMKKMVMQEAKLYGDIIVVDMNDTYEELTYKSLAILLYGVSKAPRYQMIGKIDEDVIFFPDKLTALYEQGIIDATPLCAYGY-KIQAGARIFRDKNDRWYVPESSYSCSKFPEYVSGMLYMVTWEAAQQIIKSTKYRDFIQVEDVFLTGILAE 317          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0073310)

HSP 1 Score: 118.242 bits (295), Expect = 1.939e-29
Identity = 70/221 (31.67%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  234 FSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTD--QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFI----LGQISSNEHPIRKKGF--KWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRT 872
            F Y+I++   C ++V  L  V S+  N E+R++IR+TW +   I+    ++ F++G  S++++  Q  +  E+    DL+Q +F+D Y+N+T KH++AL W +  C  A+ + K DDD F+N   L  +      P+   +    L    S  H   K+ +  KW V    Y    YP Y  G A + +   VR L   +   KY ++DDV ITGI+ + T
Sbjct:  121 FVYLIDQPA-CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEET 340          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0304987)

HSP 1 Score: 118.242 bits (295), Expect = 1.939e-29
Identity = 70/221 (31.67%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  234 FSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTD--QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFI----LGQISSNEHPIRKKGF--KWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRT 872
            F Y+I++   C ++V  L  V S+  N E+R++IR+TW +   I+    ++ F++G  S++++  Q  +  E+    DL+Q +F+D Y+N+T KH++AL W +  C  A+ + K DDD F+N   L  +      P+   +    L    S  H   K+ +  KW V    Y    YP Y  G A + +   VR L   +   KY ++DDV ITGI+ + T
Sbjct:  121 FVYLIDQPA-CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEET 340          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0113143)

HSP 1 Score: 118.242 bits (295), Expect = 1.939e-29
Identity = 70/221 (31.67%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  234 FSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTD--QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFI----LGQISSNEHPIRKKGF--KWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRT 872
            F Y+I++   C ++V  L  V S+  N E+R++IR+TW +   I+    ++ F++G  S++++  Q  +  E+    DL+Q +F+D Y+N+T KH++AL W +  C  A+ + K DDD F+N   L  +      P+   +    L    S  H   K+ +  KW V    Y    YP Y  G A + +   VR L   +   KY ++DDV ITGI+ + T
Sbjct:  121 FVYLIDQPA-CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEET 340          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0113142)

HSP 1 Score: 118.242 bits (295), Expect = 1.939e-29
Identity = 70/221 (31.67%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  234 FSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTD--QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFI----LGQISSNEHPIRKKGF--KWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRT 872
            F Y+I++   C ++V  L  V S+  N E+R++IR+TW +   I+    ++ F++G  S++++  Q  +  E+    DL+Q +F+D Y+N+T KH++AL W +  C  A+ + K DDD F+N   L  +      P+   +    L    S  H   K+ +  KW V    Y    YP Y  G A + +   VR L   +   KY ++DDV ITGI+ + T
Sbjct:  121 FVYLIDQPA-CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEET 340          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG8668 (gene:FBgn0031988 transcript:FBtr0339671)

HSP 1 Score: 115.931 bits (289), Expect = 4.044e-28
Identity = 78/242 (32.23%), Postives = 125/242 (51.65%), Query Frame = 3
Query:  180 DVSKYCSGENFTFYNHTPFSYIINETTLC---SENVFLLTYVQSSSINFERRQLIRDTW---GSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHV 887
            D SK  + E  T Y        I+   +C    E + LL  + S+  +   R  IR TW   G+ + +      + F++GR +++T    +  E+  + DL++ +F D+Y NLTLK +  L W    CP+A++I KTDDD FIN+  L  F  ++ +  ++ I G+++    PIR K  K+ V  D ++   +P +T G AY+++   V  L V S    YL ++DVF TGIV +   V  V
Sbjct:  307 DPSKGVATE--TLYEPGHVDEEIDAERICPKGGEFIKLLVLISSAMSHDAARMSIRQTWMHYGTRRDVG-----MAFVLGRGTNETINKALTQENFIYGDLIRGNFIDSYNNLTLKTISTLEWADVHCPKAKYILKTDDDMFINVPKLLTF--LDKHKDKRTIYGRLAKKWKPIRNKKSKYYVSVDQFAAGVFPSFTTGPAYVLTGDIVHELYVRSLKTVYLKLEDVFTTGIVAKSLNVKRV 539          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: CR759791.1 (beta-1,3-galactosyltransferase 2-like [Source:NCBI gene;Acc:100537407])

HSP 1 Score: 131.339 bits (329), Expect = 4.632e-35
Identity = 74/228 (32.46%), Postives = 131/228 (57.46%), Query Frame = 3
Query:  234 FSYIINETTLCSEN-VFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIG-RPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEK-FILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFG 908
            + +I++    C +   F++  V  +  N E R  IR TWG+   +  +   +LF++G R  ++T Q+++ NES++  DL+Q+ F+DTY+NLT+K +V + W+   CPQA + +K D D  +N+ +L Y   ++LN  E+ +I G + S  + +R    K+ +  D+Y   +YPPY +G  Y+ S      +L  S + + +FI+D +I G+ L+R  +     +LNFG
Sbjct:   44 YKFILDLPEKCQQQEPFVVIIVPVAPENIEARNAIRTTWGNEGLVRDKIVLVLFLLGSRSGNETLQEQLQNESQQHGDLLQSSFQDTYRNLTVKTLVMMEWLSRKCPQASYAAKVDADVLLNVKNLLYM-LVSLNTLERNYITGLVLSVNNVMRDPSSKFYIPHDVYPRSRYPPYPQGMCYIFSMDLPEKILHISRFVRPIFIEDAYI-GMCLRRLGIRPE--KLNFG 267          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: CR759791.2 (beta-1,3-galactosyltransferase 2-like [Source:NCBI gene;Acc:100537407])

HSP 1 Score: 131.339 bits (329), Expect = 4.632e-35
Identity = 74/228 (32.46%), Postives = 131/228 (57.46%), Query Frame = 3
Query:  234 FSYIINETTLCSEN-VFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIG-RPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEK-FILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFG 908
            + +I++    C +   F++  V  +  N E R  IR TWG+   +  +   +LF++G R  ++T Q+++ NES++  DL+Q+ F+DTY+NLT+K +V + W+   CPQA + +K D D  +N+ +L Y   ++LN  E+ +I G + S  + +R    K+ +  D+Y   +YPPY +G  Y+ S      +L  S + + +FI+D +I G+ L+R  +     +LNFG
Sbjct:   44 YKFILDLPEKCQQQEPFVVIIVPVAPENIEARNAIRTTWGNEGLVRDKIVLVLFLLGSRSGNETLQEQLQNESQQHGDLLQSSFQDTYRNLTVKTLVMMEWLSRKCPQASYAAKVDADVLLNVKNLLYM-LVSLNTLERNYITGLVLSVNNVMRDPSSKFYIPHDVYPRSRYPPYPQGMCYIFSMDLPEKILHISRFVRPIFIEDAYI-GMCLRRLGIRPE--KLNFG 267          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: CABZ01072312.1 (beta-1,3-galactosyltransferase 2-like [Source:NCBI gene;Acc:100333524])

HSP 1 Score: 130.954 bits (328), Expect = 7.702e-35
Identity = 74/228 (32.46%), Postives = 131/228 (57.46%), Query Frame = 3
Query:  234 FSYIINETTLCSEN-VFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIG-RPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEK-FILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFG 908
            + +I++    C +   F++  V  +  N E R  IR TWG+   +  +   +LF++G R  ++T Q+++ NES++  DL+Q+ F+DTY+NLT+K +V + W+   CPQA + +K D D  +N+ +L Y   ++LN  E+ +I G + S  + +R    K+ +  D+Y   +YPPY +G  Y+ S      +L  S + + +FI+D +I G+ L+R  +     +LNFG
Sbjct:   44 YKFILDLPEKCQQQEPFVVIIVPVAPENIEARNAIRTTWGNEGLVRDKIVLVLFLLGSRSGNETLQEQLQNESQQHGDLLQSSFQDTYRNLTVKTLVMMEWLSRKCPQASYAAKVDADVLLNVKNLLYM-LVSLNTLERNYITGLVLSVNNVMRDPTSKFYIPHDVYPRSRYPPYPQGMCYIFSMDLPEKILHISRFVRPIFIEDAYI-GMCLRRLGIRPE--KLNFG 267          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3galt1a (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-120215-203])

HSP 1 Score: 130.954 bits (328), Expect = 8.804e-35
Identity = 69/214 (32.24%), Postives = 116/214 (54.21%), Query Frame = 3
Query:  234 FSYIINETTLC-SENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTY-FSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            F ++INE   C S   FL+  + ++   F+ RQ IR+TWG     ++     LF++G  +       +  ES+ F D++  DF D+Y NLTLK ++ + W+  FCP A+++ KTD D F+N+ +L +   R N  P+ +F  G +  N  PIR    KW +  ++Y   +YPP+  G  Y+ S      L   S + + L ++DV++ G+ L++
Sbjct:   65 FKFLINEPKKCESTTPFLVLLISTNHKEFDARQAIRETWGDENTFSNVHILTLFLLGYSTEPVLNQMVEQESQIFHDILVEDFVDSYHNLTLKTLMGMRWVSLFCPNAQYVMKTDSDIFVNMDNLVFNLLRPNAKPRRRFFTGHV-INGGPIRDVHSKWFMPRELYPDSRYPPFCSGTGYVYSGDMAELLYKTSLHTRLLHLEDVYV-GLCLRK 276          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 132.88 bits (333), Expect = 1.172e-34
Identity = 82/245 (33.47%), Postives = 135/245 (55.10%), Query Frame = 3
Query:  204 ENFTFYNHTP-FSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSS---QTDQDKIMN-ESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLL-VCSYYEKYLFIDDVFITGI--VLQRTYVHHVNFQLNFGYI 914
            + F  Y H   F  +IN    CS  + LL  ++S    F+RR++IR TWG  + +N +  + LF++G+ S+   + +  K++  E   + D++Q DF D++ NLTLK +  L W  ++CP+ ++I K DDD F+++ ++  +  I+ N K+ F+ G +     PIRKK  K+ + + +Y+   YPPY  G  +++  A  R L   C   E Y  IDDVF+     VLQ T + H  F+  FG +
Sbjct:  128 KQFLLYRHCRYFPMLINHPEKCSGEIDLLIVIKSVITQFDRREVIRKTWGKEQVLNGKRIKTLFLLGKSSNLEERANHQKLLEYEDYIYGDILQWDFMDSFFNLTLKEIHFLKWFSSYCPKTQYIFKGDDDVFVSVPNIFEYLEISGNLKDLFV-GDVLFKAKPIRKKQNKYYIPQALYNKTLYPPYAGGGGFLMDGALARKLYGACETLELYP-IDDVFLGMCLEVLQVTPIKHNAFK-TFGLV 369          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: B3GNT4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:NCBI gene;Acc:100491670])

HSP 1 Score: 143.28 bits (360), Expect = 6.534e-39
Identity = 85/240 (35.42%), Postives = 127/240 (52.92%), Query Frame = 3
Query:  210 FTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMN----ESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH---HVNFQLNFG 908
            F  Y H      + + + C ++ FLL  ++S  IN ERR  IR+TWG  + I S+  +LLF++G+  S      +      ES +F+DL+Q DF D + NLTLK +  L W++  C  A+F+ K DDD FIN F++  F    LNP +   +G + +N  PIR    K+ +   MYS   YP Y  G  Y++S+   + LL  +       IDDVF+ G+ L++  V    H  F+  FG
Sbjct:   80 FLMYKHCRNFSTLLKPSKCEKDTFLLLAIKSLPINIERRIAIRNTWGKQQDIQSKKIKLLFLLGKTDSTLPAKSLRQLLSYESIEFKDLIQWDFVDNFFNLTLKEIHLLRWLNKECSHAKFVLKGDDDVFINTFNIVEFLD-GLNPDKDLFVGDVITNAVPIRNTKVKYFIPHSMYSAPHYPLYAGGGGYVMSRKTTKGLLSSAETTDLFPIDDVFV-GMCLEKINVKPQFHAGFK-TFG 316          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: b3gnt5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:NCBI gene;Acc:394849])

HSP 1 Score: 133.265 bits (334), Expect = 5.254e-35
Identity = 83/233 (35.62%), Postives = 130/233 (55.79%), Query Frame = 3
Query:  234 FSYIINETTLC-SENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSE---TTRLLFIIG-----RPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQ-AAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYV---HHVNF 893
            + Y+IN    C +E+V LL +V++S  N  RR  IR TWG+   I S+     +++F +G       S QT +D ++ E+K+F DL+Q DF+DT+ NLTLK ++   W++++CP A+FI   DDD F++  +L  + +      + F +G++     PIR K  K+ V  +MY    YP YT G AY++S+  A +           L+IDDVF+ GI   +  V   +HV F
Sbjct:   72 YRYLINNRDKCQNEDVLLLLFVKTSPENRRRRNAIRKTWGNEDYIRSQYAANIKVVFALGIEADPVKSHQTQKDLVI-ENKRFNDLIQQDFKDTFHNLTLKLLLQFGWVNSYCPSAKFIMSADDDIFVHTPNLVSYLKSLPIETQDFWIGRVHRGSPPIRSKTSKYYVPYEMYPWSSYPDYTAGAAYVVSKDVAAKVYEASQTLNTSLYIDDVFM-GICANKMGVVPQYHVYF 302          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: tcp11l1 (t-complex 11, testis-specific-like 1 [Source:Xenbase;Acc:XB-GENE-5887205])

HSP 1 Score: 132.109 bits (331), Expect = 5.419e-35
Identity = 70/222 (31.53%), Postives = 118/222 (53.15%), Query Frame = 3
Query:  222 NHTPFSYIINETTLCSEN-VFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTY-FSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH 881
            N   F ++INE   C ++  FL+  + ++   F+ RQ IR+TWG+           LF++G+ S       +  ES+ F D+V  DF D+Y NLTLK ++ + W+  FC +A++I KTD D F+N+ +L Y   +    P+ ++  G +  N  PIR    KW +  D+Y    YPP+  G  Y+ S      +   S + + L ++DV++ G+ L++  +H
Sbjct:   57 NPHSFEFVINEPEKCGKDGPFLVILISTTHKEFDARQAIRETWGNESNFKGIKIVTLFLLGKNSDPVLNQMVEQESQIFHDIVVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYIMKTDSDIFVNMDNLIYKLLKPTTKPRRRYFTGYV-INGGPIRDVRSKWYMPRDLYPESNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 276          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000049063.1 (Beta-1,3-galactosyltransferase 4 [Source:NCBI gene;Acc:100489366])

HSP 1 Score: 129.028 bits (323), Expect = 1.083e-33
Identity = 72/207 (34.78%), Postives = 111/207 (53.62%), Query Frame = 3
Query:  231 PFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKY-PPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFI 848
            P + +++    CS    LL  V S+  + ERR  IR TWGS   ++S+     F++G P S  DQ  ++ E+K   D++QA F D+Y+NLT+K +V L W+   C  A F+ KTDDD F+N FSL+ + +    P     LG++    +P R    +     D+Y PEKY  PY  G  Y++S   V  LL  +     + ++DV++
Sbjct:   64 PPAILLSPPKACSPAPMLLILVSSAPFHHERRNAIRQTWGSSSNLDSQAVTF-FVLGVPQSHNDQAALLEEAKIHGDIIQAAFNDSYRNLTMKTLVGLSWMSQRCHGARFLLKTDDDVFVNTFSLSRYLQGQHGP---LYLGRVHWKVYPNRDPDSRHYTSTDIY-PEKYFSPYCSGTGYILSHEVVEWLLQQTGKSPIIPLEDVYV 265          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: pja2 (praja ring finger 2, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-966471])

HSP 1 Score: 128.257 bits (321), Expect = 3.242e-33
Identity = 86/248 (34.68%), Postives = 127/248 (51.21%), Query Frame = 3
Query:  237 SYIINETTLCS-ENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFS----LTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGYIFLDKENITANAMDYIYI 965
            SY+I E  LCS  +VFLL  V SS  N  RR  IR TWG++          +F +GRP+S+  Q +++ ES+  +D+V+A F DTY+N TLK + ++ WI  FCP A FI K D + F+N+ S    L+Y   +    ++ +I G++     P R+      V    Y    YP Y  G A +ISQ   R + + S  E  L   DVF+ G+  ++  V  V+        F   ++IT N   Y +I
Sbjct:   72 SYVIREEGLCSGRDVFLLMVVSSSPENKTRRDTIRRTWGNMTNYKDLVVVRMFALGRPTSEETQAELLVESQVHKDMVEASFLDTYENRTLKVITSMEWIVTFCPNARFILKVDQEAFVNVESLVDYLSYLLTLERRSEDVYI-GRVIHQGVPDREPKSLHFVPTSSYPDAFYPDYCSGTALVISQDVARKVYLVSKDETTLLPPDVFL-GMCARKAGVVPVHSSR-----FSGPKHITYNRCCYRFI 312          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt1 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1349403])

HSP 1 Score: 134.42 bits (337), Expect = 5.729e-36
Identity = 73/236 (30.93%), Postives = 126/236 (53.39%), Query Frame = 3
Query:  204 ENFTFYN--------HTPFSYIINETTLCSENV-FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTY-FSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH 881
            +NFTF N        H+ F ++INE   C +N+ FL+  + ++   F+ RQ IR+TWG            LF++G+ +       +  ES+ F D++  DF D+Y NLTLK ++ + W+  FC +A+++ KTD D F+N+ +L Y   + +  P+ ++  G +  N  PIR    KW +  D+Y    YPP+  G  Y+ S      +   S + + L ++DV++ G+ L++  +H
Sbjct:   46 KNFTFGNIRTRPINPHS-FEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYV-INGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt1 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1349403])

HSP 1 Score: 134.42 bits (337), Expect = 5.729e-36
Identity = 73/236 (30.93%), Postives = 126/236 (53.39%), Query Frame = 3
Query:  204 ENFTFYN--------HTPFSYIINETTLCSENV-FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTY-FSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH 881
            +NFTF N        H+ F ++INE   C +N+ FL+  + ++   F+ RQ IR+TWG            LF++G+ +       +  ES+ F D++  DF D+Y NLTLK ++ + W+  FC +A+++ KTD D F+N+ +L Y   + +  P+ ++  G +  N  PIR    KW +  D+Y    YPP+  G  Y+ S      +   S + + L ++DV++ G+ L++  +H
Sbjct:   46 KNFTFGNIRTRPINPHS-FEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYV-INGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 278          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt5 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 [Source:MGI Symbol;Acc:MGI:2136878])

HSP 1 Score: 130.954 bits (328), Expect = 6.012e-35
Identity = 68/197 (34.52%), Postives = 106/197 (53.81%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG    +  +  R  F++G   S  + D    ES++ RD++Q DF+D Y NLTLK M+ + W+++FCPQ  ++ KTD D F+N+  LT    +  N   +F  G I  ++ PIR+K  KW V +  Y  ++YPP+  G  Y+ S      +   S    ++ ++DVF+ G+ L +
Sbjct:   56 FLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTEL-LLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFV-GLCLAK 250          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt5 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 [Source:MGI Symbol;Acc:MGI:2136878])

HSP 1 Score: 130.954 bits (328), Expect = 6.012e-35
Identity = 68/197 (34.52%), Postives = 106/197 (53.81%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG    +  +  R  F++G   S  + D    ES++ RD++Q DF+D Y NLTLK M+ + W+++FCPQ  ++ KTD D F+N+  LT    +  N   +F  G I  ++ PIR+K  KW V +  Y  ++YPP+  G  Y+ S      +   S    ++ ++DVF+ G+ L +
Sbjct:   56 FLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTEL-LLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFV-GLCLAK 250          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:MGI Symbol;Acc:MGI:2680208])

HSP 1 Score: 130.954 bits (328), Expect = 1.835e-34
Identity = 79/237 (33.33%), Postives = 120/237 (50.63%), Query Frame = 3
Query:  210 FTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQ-INSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR---TYVHHVNFQLNFG 908
            F  Y H     I+ E + C+ + FLL  ++S   + E+R  IR TWG           +L+F++G          ++ ES +F D++Q DF + + NLTLK +    WI   C QA FI K DDD FI++ ++  F     +P + F++G +     P R    K+ +   MY    YPPY  G  Y++SQA VR L +     +   IDDVF+ G+ L++   T +HH  F+  FG
Sbjct:   70 FLTYRHCRNFSILLEPSECARDTFLLLVIKSQPAHIEQRSAIRSTWGRAGSWARGRQLKLVFLLGVAGPVPPAQLLVYESWQFDDILQWDFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFLE-GWDPAQDFLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAMEEAELFPIDDVFV-GMCLRKLGVTPIHHAGFK-TFG 303          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9N293|B3GT5_GORGO (Beta-1,3-galactosyltransferase 5 (Fragment) OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT5 PE=3 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 6.322e-37
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   58 FLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESRRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSESVPYIKLEDVFV-GLCLER 252          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9N295|B3GT5_PANTR (Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan troglodytes OX=9598 GN=B3GALT5 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 8.812e-37
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   58 FLVLLVTSSHRQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSESVPYIKLEDVFV-GLCLER 252          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9Y2C3|B3GT5_HUMAN (Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.018e-36
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   58 FLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFV-GLCLER 252          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9N294|B3GT5_PANPA (Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan paniscus OX=9597 GN=B3GALT5 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.192e-36
Identity = 72/197 (36.55%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            FL+  V SS      R  IR TWG  + +  +  +  F++G  SS  +  ++  ES++  D++Q DF D Y NLTLK M+ + W+H FCPQA F+ KTD D FIN+  LT    +  N   +F  G +  NE PIR+   KW V +  Y  ++YPP+  G  Y+ S      +   S    Y+ ++DVF+ G+ L+R
Sbjct:   58 FLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDGYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTEL-LLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSESVPYIKLEDVFV-GLCLER 252          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q6DE15|B3G5B_XENLA (Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase B OS=Xenopus laevis OX=8355 GN=b3gnt5-b PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.927e-36
Identity = 94/266 (35.34%), Postives = 143/266 (53.76%), Query Frame = 3
Query:  141 NQENFINPDLN-DEDVSKYCSGENFTFYNHTPFSYIINETTLC-SENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSE---TTRLLFIIGR-----PSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSL-TYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQ-AAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYV---HHVNF 893
            N  NF+N  L+   D S   +G          + Y+IN    C +E+V LL +V+++  N  RR  IR TWG+   I S      +++F +G       S  T QD ++NE+K+F+DL+Q DF DT+ NLTLK ++   W+++FCP A+FI   DDD F++  +L TY   + +  ++ F +G++     PIR K  K+ V  +MY    YP YT G AY++S+  A +           L+IDDVF+ GI   +  V   +HV F
Sbjct:   50 NSYNFVNDSLSVPRDRSDGAAG----------YRYLINNRHKCLNEDVLLLLFVKTAPENRRRRNAIRKTWGNEDYIRSRYAANIKVVFALGVERDPVKSHHTQQD-LVNENKRFKDLIQQDFSDTFHNLTLKLLLQFGWVNSFCPSAKFIMSADDDIFVHTPNLVTYLKSLPIETQD-FWIGRVHRGSPPIRSKASKYYVPYEMYPWSSYPDYTAGAAYVVSRDVAAKVYEASQTLNTSLYIDDVFM-GICANKMGVVPQYHVYF 302          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A267FYC5 (Hexosyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027891g3 PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 4.940e-47
Identity = 89/279 (31.90%), Postives = 149/279 (53.41%), Query Frame = 3
Query:  186 SKYCSG---ENFTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKG--FKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGYIFLDKENITANAMDYIYIVG-RNIVLPTQWEK 1004
            +K C+G   ++F       F+Y+ NE  LC+  + LLT V S++ NF RR  IR TWGSL+ + +   +L+F +G P +   Q +I  ES++ RD+VQ D+R+ Y+N++LKH+    W+   C  A++++K DDDTF ++  L  F  +  +P + F        +    ++G   KW V    ++  +YP Y +GF Y +  + +  L +CS + K+ +IDDV++TG++     V    F    GY        +   +DYI++V   N  L   W +
Sbjct:  169 AKACAGARAKSFVLRYVQNFAYVHNEPDLCAGQLLLLTAVHSNAKNFNRRATIRRTWGSLRYVGANRLQLVFFLGLPGNPEHQAEIDAESRRHRDIVQLDYREHYRNMSLKHLSVYEWMILHCQSAQYLAKVDDDTFTDVVHLAAF--LQHSPPDGFYCSNTRGAKPQRLRRGPKAKWAVNRAEFAAARYPAYCEGFGYAVRASRLPDLYLCSLFSKFFWIDDVYVTGVLAAAAKVPLAGFWAGHGYTGQLPSLASEKILDYIFLVADHNEFLEVVWHR 445          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A267EPS1 (Hexosyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027891g1 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.390e-46
Identity = 89/279 (31.90%), Postives = 147/279 (52.69%), Query Frame = 3
Query:  186 SKYCSGEN---FTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKG--FKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGYIFLDKENITANAMDYIYIVG-RNIVLPTQWEK 1004
            +K C+G     F       F+Y+ NE  LC+  + LLT V S++ NF RR  IR TWGSL+ + +   +L+F +G P +   Q +I  ES++ RD+VQ D+R+ Y+N++LKH+    W+   C  A++++K DDDTF ++  L  F  +  +P + F        +    ++G   KW V    ++  +YP Y +GF Y +  + +  L +CS + K+ +IDDV++TG++     V    F    GY        +   +DYI++V   N  L   W +
Sbjct:  170 AKACAGARANPFVLRYVQNFAYVHNEPDLCAGQLLLLTAVHSNAKNFNRRATIRRTWGSLRYVGANRLQLVFFLGLPGNPEHQAEIDAESRRHRDIVQLDYREHYRNMSLKHLSVYEWMILHCQSAQYLAKVDDDTFTDVVHLAAF--LQHSPPDGFYCSNTRGAKPQRLRRGPKAKWAVNRAEFAAARYPAYCEGFGYAVRASRLPDLYLCSLFSKFFWIDDVYVTGVLAAAAKVPLAGFWAGHGYTGQLPSLASEKILDYIFLVADHNEFLEVVWHR 446          
BLAST of Hexosyltransferase vs. TrEMBL
Match: C3Y7X5 (Hexosyltransferase (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_207854 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.620e-44
Identity = 82/224 (36.61%), Postives = 130/224 (58.04%), Query Frame = 3
Query:  213 TFYNHTPFSYIINETTLC-SENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLT-YFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYV 878
            T  N  P+++ +N    C ++NVFLL  V +S  NF++RQ IRDTWG+   +N    + +F +G   + T Q+ +  E    RD++Q DF D+Y+NLTLK ++   W   +C QA ++ KTDDD F+N+  L  +  +++ N   +F+ G +  +  PIR    KW V ++ Y  + YP Y  G AY+IS+   + L   S   +YLFI+DV++ GI L++  V
Sbjct:    7 TILNPHPYTFTLNIPDKCKNDNVFLLIVVTTSPANFDQRQAIRDTWGNESNVNGVIIKRVFAVGMVDNSTVQEDLEREHGVHRDIIQEDFLDSYRNLTLKAVMVWKWAFQYCSQASYVMKTDDDAFVNVHKLVNHLGQLSANASRRFVTGHVYVDTEPIRDPASKWFVTKEEYPRDTYPSYPCGCAYVISKDLTKLLFETSLVTEYLFIEDVYL-GICLEKLGV 229          
BLAST of Hexosyltransferase vs. TrEMBL
Match: V4AM00 (Hexosyltransferase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_116475 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.654e-44
Identity = 88/247 (35.63%), Postives = 139/247 (56.28%), Query Frame = 3
Query:  261 LCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEK-FILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGYIFLDKENITANAMDYIYIVGRNIVLPTQW 998
            +C +N+F+L +V SS  N + R  IR TWG  K  N +  R +F++G P + T Q  I+ E++K++D+VQ DF+D+Y+NLT KH++ L W    CP   +I KTDDDT +N+F++  +  +N   + K F+   I + + P R    KW V    Y   KYP Y +GFAY+++      LL  S   K  +IDDV++TGI+     V  +    N  +  + KEN+ A+  + ++I+ R   +   W
Sbjct:    1 MCKQNLFILAFVHSSPNNVKERNQIRLTWGGDKTFNGKDFRTVFMLGDPLNSTIQRIIVEEARKYKDIVQGDFKDSYRNLTYKHIMGLSWTIRNCPNVRYILKTDDDTMVNVFNMMEY--LNFTEQNKNFLYCSIFTVQTPFRFFT-KWLVSILEYPFAKYPYYCQGFAYLMTPDVAEKLLNASECAKMFWIDDVYVTGILNVYANVPFLQMTSNHSFTIMKKENLGASVKNVMFILSRKKRMRESW 244          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A1S3JJW5 (Hexosyltransferase OS=Lingula unguis OX=7574 GN=LOC106173915 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.218e-44
Identity = 86/241 (35.68%), Postives = 140/241 (58.09%), Query Frame = 3
Query:  201 GENFTFYNHTPFSYIINETTLCSE----NVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFIL--GQISSNEHPIRKKGF----KWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNF 893
            GEN  + +  P+ Y++N   +C++    ++FL+  V S    F+RR L+R TWGS K +N    R ++I+G  ++   Q K+  E  ++ DLVQ DFRD+Y NLT+K ++ L W   FCP+A+F+ KTDDD F+N   L  + + +L P+++ +L  G I+ N HP+R   +    KW V  + Y  E YPPY  G AY++S  A + +   S    +  ++DVF+ GI   +T ++  ++
Sbjct:   60 GENRLWIHTRPYQYLMNIEKVCAKSNVRDLFLIVLVLSRPDGFKRRHLVRTTWGSPKTVNGTEIRTVYILGGSNNTNTQQKLQEEQAQYGDLVQIDFRDSYDNLTVKTVMGLRWASTFCPRAKFVMKTDDDMFVNYMLLVQYLK-DLTPQDQELLYAGSINGNLHPVRVAEYVSEKKWVVPVEEYPDEDYPPYCSGGAYVLSGRAAKSIYETSKTTPFFRMEDVFV-GICANKTRIYPTDY 298          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:103046152])

HSP 1 Score: 140.969 bits (354), Expect = 1.727e-38
Identity = 72/220 (32.73%), Postives = 119/220 (54.09%), Query Frame = 3
Query:  234 FSYIINETTLC-SENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTY-FSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHV 887
            F ++INE + C  +  FLL  + ++   F+ RQ IR+TWG     +      LF++G  S       +  ES+ F D++  DF D+Y NLTLK M+ + W+ +FCP A ++ KTD D F+N+ +L     R N  P+++F  G +  N  PIR    KW +  +MY   KYPP+  G  Y+ S      +   S + + + ++DV++ G+ L++  +H +
Sbjct:   66 FRFLINEPSKCEGDPPFLLILISTNHKEFDARQAIRETWGEENMYSDIRIVTLFLLGHNSEPVLNQMVEQESQIFHDIIVEDFEDSYHNLTLKTMMGMRWVSSFCPNAHYVMKTDSDIFVNMDNLVLNLLRPNAKPRQRFFTGHV-INGGPIRDTRSKWYMSREMYPESKYPPFCSGTGYVFSGDMAELIFKTSLHTRLIHLEDVYV-GLCLRKLGIHPI 283          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:NCBI gene;Acc:103046404])

HSP 1 Score: 139.813 bits (351), Expect = 4.800e-38
Identity = 73/218 (33.49%), Postives = 118/218 (54.13%), Query Frame = 3
Query:  234 FSYIINETTLCSENV-FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTY-FSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH 881
            F +IINE   C  NV FL+  + ++   F+ RQ IR+TWG     +      LF++GR +       +  ES+ F D+V  DF D+Y NLTLK ++ + W+  FC QA+++ KTD D F+N+ +L Y   +    P+ ++  G +  N  PIR    KW +  D+Y   KYPP+  G  Y+ S      +   S + + L ++DV++ G+ L++  +H
Sbjct:   67 FDFIINEPKKCETNVPFLVILISTTHKEFDARQAIRETWGDESTFSDLRIITLFLLGRSTDSVLNQMVEQESQIFHDIVVEDFVDSYHNLTLKTLMGMRWVATFCNQAKYVMKTDSDIFVNMDNLVYKLLKPATKPRRRYFTGYV-INGSPIRDMRSKWYMPRDLYPESKYPPFCSGTGYVFSADVAELIYKTSLHTRLLHLEDVYV-GVCLRKLGIH 282          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt5b (lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase B [Source:NCBI gene;Acc:103033521])

HSP 1 Score: 140.584 bits (353), Expect = 6.108e-38
Identity = 82/226 (36.28%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  201 GENFTFYNHTPFSYIINETTLCS-ENVFLLTYVQSSSINFERRQLIRDTWGS---LKQINSETTRLLFIIG---RPSSQTD-QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLT-YFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQ-AAVRPLLVCSYYEKYLFIDDVFI 848
            GE   F +H    Y+IN    C+  +V LL +V+SS  NFERRQ IR TWG+   +++    + R++F +G    PS +   Q+ +  E +K+ DL+Q DF DT+ NLT+K ++ L W H +C  A+F+   DDD F+++ +L  Y   +  +  + F +G++     PIR+K  K+ V E+MY    YP YT G  Y++S+  A R           L+IDDVF+
Sbjct:   65 GEARRFSDH---QYLINHEQKCTNRDVLLLLFVKSSPENFERRQAIRSTWGNEAYIERTLGVSVRVVFALGLHPSPSQRKKLQEMLHQEDEKYNDLIQQDFLDTFHNLTIKLLLQLGWTHAYCSNAQFLMSADDDIFVHMPNLIHYLQEVRRSGVKDFWVGKVHRGAPPIRRKDSKYYVSEEMYPWSMYPDYTPGAGYVVSKDVAARVYEASLTLNASLYIDDVFM 287          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: si:ch211-250e5.2 (beta-1,3-galactosyltransferase 2-like [Source:NCBI gene;Acc:111197654])

HSP 1 Score: 129.028 bits (323), Expect = 1.035e-33
Identity = 71/215 (33.02%), Postives = 116/215 (53.95%), Query Frame = 3
Query:  234 FSYIINETTLCS-ENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTD--QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            + +I++E   C  EN FL+  V  +    E R  IR TWG+   +  +T  +LF++G P  +T+  Q+++  ES+K+ DL+Q+DF DTY NLT+K MV + W+   CPQA +  K D D F+N+ ++         P+  +I G +  N   IR    KW V +++Y  + YP Y  G  Y+ S    + L+  S   +   I+D ++ G  L++
Sbjct:  110 YHFILDEPDKCKQENPFLVLMVPVAPHELEARNAIRSTWGNETVVQGKTVTVLFLVGLPGIKTEKQQEELNLESQKYHDLIQSDFMDTYLNLTIKTMVIMDWLATRCPQAAYSMKVDSDMFLNLDNMMNLLLAPETPRINYITGMVMWNRPVIRDPASKWYVPQELYPEDYYPTYLLGMGYIFSNDLPKKLVEVSKDIQPFNIEDAYV-GTCLKK 323          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt5a (lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A-like [Source:NCBI gene;Acc:103022371])

HSP 1 Score: 124.79 bits (312), Expect = 4.059e-32
Identity = 78/232 (33.62%), Postives = 117/232 (50.43%), Query Frame = 3
Query:  234 FSYIINETTLCSE-NVFLLTYVQSSSINFERRQLIRDTWGSLKQINSE---TTRLLFIIGRPSSQTDQD----KIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLT-YFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMIS-QAAVRPLLVCSYYEKYLFIDDVF--ITGIVLQRTYVHHVNF 893
            F Y+ N  + C++ +V LL +V++S  NF RRQ IR TWG+   I SE     +++FI+G    Q  +D    K+  E +   DLVQ  F DT+ NLT+K ++   W H +C  A F+   DDD FI++ +L  Y   ++    +   +G +     P+R+K  K+ V   MY    YP YT G  Y++S   A +           L IDDVF  +  I +  +   HV F
Sbjct:   73 FPYLFNPKSTCADSDVLLLLFVKTSPENFRRRQAIRSTWGNQTYIRSELGVAVKVMFIMGVHPEQHKRDALQRKLHAEDQDHGDLVQQAFSDTFHNLTVKLLLQFRWAHAYCAHARFLMSADDDIFIHMPNLVRYLQDLSKQNVQDLWVGHVHRGSPPVRRKESKYYVPFQMYQWASYPDYTAGAGYVVSGDVAAKIYQATLSLNASLHIDDVFMGMCAITMGVSPQEHVYF 304          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 132.88 bits (333), Expect = 7.815e-37
Identity = 79/225 (35.11%), Postives = 115/225 (51.11%), Query Frame = 3
Query:  234 FSYIINETTLCSENV-FLLTYVQSSSINFERRQLIRDTWGSLK-QINSETTRLLFIIGRPSSQTD-QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYF----SRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHV 887
            F Y++NE   C     FL+  V S S  FE R+ IR+TW S    +   + R LF++G  S  +D Q +I  ES++  DL+Q +F D Y NLTLK M+ LHW+   CP A ++ KTD D F+N+  L        R  + P++ F  G +     P R    KW + EDMY    YP +  G  Y++S      L   S   + L ++DV++ G+ L+   V  V
Sbjct:    1 FRYLLNEPDTCRPRAPFLVVLVASESTEFEAREAIRETWASESVALRGVSFRRLFLLGTASPASDAQRRIEEESRRHGDLIQQNFTDAYDNLTLKTMMGLHWVSVHCPHASYVMKTDSDMFVNLEVLVKAVLEQQRRRVPPRDYFT-GYVMRGFLPNRNPASKWYMPEDMYPGATYPTFCSGTGYVMSATLASRLYRASLAIRRLRLEDVYV-GVCLESLGVEPV 223          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3gnt2a (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2a [Source:ZFIN;Acc:ZDB-GENE-090312-192])

HSP 1 Score: 118.627 bits (296), Expect = 2.509e-30
Identity = 78/232 (33.62%), Postives = 122/232 (52.59%), Query Frame = 3
Query:  198 SGENFTFY-NHTPFSYIINETTLCS-ENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMN----ESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINI-FSLTYFSRINLNPK-EKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQR 869
            S  +F  Y N   F  +I++   C+    FLL  ++S   +F+RRQ IR++WG+    N  T R +F++GRP++   +  + +    ESK++ D++Q DFRD++ NLTLK ++ L W+   C    FI K DDD F+N   ++   S I    K +   LG +  N  P R K  K+ + E ++    YPPY  G  Y+ S    R +   S       IDDV++ G+ L+R
Sbjct:  123 SFRDFLLYQNCQTFPQLIDQPRKCAGHRPFLLFAIKSVIAHFDRRQAIRESWGAETSGNV-TVRRVFLLGRPANPDLEPNLQHLLDLESKRYSDILQWDFRDSFFNLTLKELLFLKWVEQRCSDVRFIFKGDDDVFVNTDRTVALLSNITAPDKVQNLFLGDVIVNAGPHRDKKVKYYIPESVFE-GAYPPYAGGGGYVYSGEMARRIHQVSRQVMQFPIDDVYV-GMCLRR 351          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GALT4 (beta-1,3-galactosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:919])

HSP 1 Score: 113.62 bits (283), Expect = 8.454e-29
Identity = 67/218 (30.73%), Postives = 107/218 (49.08%), Query Frame = 3
Query:  240 YIINETTLCSENV--FLLTYVQSSSINFERRQLIRDTWGSLKQINSET----------TRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLT---YFSRINLNPKEK----------------FILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLL 800
            ++ +   LC      FLL  V S+  +  RR+ IR+TWG ++++   +           R++F++G   S   +  + NES + RD+VQA+F DTY+NLTLK M  L W  + CP   F+ K DDD F+N  SL    + +    +P ++                  LG++ S   P R    K  V ++ +  + Y PY  G AY++S +A R +L
Sbjct:   61 FLSSPGELCRPGAEPFLLICVASAPEHRSRREAIRETWGGVRKVAVASPGGGGGRALDVRVVFVLGVTRSDRTRASVQNESVERRDIVQAEFLDTYRNLTLKTMATLQWFVSRCPGVRFLLKADDDVFVNPHSLVEHLHDAHGPASPADEDYGKGGGVGGGEGGHDLYLGRVHSRVRPNRDPASKAFVSDERFPGDHYAPYCSGTAYVLSGSAARKVL 278          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 111.309 bits (277), Expect = 3.076e-28
Identity = 64/203 (31.53%), Postives = 101/203 (49.75%), Query Frame = 3
Query:  273 NVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKI------MNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEK-----FILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFI 848
            NV LL  ++S + N ERR +IR TWG    +     R +F++G PS +  + ++        ES++  D+VQ +F DT+ NLTLK ++ L W+H  C  A ++   DDD F+N  +L    RI    +          G + SN  PIR    K+ V   +++ + YPPY  G   +++      +   +     L IDDVF+
Sbjct:   50 NVTLLLAIKSDARNLERRDVIRRTWGREGSVRGRPVRRVFLVGVPSGEAPERRVHLNALLQEESREHGDIVQWNFLDTFFNLTLKQLLFLDWLHERCAGARYVFDGDDDVFVNTPNL--LERIAAEERAGRGDGHLYEGYVISNVGPIRAPSSKYFVPVQVHAGDSYPPYVGGGGILMAGRTALDIRRVAGQLAMLPIDDVFL 250          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 107.457 bits (267), Expect = 2.910e-27
Identity = 62/207 (29.95%), Postives = 104/207 (50.24%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTD----QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINI-FSLTYFSRINLNPKE--KFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYV 878
            FL+  + S     + RQ IRDTWG+   +     + LF++G   ++      Q  +  ES++  DL+Q +F DTY NLTLK M+ LHW+   C  A ++ KTD D F+N+ F ++   +  L+      +  G +     P R    KW +  ++Y  E+YP +  G  Y++S      +   S   + L ++DV++ G+ L +  V
Sbjct:   10 FLVLLISSVPAQLDARQAIRDTWGNESLVPGIVIKRLFLLGAAPAEAGSLRVQSLLEEESRRHGDLLQQNFVDTYYNLTLKTMMGLHWVSEHCSDAAYVMKTDSDMFVNVEFLVSTVLKPELHQPSLPDYFTGYLMRGYSPNRNPESKWYMPVEVYPGERYPTFCSGTGYVLSGTLAARVYRVSLTIRRLHLEDVYV-GLCLAKLRV 215          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI5])

HSP 1 Score: 122.865 bits (307), Expect = 2.460e-33
Identity = 69/203 (33.99%), Postives = 107/203 (52.71%), Query Frame = 3
Query:  261 LCSENVFLLTYVQSSSINFERRQLIRDTWGSLK-QINSE--TTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIV 860
            LC+ NVFLL  V S   +F  R+ IR +WG+ +  IN    T + +F +G+ S       +  E+ +++D+V  DF DTY+NLTLK ++ L W    CPQA++I KTD D F+N+  L    RI    ++   LG+I     P R K  K+ V +  +S   YPPY  G  Y+   + +  LL  S+      ++D +   ++
Sbjct:    3 LCTGNVFLLAAVHSCHESFSMREAIRLSWGNQENAINKGKWTWKTVFFLGQSSDDEKNQLLRLEAARYKDIVIGDFLDTYRNLTLKTILILRWAKKHCPQAQYILKTDHDCFVNVLPLMRLLRI----RKPLYLGRIHWKNTPTRNKTSKFYVSKAEFSEPVYPPYAAGGGYVFKGSLLPSLLQASHEAAVFPMEDAYFGSLM 201          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI4])

HSP 1 Score: 100.138 bits (248), Expect = 7.289e-25
Identity = 64/209 (30.62%), Postives = 103/209 (49.28%), Query Frame = 3
Query:  264 CSENVFLLTYVQSSSINFERRQLIRDTWGSLKQI--------NSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSL-TYFSRINL-NPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIV 860
            C    FLL  V S   NF+RR+ IR +WG  + +           + + +F+IGR  ++T Q  +  ESKK  D+V  DF D+Y NL  K ++ + W H FC  A++I KTDDD +IN  +L T+    ++ N  +    G++  +   IR K  +  +  + Y   ++P Y  G  Y+ S   +  L+  S   K   ++D     I+
Sbjct:    2 CRRTPFLLIEVHSRPSNFKRREAIRFSWGQPENVINQAGNFPQGRSWKTVFMIGRSQNKTIQSALDFESKKSSDIVFGDFEDSYSNLYKKMVLGIRWAHTFC-TADYILKTDDDCYINAHALITWLDSYHMVNASQPLYTGRLVEDRRVIRDKEDRNYLSMEEYPDAEFPAYIAGGGYLFSGFLLLRLISGSKRVKMFPVEDACFGTIM 209          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO35379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLN2])

HSP 1 Score: 91.6633 bits (226), Expect = 1.010e-21
Identity = 59/211 (27.96%), Postives = 106/211 (50.24%), Query Frame = 3
Query:  303 SSINFERRQLIRDTWGSLK--------QINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHV---NFQLN 902
            SS++ +RR  IR TWG+ +        +++S + +L+F++G+   +   +KI  E+K + D+V  DF D Y NL +K  +   WI      ++F+ K DDD ++ +  LT+     L   E+F  G + +N    R    K  + +  +  + YPPY  G  Y+ +   +   +  +Y+ K   I+D ++ GI+L+   +  V    F LN
Sbjct:   12 SSVHLDRRNAIRRTWGNGRRSTNDTGSKVDSLSFKLVFLLGKSYDKVLDEKIATEAKLYNDIVVGDFHDNYTNLIIKVYMGFKWIQENM-NSKFVIKADDDLYLYLPRLTH----RLAKAERFFGGYVMTNAQVYRDVNNKHGISKPFFGEDVYPPYCGGPFYVFTSNLLPDFIRLTYHFKPFHIEDAYM-GILLRHMGIRPVFIPGFLLN 216          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO36369 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIV3])

HSP 1 Score: 91.6633 bits (226), Expect = 1.590e-21
Identity = 62/236 (26.27%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  180 DVSKYCSGENF----TFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSE-----TTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIV 860
            D ++  + +NF     F+N+   S  +    + S+++FL+  V S+  +F +RQ IR+TWGS+   +S+       +L+F++G      D       S+K  DL+   F +TY+NL +K  V L W      + +++ K D+D F+NI  +  +    +   ++   G++ +N   +R    K++V   +Y P  YPPY +G  Y++S+  +  +L      +   ++D F+  I 
Sbjct:    1 DFARTPTAKNFLLFLPFHNYRILSQFLG-PRMNSQDLFLIVLVLSTPESFIQRQAIRETWGSITSTDSKGKSDKKVKLVFVLGG-LGHVDSALRREHSEK-NDLLIGSFEETYRNLVVKVFVGLKWAST--QRCKYVFKADEDVFLNIPRVVEWVE-EIGSPQRLYAGEVVNNNTVLRWPWAKYSVSPLVYEPSYYPPYCRGAFYLLSRPVLPAILEEVAKRRAFAVEDAFLGVIA 230          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO34915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ5])

HSP 1 Score: 88.1965 bits (217), Expect = 1.691e-20
Identity = 61/207 (29.47%), Postives = 104/207 (50.24%), Query Frame = 3
Query:  279 FLLTYVQSSSINFERRQLIRDTWGS--LKQINSETTR------LLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIR---KKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQ 866
            +L+  V S     E RQ IR+TWGS  L++  + + R      + F +G+    +   K   E++   D++  +FRDTY NL +K  ++  W      + +F+ KTDDD ++ +   T++ R+  +P ++F  G I  +   IR    K  KW + +  +S   YPPY  G  ++IS   V  LL  +   +   +DD +I GI ++
Sbjct:    1 YLVVVVNSDPRKLENRQTIRETWGSSHLQREYTISNRDGVKWGVFFAMGKTGDTSLDSKTTREAQIHNDILIGNFRDTYNNLIIKTFMSHRWTVTL--KCKFVLKTDDDVYVRLNVFTHWLRLQGSP-DRFYGGDIFKDYRVIRDRCSKWRKWAISKAYFSENFYPPYCGGPFHVISSDIVPYLLSYTSLRRPFHVDDAYI-GIAMR 203          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:101163306])

HSP 1 Score: 133.65 bits (335), Expect = 7.596e-36
Identity = 70/218 (32.11%), Postives = 116/218 (53.21%), Query Frame = 3
Query:  234 FSYIINETTLC-SENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTY-FSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH 881
            F Y+INE   C +E  FL+  + ++   F+ RQ IR+TWG            LF++GR         +  ES+ F D+V  DF D+Y NLTLK ++ + W+  +C +A+++ KTD D F+N+ +L Y   +    P+ ++  G +  N  PIR    KW +  D+Y   KYPP+  G  Y+ S      +   S + + L ++DV++ G+ L++  +H
Sbjct:   65 FGYLINEDKKCETEAPFLVILISTTHKEFDARQAIRETWGDESTFPEVRVVALFLLGRSMDAVLNQMVEQESQIFHDVVVEDFIDSYHNLTLKTLMGMRWVATYCTKAQYVLKTDSDIFVNMENLIYNLLKPTTKPRRRYFTGYV-INGGPIRDIRSKWYMPRDLYPDSKYPPFCSGTGYVFSADVAELIYKISLHTRLLHLEDVYV-GVCLRKLGIH 280          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: ENSORLT00000034091.1 (pep primary_assembly:ASM223467v1:3:3501170:3506038:-1 gene:ENSORLG00000028331.1 transcript:ENSORLT00000034091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.316e-35
Identity = 69/220 (31.36%), Postives = 122/220 (55.45%), Query Frame = 3
Query:  234 FSYIINETTLCS-ENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIG---RPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH 881
            + ++INE   C  E  F++  V  +  N   R +IR TWGS  Q+      L F++G     ++   Q ++  ES++ RDL+Q+DF D YKNLT+K MV L W+ ++C  A +  K D D F+N+ +L     +   PK  ++ G +++    +R    KW + E +Y  ++YPPY  G  Y++S    + L++ S + K ++I+D ++ G+ ++  ++H
Sbjct:   74 YHFVINEPQKCEKEEPFVVLVVPVAPHNRAHRDVIRSTWGSQSQVLGRKVLLFFLVGLKDGEAAPQLQQQLQRESRRHRDLIQSDFVDCYKNLTIKTMVMLEWLDSYCSSASYAMKIDSDMFLNVGNLIIM--LLKAPKSNYMTGLVANGGSVLRNPSSKWYLPEKLYPRQQYPPYALGLGYILSLDLPKKLIMASRHVKAIYIEDAYL-GLCMEHLHLH 290          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: zgc:194679 (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:101162806])

HSP 1 Score: 132.109 bits (331), Expect = 6.592e-35
Identity = 69/220 (31.36%), Postives = 122/220 (55.45%), Query Frame = 3
Query:  234 FSYIINETTLC-SENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIG---RPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH 881
            + ++INE   C  E  F++  V  +  N   R +IR TWGS  Q+      L F++G     ++   Q ++  ES++ +DL+Q+DF D YKNLT+K MV L W+ ++C  A +  K D D F+N+ +L     +   PK  ++ G ++     +R    KW + E +Y  ++YPPY  G  Y++S    + L++ S + K ++I+DV++ G+ ++  ++H
Sbjct:   84 YHFVINEPQKCEKEEPFVVLVVPVAPHNRAHRDVIRSTWGSQSQVLGRKVLLFFLVGLKDGEAAPQLQQQLQRESRRHQDLIQSDFVDCYKNLTIKTMVMLEWLDSYCSSASYAMKIDSDMFLNVGNLIIM--LLKAPKSNYMTGLVAYGGSVLRNPSSKWYLPEKLYPRQQYPPYALGLGYILSLDLPKKLIMASRHVKAIYIEDVYL-GLCMEHLHLH 300          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:NCBI gene;Acc:101156539])

HSP 1 Score: 130.954 bits (328), Expect = 8.482e-35
Identity = 71/222 (31.98%), Postives = 117/222 (52.70%), Query Frame = 3
Query:  222 NHTPFSYIINETTLC-SENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTY-FSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVH 881
            N   F ++INE   C S   FL+  + ++   F+ RQ IR+TWG            +F++G  S       +  ES+ F D+V  +F D+Y NLTLK M+ + W+  FCP+A+++ KTD D F+N+ +L Y   +    P+ ++  G +  N  PIR    KW +  D+Y   KYPP+  G  Y+ S      +   S + + L ++DV++ G+ L++  +H
Sbjct:   61 NPHAFEFVINEPKKCESITPFLVILISTNHKEFDARQAIRETWGDESTFTQIHILTIFLLGWNSDDVLNQMVEQESQIFHDIVVENFIDSYHNLTLKTMMGMRWVATFCPKAQYVMKTDSDIFVNMDNLIYKLLKPTTKPRRRYFTGYV-INGGPIRDMRSKWYMPRDVYPDSKYPPFCSGTGYVFSADIAELIYKTSLHTRLLHLEDVYV-GLCLRKLGIH 280          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 132.494 bits (332), Expect = 8.671e-35
Identity = 73/230 (31.74%), Postives = 123/230 (53.48%), Query Frame = 3
Query:  204 ENFTFYNHTP-FSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTD----QDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYV 878
            + F  Y H   F  + N    CS  +FLL  ++S +   +RR++IR TWG  + ++ +  + LF++G+PS++ +    Q  +  E K + D++Q DF D++ NLTLK    L W H +CP   ++ K DDD F+++ ++  +     N K  F+ G +     PIRKK  K+ + E +Y+   YPPY  G  +++     R L   +   +   IDDVF+ G+ L+  +V
Sbjct:   95 QQFLLYRHCRLFPMVFNHPEKCSGEIFLLIVIKSVATQHDRREVIRKTWGKEQVLDGKRVKTLFLLGKPSNEAERENHQKLVEYEDKIYGDILQWDFLDSFFNLTLKETHFLKWFHTYCPNVRYVFKGDDDVFVSVENIFEYLESIKNEKNMFV-GDVLVKAKPIRKKENKYYIPEALYNETYYPPYAGGGGFLMDGPLARRLDRAANTLELFPIDDVFL-GMCLEVLHV 322          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000023690.1 (SMESG000023690.1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/302 (98.68%), Postives = 300/302 (99.34%), Query Frame = 3
Query:   99 MKNIILFLICIGISNQENFINPDLNDEDVSKYCSGENFTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGYIFLDKENITANAMDYIYIVGRNIVLPTQWEK 1004
            MKNIILFLICIGISNQENFINPD+NDEDVSKYCSGENFTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADF DTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHH+NFQLNFGYIFLDKENITAN MDYIYIVGRNIVLPTQWEK
Sbjct:    1 MKNIILFLICIGISNQENFINPDVNDEDVSKYCSGENFTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFLDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHMNFQLNFGYIFLDKENITANTMDYIYIVGRNIVLPTQWEK 302          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000020765.1 (SMESG000020765.1)

HSP 1 Score: 337.035 bits (863), Expect = 4.391e-115
Identity = 156/300 (52.00%), Postives = 219/300 (73.00%), Query Frame = 3
Query:   99 MKNIILFLICIGISNQENFINPDLNDEDVSKYCSGENFTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGYIFLDKENITANAMDYIYIVGRNIVLPTQW 998
            M   I F++ + I   ++ INP++N + +  +C+GEN T++NHTPFSYII E+ LC  +V+LLTYVQSSSI+F+RR +IR+TWGSL+ ++++  +L F+IG   +   Q KI  ESK F D++Q DF D+YKNLTLKH+VALHWI N+C  A+F+SKTDDDTFI+IF+L  + + +LNP +K ILG+IS NE PIR+ GFKWT+  +MY  +KYPP+ KGFAY+IS AA++PL +CSYYEK+LFIDDVFITG+V +   +   +F   FG+ ++  E I   +MD ++ V +    P QW
Sbjct:    1 MFKYIYFILTVCIHESKHIINPEVNSDSIRLFCTGENLTYFNHTPFSYIIKESDLCFGDVYLLTYVQSSSIHFKRRMMIRETWGSLRYVSNDPVKLAFVIGYSENFKIQKKIEKESKDFGDIIQGDFIDSYKNLTLKHIVALHWIVNYCSHAQFVSKTDDDTFISIFNLVSYLKEHLNPADKLILGKISYNETPIREPGFKWTINSEMYPNDKYPPFLKGFAYVISNAAIKPLFICSYYEKFLFIDDVFITGLVSRLAGIELQSFDKVFGHFWISNEPIPIESMDNLFFVSQTEYYPDQW 300          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000020856.1 (SMESG000020856.1)

HSP 1 Score: 286.96 bits (733), Expect = 2.542e-95
Identity = 143/288 (49.65%), Postives = 191/288 (66.32%), Query Frame = 3
Query:  114 LFLICIGISN-QENFINPDLNDEDVSKYCSGENFTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGYIFLDKENITANAMDYIYIVGR 974
            LF+I I I++     I PDL      K+C      FYNHTPF YI NE  LC   +FLL YVQSSS +F RR++IR+TWGS+K ++    RLLF+IG+ + +T Q K+  E K FRD++QADF DTY NLTLKH+VALHWIHN+C  A+FI KTDDDTF++IF + Y+   N NP EKFILG++ +N  PIR+K  KW V   +Y  E YPPY  G AY+ISQ A+ PL +CSY+ +  FIDDV ITG + +   V+  +   NFG  F+  ++I  N M+ ++ + +
Sbjct:   10 LFVIYIVINSLNATIIQPDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPMEKFILGRVITNSRPIRRKS-KWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLRSLDWNFGPKFIILKDIQMNLMENLFFITQ 296          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000023044.1 (SMESG000023044.1)

HSP 1 Score: 160.999 bits (406), Expect = 1.748e-46
Identity = 98/265 (36.98%), Postives = 154/265 (58.11%), Query Frame = 3
Query:  195 CSGENFTFYNHTP---FSYIINETTLCSEN-VFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQ-AAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGYIFLDKENITAN----AMDYIY 962
            C   N +  N+ P     Y INE +LC ++   +L  V SS  N E+RQ IR+T+GSLK++N ++ R+++ +G   + T Q  + +ES  +RD++QA+F D+Y NLTLKH+   +W+  FC  A ++ K DDDT ++IF L YF R   + K  F    I++   P+ + G KW+V  D +  + YPPY +GFAY+++    +R  + CS   K+ +IDDV + G V Q+  +    F  N+G+      N+ AN    +MDYI+
Sbjct:   19 CEVSNNSISNYFPNQRIEYEINENSLCKDSEPDILIAVHSSPNNSEKRQNIRNTFGSLKRVNKKSLRVIYFVGITLNSTLQSLLESESFHYRDIIQANFIDSYHNLTLKHVSLHNWVERFCRNATYLIKIDDDTMVDIFHLEYFFR-TFDMKSDFYCKVINA---PVLRSG-KWSVSLDDFPEKYYPPYCEGFAYILTNLQKLRKFVDCSLNMKFFWIDDVLLLGTVRQKLNMTAQYFPENYGH-----SNLNANSDNYSMDYIF 273          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000023046.1 (SMESG000023046.1)

HSP 1 Score: 156.377 bits (394), Expect = 4.028e-44
Identity = 99/272 (36.40%), Postives = 155/272 (56.99%), Query Frame = 3
Query:  195 CSGENFTFYNHTP---FSYIINETTLCSEN-VFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQ-AAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHVNFQLNFGY---IFLDKENITANAMDYIYIVGRNIVL 986
            C   N +  N+ P     Y INE +LC ++   +L  V SS  N E+RQ IR+T+GSLK++N ++ R+++ +G   + T Q  + +ES  +RD++QA+F D+Y NLTLKH+   +W+  FC  A ++ K DDDT ++IF L YF R   + K  F    I++   P+ + G KW+V  D Y    YP Y +GFAY+++    +R  + CS   K+ +IDDV + G V Q+  +   +F +N+ Y   +F++K N          I  RN+VL
Sbjct:   19 CEVSNNSISNYFPNQRIEYEINENSLCKDSEPDILIAVHSSPNNSEKRQNIRNTFGSLKRVNKKSLRVIYFVGITLNSTLQSLLESESFHYRDIIQANFIDSYHNLTLKHVSLYNWVERFCRNATYLIKIDDDTMVDIFHLEYFFR-TFDIKSDFYCRVINT---PVLRSG-KWSVSLDDYPDNVYPLYCEGFAYILTNLQKLRKFVDCSLNMKFFWIDDVLLLGTVRQKLNMTIQDFPMNYSYSNSLFVEKMN---------SIFFRNVVL 276          
The following BLAST results are available for this feature:
BLAST of Hexosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GALT52.119e-3736.55beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT52.119e-3736.55beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT52.119e-3736.55beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT52.119e-3736.55beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT52.249e-3736.55beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0024.152.500e-2429.44Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
B0024.152.500e-2429.44Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
C54C8.31.325e-2027.68Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
C47F8.34.925e-1930.39Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:G... [more]
E03H4.116.563e-1927.57Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG113571.939e-2931.67gene:FBgn0035558 transcript:FBtr0073310[more]
CG113571.939e-2931.67gene:FBgn0035558 transcript:FBtr0304987[more]
CG113571.939e-2931.67gene:FBgn0035558 transcript:FBtr0113143[more]
CG113571.939e-2931.67gene:FBgn0035558 transcript:FBtr0113142[more]
CG86684.044e-2832.23gene:FBgn0031988 transcript:FBtr0339671[more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR759791.14.632e-3532.46beta-1,3-galactosyltransferase 2-like [Source:NCBI... [more]
CR759791.24.632e-3532.46beta-1,3-galactosyltransferase 2-like [Source:NCBI... [more]
CABZ01072312.17.702e-3532.46beta-1,3-galactosyltransferase 2-like [Source:NCBI... [more]
b3galt1a8.804e-3532.24UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
b3gnt71.172e-3433.47UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GNT46.534e-3935.42UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt55.254e-3535.62UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
tcp11l15.419e-3531.53t-complex 11, testis-specific-like 1 [Source:Xenba... [more]
ENSXETT00000049063.11.083e-3334.78Beta-1,3-galactosyltransferase 4 [Source:NCBI gene... [more]
pja23.242e-3334.68praja ring finger 2, E3 ubiquitin protein ligase [... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3galt15.729e-3630.93UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3galt15.729e-3630.93UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3galt56.012e-3534.52UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3galt56.012e-3534.52UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3gnt41.835e-3433.33UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9N293|B3GT5_GORGO6.322e-3736.55Beta-1,3-galactosyltransferase 5 (Fragment) OS=Gor... [more]
sp|Q9N295|B3GT5_PANTR8.812e-3736.55Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan... [more]
sp|Q9Y2C3|B3GT5_HUMAN1.018e-3636.55Beta-1,3-galactosyltransferase 5 OS=Homo sapiens O... [more]
sp|Q9N294|B3GT5_PANPA1.192e-3636.55Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan... [more]
sp|Q6DE15|B3G5B_XENLA5.927e-3635.34Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminylt... [more]
back to top
BLAST of Hexosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FYC54.940e-4731.90Hexosyltransferase OS=Macrostomum lignano OX=28230... [more]
A0A267EPS11.390e-4631.90Hexosyltransferase OS=Macrostomum lignano OX=28230... [more]
C3Y7X51.620e-4436.61Hexosyltransferase (Fragment) OS=Branchiostoma flo... [more]
V4AM001.654e-4435.63Hexosyltransferase OS=Lottia gigantea OX=225164 GN... [more]
A0A1S3JJW59.218e-4435.68Hexosyltransferase OS=Lingula unguis OX=7574 GN=LO... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3galt1a1.727e-3832.73beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
B3GALT14.800e-3833.49beta-1,3-galactosyltransferase 1 [Source:NCBI gene... [more]
b3gnt5b6.108e-3836.28lactosylceramide 1,3-N-acetyl-beta-D-glucosaminylt... [more]
si:ch211-250e5.21.035e-3333.02beta-1,3-galactosyltransferase 2-like [Source:NCBI... [more]
b3gnt5a4.059e-3233.62lactosylceramide 1,3-N-acetyl-beta-D-glucosaminylt... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3galt27.815e-3735.11UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
b3gnt2a2.509e-3033.62UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GALT48.454e-2930.73beta-1,3-galactosyltransferase 4 [Source:HGNC Symb... [more]
B3GNT33.076e-2831.53UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3galt22.910e-2729.95UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333262.460e-3333.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333457.289e-2530.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353791.010e-2127.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363691.590e-2126.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349151.691e-2029.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3galt1a7.596e-3632.11beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
ENSORLT00000034091.11.316e-3531.36pep primary_assembly:ASM223467v1:3:3501170:3506038... [more]
zgc:1946796.592e-3531.36beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
B3GALT18.482e-3531.98beta-1,3-galactosyltransferase 1 [Source:NCBI gene... [more]
b3gnt78.671e-3531.74UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023690.10.000e+098.68SMESG000023690.1[more]
SMESG000020765.14.391e-11552.00SMESG000020765.1[more]
SMESG000020856.12.542e-9549.65SMESG000020856.1[more]
SMESG000023044.11.748e-4636.98SMESG000023044.1[more]
SMESG000023046.14.028e-4436.40SMESG000023046.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015286 ID=SMED30015286|Name=Hexosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1091bp
TTGTAACTCAACAATTATAATAGCACACTAATTTGTTATTAGAATATTAC
AATAATTGCTTGTTGAGATTATTTTCAACTTAATTATTTTGTAAAAGAAT
GAAAAATATAATTTTATTTCTAATTTGTATTGGAATATCAAATCAAGAAA
ATTTTATCAATCCAGATCTCAATGATGAAGATGTATCAAAGTATTGTTCA
GGTGAAAATTTTACATTTTACAATCATACCCCATTTTCTTATATCATCAA
TGAGACGACGTTGTGTTCAGAAAATGTTTTCCTATTGACCTATGTGCAAA
GCTCGTCGATCAACTTTGAACGACGTCAACTGATTCGAGATACCTGGGGA
TCTTTAAAGCAAATCAATTCAGAAACGACTCGATTGCTCTTTATAATCGG
CAGACCCAGCTCACAAACCGATCAAGATAAGATCATGAATGAGAGTAAAA
AGTTTCGTGACTTAGTTCAAGCCGATTTTCGCGACACCTATAAAAATTTG
ACTTTGAAACACATGGTCGCTTTGCACTGGATTCACAATTTTTGTCCTCA
GGCGGAATTCATTTCAAAAACCGATGATGATACGTTTATCAATATTTTCT
CATTGACCTATTTTTCACGAATAAATTTAAACCCAAAAGAAAAATTCATT
CTGGGACAAATTTCTTCAAATGAGCACCCGATTCGAAAAAAAGGATTCAA
ATGGACCGTTGGAGAAGACATGTATTCACCCGAAAAATATCCTCCGTACA
CTAAAGGATTTGCGTACATGATTTCTCAGGCCGCAGTTAGGCCACTTTTA
GTCTGTTCATATTATGAGAAATATCTTTTTATTGATGACGTTTTTATTAC
CGGCATTGTTCTGCAAAGAACATATGTTCACCACGTGAACTTTCAACTAA
ATTTTGGATATATTTTTTTGGATAAAGAAAATATCACGGCAAATGCAATG
GATTATATATACATTGTTGGCCGCAATATCGTTTTACCGACGCAATGGGA
GAAATTATGGGATTTATCATTGAAGCAGTTACTATAATAAATAAATTTTA
TTTTGAAACTTTTACATATTTTAAATATAATGATACAGGGC
back to top

protein sequence of SMED30015286-orf-1

>SMED30015286-orf-1 ID=SMED30015286-orf-1|Name=SMED30015286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=313bp
MKNIILFLICIGISNQENFINPDLNDEDVSKYCSGENFTFYNHTPFSYII
NETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFII
GRPSSQTDQDKIMNESKKFRDLVQADFRDTYKNLTLKHMVALHWIHNFCP
QAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGF
KWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFI
TGIVLQRTYVHHVNFQLNFGYIFLDKENITANAMDYIYIVGRNIVLPTQW
EKLWDLSLKQLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002659Glyco_trans_31
Vocabulary: molecular function
TermDefinition
GO:0008378galactosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.550.50coord: 51..269
e-value: 1.4E-5
score: 26.2
NoneNo IPR availablePANTHERPTHR11214:SF148HEXOSYLTRANSFERASEcoord: 36..267
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.559
IPR002659Glycosyl transferase, family 31PFAMPF01762Galactosyl_Tcoord: 74..264
e-value: 2.1E-47
score: 161.5
IPR002659Glycosyl transferase, family 31PANTHERPTHR11214BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASEcoord: 36..267