SMED30015272

Overview
NameSMED30015272
Smed IDSMED30015272
Length (bp)1510
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30015272 (SMED30015272) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30015272 (SMED30015272) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30015272 (SMED30015272) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30015272 (SMED30015272) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015272

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015272h1SMcG0014107 SmedASXL_030022SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015272h1SMcG0014107 SmedASXL_004610SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30015272h1SMcG0014107 dd_Smed_v4_19180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015272h1SMcG0014107 dd_Smed_v6_19180_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30015272h1SMcG0014107 OX_Smed_1.0.22099ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015272 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000112:233130..234639 -7505
Homology
BLAST of SMED30015272 vs. Ensembl Human
Match: LRRC70 (leucine rich repeat containing 70 [Source:HGNC Symbol;Acc:HGNC:35155])

HSP 1 Score: 106.301 bits (264), Expect = 1.125e-23
Identity = 69/226 (30.53%), Postives = 124/226 (54.87%), Query Frame = 2
Query:  272 ITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            + A+ ++  NI  V    FV  R+L  L +N    I RLD GIF+  ++L+   +  N+++ +   +FN   ++Q L+L  N + V+    F     LR ++LS+N +L I E  F+ L NL  L L  N ++ +   AF  L+ +  + L+HN + ++   +F  + ++  LLL +++IR+++   F G++NL++L L +N L  L    FS +K L  ++LD +
Sbjct:   86 LVALYLDNSNILYVYPKAFVQLRHLYFLFLNN-NFIKRLDPGIFKGLLNLRNLYLQYNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSNNNILRISESGFQHLENLACLYLGSNNLTKVPSNAFEVLKSLRRLSLSHNPIEAIQPFAFKGLANLEYLLLKNSRIRNVTRDGFSGINNLKHLILSHNDLENLNSDTFSLLKNLIYLKLDRN 310          

HSP 2 Score: 71.2478 bits (173), Expect = 1.937e-12
Identity = 63/213 (29.58%), Postives = 107/213 (50.23%), Query Frame = 2
Query:  434 MTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED-INCIIRFPKIQLS--ENVV---SRLRKF-RSCYKGENDLK 1051
            +T N ++ I E       +L  L L N+ I  ++  AF   ++L F+ L++N +  +    F+GL+NL  L L +N++SF+    F+ L  +  + L  N+L  L   +F  + ++  L L++N I  IS   F+ L+NL  L L +N L  +  + F  +K L  + L  + I  I  F    L+  E ++   SR+R   R  + G N+LK
Sbjct:   67 LTGNNISYINESELTGLHSLVALYLDNSNILYVYPKAFVQLRHLYFLFLNNNFIKRLDPGIFKGLLNLRNLYLQYNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSNNNILRISESGFQHLENLACLYLGSNNLTKVPSNAFEVLKSLRRLSLSHNPIEAIQPFAFKGLANLEYLLLKNSRIRNVTRDGFSGINNLK 279          

HSP 3 Score: 60.8474 bits (146), Expect = 3.502e-9
Identity = 52/165 (31.52%), Postives = 82/165 (49.70%), Query Frame = 2
Query:  569 FINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDL-KTPS 1060
            F+ L+ N +  I E    GL +L  L L ++ I ++ P AF  LR ++ + LN+N +  LD   F  + ++  L L  NQ+  +    F  L ++QYL+L+ N+L +L    F  M  L  ++L    N I+R     +SE+    L      Y G N+L K PS
Sbjct:   64 FLYLTGNNISYINESELTGLHSLVALYLDNSNILYVYPKAFVQLRHLYFLFLNNNFIKRLDPGIFKGLLNLRNLYLQYNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSN--NNILR-----ISESGFQHLENLACLYLGSNNLTKVPS 221          
BLAST of SMED30015272 vs. Ensembl Human
Match: IGFALS (insulin like growth factor binding protein acid labile subunit [Source:HGNC Symbol;Acc:HGNC:5468])

HSP 1 Score: 102.834 bits (255), Expect = 1.647e-22
Identity = 69/219 (31.51%), Postives = 117/219 (53.42%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +P + F    +L +L++ G   +  L   +F     L++  ++ N L  I   +F     LQ+L L  N I  +   AF   K LR+++LSHN + G+ E TF GL+ L VL L+HN I+ ++P  F  L  +  ++L HN++  L  RSF  +  +  L L+ NQ++++   AF GL N+  ++L  N L  L E +F  + +L ++ L+   +C+ R
Sbjct:  223 LPDAAFRGLGSLRELVLAG-NRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEG--SCLGR 438          

HSP 2 Score: 95.1301 bits (235), Expect = 5.432e-20
Identity = 68/256 (26.56%), Postives = 120/256 (46.88%), Query Frame = 2
Query:  176 PVNWEITSIIVSITMPYKSDWDNLFLNCSTSNIT-----------AIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFS 910
            P   E  +   +    Y  D D L + CS+ N+T           A+ ++  N+ SVP + F +  +L  L + G G +  L+        +L    +  N+L  +    F     L  L L+NN +  + +  F    +L  +NL  N L  + +  F GL +L  L+LA NR+++++P  FS L ++  ++L+ N L ++    F  +  + +L L+ N I  ++  AF GL  L++L L +N++  L E  F 
Sbjct:   71 PGEAEGPACPAACVCSYDDDADELSVFCSSRNLTRLPDGVPGGTQALWLDGNNLSSVPPAAFQNLSSLGFLNLQG-GQLGSLEPQALLGLENLCHLHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFP 325          

HSP 3 Score: 83.1889 bits (204), Expect = 3.663e-16
Identity = 47/174 (27.01%), Postives = 90/174 (51.72%), Query Frame = 2
Query:  401 FRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKR 922
            F++   L++ ++  N++  + E+ F     L+ L+L +N ++ +   AF    N+  +NLS N L  + E+ F GL  L+ L L  + +  I+P  F+ L  +  + L  N L+ ++ +S + +  ++ L L  NQ+  +  + F+GL  L+YL L  N+L  L       ++R
Sbjct:  348 FKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQR 521          

HSP 4 Score: 75.485 bits (184), Expect = 1.026e-13
Identity = 60/233 (25.75%), Postives = 105/233 (45.06%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLF-------------NSCSTL-----------QELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLE 928
            +R++ A+ FV    L+KL ++   +I  +  G F     L+   ++ N++  + E  F             N+ ++L           +EL L +N I+ + E +F     L  + L HN L  +    F GL N+ V+ L+ N +  +    F  L K+HS+ L  + L  +   +F  +  + RL L DN +  I  ++  GL  L  L L +N+L  L   +F  + +LE
Sbjct:  268 LRAIKANVFVQLPRLQKLYLDR-NLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLE 499          

HSP 5 Score: 54.299 bits (129), Expect = 4.305e-7
Identity = 45/185 (24.32%), Postives = 86/185 (46.49%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNL 853
             ++ V A  F+   N+  + ++G   +  L E +FR    L    +  + L  I    F   S L+ L L +N +  I E +      L  ++L+ N L  +  + F+GL  L  L+L+ NR++ +   A   L++   ++++HN+L +L       +  +  L L +N +R  + +   GL+ L
Sbjct:  387 QLQEVKAGAFLGLTNVAVMNLSG-NCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVSHNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQP-PGLERL 569          
BLAST of SMED30015272 vs. Ensembl Human
Match: LRIG3 (leucine rich repeats and immunoglobulin like domains 3 [Source:HGNC Symbol;Acc:HGNC:30991])

HSP 1 Score: 102.449 bits (254), Expect = 1.740e-22
Identity = 74/243 (30.45%), Postives = 130/243 (53.50%), Query Frame = 2
Query:  287 INPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSEN 994
            +N   I++V    F     L+ L +   G+   +D G F    +++  ++  N LT IT+        LQEL L+ N I  I   A+  C+ L  ++L+ N L  + + +F GL  L  L + +NR+S+I   AF  L  + +++L +N++ S  I     +F  +  + RL+L  N+IR I+ KAF GLD L++L L +N +M L+ + FS+MK+L+ + L+      +C +++    ++EN
Sbjct:  222 LNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMD-GAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEI-SWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAEN 462          

HSP 2 Score: 74.3294 bits (181), Expect = 1.865e-13
Identity = 59/205 (28.78%), Postives = 95/205 (46.34%), Query Frame = 2
Query:  368 PGIIDRLDEGIF-----RNRI-----------HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESM---FSEMKRL 925
            PG  D L   +      RNRI            L+  ++  NK+  +    F     L+ L +  N +  + + AF    N+  + L HN L  I +    GL+ L  L L+ N I+ I P A+   +K+  ++L  N L  LD  SF  +  +  L + +N++  I+  AF+GL +L+ L LKNN++    E M   FS + +L
Sbjct:  184 PGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKL 388          

HSP 3 Score: 54.6842 bits (130), Expect = 2.821e-7
Identity = 46/185 (24.86%), Postives = 87/185 (47.03%), Query Frame = 2
Query:  266 SNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEK---TFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQI 811
            SN+  + ++  N+  +   +      L++L ++    I+R+    +     L +  +T N L+ + +  F   S L  L + NN +  I + AF    +L+ ++L +N +    E     F GL  L  LIL  NRI  I   AF+ L  +  ++L+ N ++SL   +F  +  + +L LN + +
Sbjct:  263 SNMEILQLDHNNLTEITKGWLYGLLMLQELHLS-QNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLNTSSL 446          

HSP 4 Score: 52.7582 bits (125), Expect = 1.170e-6
Identity = 51/207 (24.64%), Postives = 104/207 (50.24%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRK-IHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---------INCIIRFPKIQLSENVVSRL 1009
            L++ K+ +N+L  I   L    + +  LSLA N I  I        ++L  ++LS N +  + +  F  L  L  L L  NR++ ++P  F +L   +  ++LN N++ ++  +  F +  +  L LN N+I+++    F+GL  L+ L ++ N +  L +  F  +  +E ++LD +         +  ++   ++ LS+N ++R+
Sbjct:  100 LREVKLNNNELETIP-NLGPVSANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISEL-QTAFPAL-QLKYLYLNSNRVTSMEPGYFDNLANTLLVLKLNRNRISAIPPK-MFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRI 302          
BLAST of SMED30015272 vs. Ensembl Human
Match: LRIG3 (leucine rich repeats and immunoglobulin like domains 3 [Source:HGNC Symbol;Acc:HGNC:30991])

HSP 1 Score: 103.219 bits (256), Expect = 1.862e-22
Identity = 74/245 (30.20%), Postives = 131/245 (53.47%), Query Frame = 2
Query:  281 IMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSEN 994
            + +N   I++V    F     L+ L +   G+   +D G F    +++  ++  N LT IT+        LQEL L+ N I  I   A+  C+ L  ++L+ N L  + + +F GL  L  L + +NR+S+I   AF  L  + +++L +N++ S  I     +F  +  + RL+L  N+IR I+ KAF GLD L++L L +N +M L+ + FS+MK+L+ + L+      +C +++    ++EN
Sbjct:  220 LELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMD-GAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEI-SWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAEN 462          

HSP 2 Score: 75.8702 bits (185), Expect = 7.982e-14
Identity = 59/205 (28.78%), Postives = 95/205 (46.34%), Query Frame = 2
Query:  368 PGIIDRLDEGIF-----RNRI-----------HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESM---FSEMKRL 925
            PG  D L   +      RNRI            L+  ++  NK+  +    F     L+ L +  N +  + + AF    N+  + L HN L  I +    GL+ L  L L+ N I+ I P A+   +K+  ++L  N L  LD  SF  +  +  L + +N++  I+  AF+GL +L+ L LKNN++    E M   FS + +L
Sbjct:  184 PGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKL 388          

HSP 3 Score: 55.4546 bits (132), Expect = 2.390e-7
Identity = 46/181 (25.41%), Postives = 85/181 (46.96%), Query Frame = 2
Query:  266 SNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEK---TFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLN 799
            SN+  + ++  N+  +   +      L++L ++    I+R+    +     L +  +T N L+ + +  F   S L  L + NN +  I + AF    +L+ ++L +N +    E     F GL  L  LIL  NRI  I   AF+ L  +  ++L+ N ++SL   +F  +  + +L LN
Sbjct:  263 SNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQ-NAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLN 442          

HSP 4 Score: 54.299 bits (129), Expect = 4.968e-7
Identity = 51/207 (24.64%), Postives = 104/207 (50.24%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRK-IHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---------INCIIRFPKIQLSENVVSRL 1009
            L++ K+ +N+L  I   L    + +  LSLA N I  I        ++L  ++LS N +  + +  F  L  L  L L  NR++ ++P  F +L   +  ++LN N++ ++  +  F +  +  L LN N+I+++    F+GL  L+ L ++ N +  L +  F  +  +E ++LD +         +  ++   ++ LS+N ++R+
Sbjct:  100 LREVKLNNNELETIP-NLGPVSANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISEL-QTAFPAL-QLKYLYLNSNRVTSMEPGYFDNLANTLLVLKLNRNRISAIPPK-MFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRI 302          
BLAST of SMED30015272 vs. Ensembl Human
Match: LRIG3 (leucine rich repeats and immunoglobulin like domains 3 [Source:HGNC Symbol;Acc:HGNC:30991])

HSP 1 Score: 103.219 bits (256), Expect = 1.947e-22
Identity = 74/245 (30.20%), Postives = 131/245 (53.47%), Query Frame = 2
Query:  281 IMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSEN 994
            + +N   I++V    F     L+ L +   G+   +D G F    +++  ++  N LT IT+        LQEL L+ N I  I   A+  C+ L  ++L+ N L  + + +F GL  L  L + +NR+S+I   AF  L  + +++L +N++ S  I     +F  +  + RL+L  N+IR I+ KAF GLD L++L L +N +M L+ + FS+MK+L+ + L+      +C +++    ++EN
Sbjct:  160 LELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMD-GAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEI-SWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAEN 402          

HSP 2 Score: 76.2554 bits (186), Expect = 7.493e-14
Identity = 59/205 (28.78%), Postives = 95/205 (46.34%), Query Frame = 2
Query:  368 PGIIDRLDEGIF-----RNRI-----------HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESM---FSEMKRL 925
            PG  D L   +      RNRI            L+  ++  NK+  +    F     L+ L +  N +  + + AF    N+  + L HN L  I +    GL+ L  L L+ N I+ I P A+   +K+  ++L  N L  LD  SF  +  +  L + +N++  I+  AF+GL +L+ L LKNN++    E M   FS + +L
Sbjct:  124 PGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKL 328          

HSP 3 Score: 55.4546 bits (132), Expect = 1.986e-7
Identity = 50/230 (21.74%), Postives = 110/230 (47.83%), Query Frame = 2
Query:  416 HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGI---YEKTFEGL-------------------VNLYVLILAHNRISFIKPFAFSSLRK-IHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---------INCIIRFPKIQLSENVVSRL 1009
            H+ +  ++ N+L+ I     +   +L+E+ L NN ++ I  L      N+  ++L+ N ++ I   + K F+ L                   + L  L L  NR++ ++P  F +L   +  ++LN N++ ++  +  F +  +  L LN N+I+++    F+GL  L+ L ++ N +  L +  F  +  +E ++LD +         +  ++   ++ LS+N ++R+
Sbjct:   15 HISRPDLSHNRLSFIKASSMSHLQSLREVKLNNNELETIPNLG-PVSANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISELQTAFPALQLKYLYLNSNRVTSMEPGYFDNLANTLLVLKLNRNRISAIPPK-MFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRI 242          

HSP 4 Score: 55.4546 bits (132), Expect = 2.146e-7
Identity = 46/181 (25.41%), Postives = 85/181 (46.96%), Query Frame = 2
Query:  266 SNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEK---TFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLN 799
            SN+  + ++  N+  +   +      L++L ++    I+R+    +     L +  +T N L+ + +  F   S L  L + NN +  I + AF    +L+ ++L +N +    E     F GL  L  LIL  NRI  I   AF+ L  +  ++L+ N ++SL   +F  +  + +L LN
Sbjct:  203 SNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQ-NAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLN 382          
BLAST of SMED30015272 vs. Ensembl Celegans
Match: lron-15 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q18902])

HSP 1 Score: 78.1814 bits (191), Expect = 6.769e-15
Identity = 70/262 (26.72%), Postives = 123/262 (46.95%), Query Frame = 2
Query:  281 IMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIF--RNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL--------DEDINCIIR-FPKIQLSENVVSRLRKFRSCYK 1033
            +M++   I+ +      D   L+ L + G   +D + E +F   +   LK   +  NK+  I+ + F+    LQ+L L++N I+ I  + F   +NLR+++LSHN ++ I       L  L VL L HN ++ I   AF S   + S++L+HN           +I  + +L L+ NQI +I +  F     ++ LSL +N +  +   +  +   L ++++        D D  C  R    I+LS N +  L K    Y+
Sbjct:  537 LMLDNNQIQKIDNFSLADLPKLQHLSLAG-NQLDIITENMFGSSSSSELKSLNLAHNKIHSISSRSFSDLDNLQQLRLSHNNIRTITSMTFSNLRNLRYLDLSHNRIIKILPSALYQLPALDVLHLDHNNLNEIDRDAFRSFSDLQSLKLSHNAFRRFSCEFLGSISQVHQLDLSSNQINEIDI--FCIARGIRKLSLASNSVEKINRKLLQDATELTSIDISHNGIIDVDSDAFCECRKLSHIKLSHNYIRNLWKGTFQYQ 795          

HSP 2 Score: 63.1586 bits (152), Expect = 3.859e-10
Identity = 60/222 (27.03%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRN-RIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTI------KVIFELAFHTCKNLRFINLSHNLLLGIYEK-TFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            I + P +   D RNL  L +NG   ++R+D  + +     L +  + +N L  I   + +    L+ L ++ N I        +  +       +R +NL+ N +  + +   FE +  L  + ++ NRI FI P  F  L+ + S+ L +NQL      S F +  +  L+L++NQI+ I   +   L  LQ+LSL  N+L ++ E+MF      E   L+
Sbjct:  371 IHATPEA-LRDLRNLTHLNLNG-NKLNRIDGDVLKGCTDTLVELFIANNYLEHIPHGVLSGMKQLEHLDISKNKIMSLKKPTSLLSITKEETSTVRRLNLAGNRINNMSDYLIFEHMPLLTYVDVSFNRIRFISPRVFEKLKNLESLFLQNNQLAHFP--SLFRLDKLRHLMLDNNQIQKIDNFSLADLPKLQHLSLAGNQLDIITENMFGSSSSSELKSLN 588          

HSP 3 Score: 60.8474 bits (146), Expect = 1.872e-9
Identity = 46/175 (26.29%), Postives = 86/175 (49.14%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLL-LNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            ++K  + SN +  I  KL    + L  + +++N I  +   AF  C+ L  I LSHN +  +++ TF+   +L+ L ++ N I F+    F     I  + +N+N+L  + + +  +  + + LL L  N I+ +         NL  LS  NNK+  +E+  F  +  L+ ++L
Sbjct:  726 IRKLSLASNSVEKINRKLLQDATELTSIDISHNGIIDVDSDAFCECRKLSHIKLSHNYIRNLWKGTFQYQESLHTLDISFNDILFLHQGTFGK-NNILQLHVNNNKLSRIPLEALSSTMASLHLLDLAHNNIKIVDSSQLTSFGNLSILSFANNKVDSIEDGAFENLLSLKILDL 899          

HSP 4 Score: 52.7582 bits (125), Expect = 6.148e-7
Identity = 56/235 (23.83%), Postives = 104/235 (44.26%), Query Frame = 2
Query:  239 DNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLL-LNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            +N+F + S+S + ++ +    I S+ +  F D  NL++L                         +++ N +  IT   F++   L+ L L++N I  I   A +    L  ++L HN L  I    F    +L  L L+HN           S+ ++H ++L+ NQ+  +DI   F I   IR L L  N +  I+ K  +    L  + + +N ++ ++   F E ++L  ++L
Sbjct:  573 ENMFGSSSSSELKSLNLAHNKIHSISSRSFSDLDNLQQL-------------------------RLSHNNIRTITSMTFSNLRNLRYLDLSHNRIIKILPSALYQLPALDVLHLDHNNLNEIDRDAFRSFSDLQSLKLSHNAFRRFSCEFLGSISQVHQLDLSSNQINEIDI---FCIARGIRKLSLASNSVEKINRKLLQDATELTSIDISHNGIIDVDSDAFCECRKLSHIKL 779          

HSP 5 Score: 50.0618 bits (118), Expect = 3.898e-6
Identity = 61/248 (24.60%), Postives = 112/248 (45.16%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGII-----------------------DRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLE-ESMFSEMKRLETVEL 940
            N+  + ++  NIR++ +  F + RNL  L ++   II                       + +D   FR+   L+  K++ N     + +   S S + +L L++N I  I    F   + +R ++L+ N +  I  K  +    L  + ++HN I  +   AF   RK+  I+L+HN + +L   +F    S+  L ++ N I  +    F G +N+  L + NNKL  +  E++ S M  L  ++L
Sbjct:  607 NLQQLRLSHNNIRTITSMTFSNLRNLRYLDLSHNRIIKILPSALYQLPALDVLHLDHNNLNEIDRDAFRSFSDLQSLKLSHNAFRRFSCEFLGSISQVHQLDLSSNQINEID--IFCIARGIRKLSLASNSVEKINRKLLQDATELTSIDISHNGIIDVDSDAFCECRKLSHIKLSHNYIRNLWKGTFQYQESLHTLDISFNDILFLHQGTF-GKNNILQLHVNNNKLSRIPLEALSSTMASLHLLDL 851          
BLAST of SMED30015272 vs. Ensembl Celegans
Match: egg-6 (Leucine-rich repeat-containing protein egg-6 [Source:UniProtKB/Swiss-Prot;Acc:P90920])

HSP 1 Score: 71.2478 bits (173), Expect = 9.612e-13
Identity = 57/214 (26.64%), Postives = 104/214 (48.60%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            +R +    F++   L+ L +    II  LD    +   +L+   +++N L  +          L+++ +  N I  I  LAF    NL+ I++ +N ++ I   +FE L  L VL++ +N ++ I+   F  ++ +  + + +N L +LD  SF  +  +  L L  N+I DI    F  L  L +L L NNK+   + S+F   K++  + LD
Sbjct:  235 LRRIHPMAFMNVPQLQYLYLQD-NIISTLDGNRLQGFKNLEVLDVSNNALYALPS--LKDLPNLKQVRVDGNLITKIETLAFSNNPNLQLISVQNNNIVQISRNSFESLDKLVVLLVGNNSLAKIERGMFDGMKNLQQLSIRNNTLTALDASSFAQLAHLTTLDLGHNKIHDIEEGTFDKLSKLFWLDLSNNKISGFKTSVFK--KKISNILLD 443          

HSP 2 Score: 62.3882 bits (150), Expect = 4.833e-10
Identity = 54/229 (23.58%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNR----------------------ISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLL------------------------EESMFSEMKRL 925
            +D +   I RN  +L    + SN ++ I      +   L+EL + NNT++ I  +AF     L+++ L  N++  +     +G  NL VL +++N                       I+ I+  AFS+   +  I + +N ++ +   SF ++  ++ LL+ +N +  I    F G+ NLQ LS++NN L  L                        EE  F ++ +L
Sbjct:  187 LDAIPAQILRNAANLMYLDLGSNNISEINNFELMNLPFLRELRVQNNTLRRIHPMAFMNVPQLQYLYLQDNIISTLDGNRLQGFKNLEVLDVSNNALYALPSLKDLPNLKQVRVDGNLITKIETLAFSNNPNLQLISVQNNNIVQISRNSFESLDKLVVLLVGNNSLAKIERGMFDGMKNLQQLSIRNNTLTALDASSFAQLAHLTTLDLGHNKIHDIEEGTFDKLSKL 415          
BLAST of SMED30015272 vs. Ensembl Celegans
Match: tol-1 (TOLl (Drosophila) family [Source:UniProtKB/TrEMBL;Acc:Q9N5Z3])

HSP 1 Score: 70.0922 bits (170), Expect = 2.214e-12
Identity = 48/186 (25.81%), Postives = 104/186 (55.91%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESM--FSEMKRLE 928
            I++L  G+  N  +L+   ++SN+L +  +++    S +  L L+NN+++++   +    K L  ++LSHN L  +       +  L  + L+HNRI+ +  +  + ++++H+++L++NQL S+    F +   +  L +++N+I  +   AF     L+ +S+K NK+  L+E +   S ++RL+
Sbjct:  342 IEQLTGGVLANATNLQTLDLSSNQLRVFRDEVLPENSKIGNLRLSNNSLELLEPSSLSGLK-LESLDLSHNKLTEV-PAAIGKVEQLKKVDLSHNRIAKVYQYVLNKIKQLHTVDLSNNQLQSIGPYIFSDSSELHSLDVSNNEISLLFKDAFARCPKLRKISMKMNKIKSLDEGLTEASGLRRLD 525          

HSP 2 Score: 50.0618 bits (118), Expect = 3.902e-6
Identity = 31/99 (31.31%), Postives = 53/99 (53.54%), Query Frame = 2
Query:  614 TFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFS 910
            +F G + L  L +    +  I+P AF +L  + +++L+ N L+SL    F     + +L LN N+   +S   F+ L NL+YL+L NN L  + + + S
Sbjct:  779 SFIGRLRLQRLHINGTGLRSIQPKAFHTLPALKTLDLSDNSLISLSGEEFLKCGEVSQLFLNGNRFSTLSRGIFEKLPNLKYLTLHNNSLEDIPQVLHS 877          
BLAST of SMED30015272 vs. Ensembl Celegans
Match: sma-10 (Leucine-rich repeats and immunoglobulin-like domains protein sma-10 [Source:UniProtKB/Swiss-Prot;Acc:Q965M2])

HSP 1 Score: 68.1662 bits (165), Expect = 7.545e-12
Identity = 57/210 (27.14%), Postives = 100/210 (47.62%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEE 898
            NI  + +   +I  +   +F  F  L  L +     I  L++  F     L+   +T N +  +    FN   +LQ +SLA N +  + +  F+ C+ L+ +NLS N +  + E    GL +L VL L++N+I      ++S   K+  + L+ N++ SL   SF  +  +  L+L+ N I  +   A  G+ +L  L L +N L +  E
Sbjct:  172 NIEKLDLASNSITDIGTDHFSSFNTLVTLKL-ARNHITTLNQFSFSRLRKLESLDLTRNMIREVRFLAFNQLPSLQNVSLARNDVYRLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDLSSNTLAVCVE 380          

HSP 2 Score: 65.4698 bits (158), Expect = 5.959e-11
Identity = 50/187 (26.74%), Postives = 91/187 (48.66%), Query Frame = 2
Query:  383 RLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSL--DIRSFFN--IHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFS--EMKRL 925
            RLD+G+F     LK   +++N++  +TE      ++L+ L L+ N I+     ++     L++++L  N +  +   +F  L  L  LIL+ N I  +  FA   +  +H ++L+ N L     D    +N  +  +  L   +NQ+R I  +AF+    L+ L L +N +  +    F   E+KRL
Sbjct:  257 RLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDLSSNTLAVCVEDGAVLYNTSMPFLRSLRFTNNQLRVIPKRAFERFPALEELDLTDNPIATIHPEAFEPLELKRL 443          

HSP 3 Score: 63.929 bits (154), Expect = 1.824e-10
Identity = 42/175 (24.00%), Postives = 85/175 (48.57%), Query Frame = 2
Query:  416 HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            HL+K  + SN ++ +T +  +  + ++ + L+ N I  + +       N+  ++L+ N +  I    F     L  L LA N I+ +  F+FS LRK+ S++L  N +  +   +F  + S+  + L  N +  +    F   + L++L+L  N++  + E     +  LE ++L
Sbjct:  124 HLEKLDLRSNLISTVTSEELSYLAAVRSVDLSRNLISYLPKPTTSAKVNIEKLDLASNSITDIGTDHFSSFNTLVTLKLARNHITTLNQFSFSRLRKLESLDLTRNMIREVRFLAFNQLPSLQNVSLARNDVYRLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDL 298          

HSP 4 Score: 62.003 bits (149), Expect = 6.866e-10
Identity = 49/206 (23.79%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  374 IIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED-INCIIRFPKIQLS 988
            +I  L +     +++++K  + SN +T I    F+S +TL  L LA N I  + + +F   + L  ++L+ N++  +    F  L +L  + LA N +  +    F +   +  + L+ N++ ++     F + S+  L L+ NQI+   + ++     L++LSL +N++  L    F  +++LE + L  + I+ + +F  + +S
Sbjct:  158 LISYLPKPTTSAKVNIEKLDLASNSITDIGTDHFSSFNTLVTLKLARNHITTLNQFSFSRLRKLESLDLTRNMIREVRFLAFNQLPSLQNVSLARNDVYRLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANSIDSLHKFALVGMS 363          

HSP 5 Score: 55.0694 bits (131), Expect = 8.998e-8
Identity = 50/200 (25.00%), Postives = 94/200 (47.00%), Query Frame = 2
Query:  341 NLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            N+EKL +    I D +    F +   L   K+  N +T + +  F+    L+ L L  N I+ +  LAF+   +L+ ++L+ N +  + +  F     L  L L+ NR+  +       L  +  ++L++NQ+ S  I S+ +   +  L L+ N+I+ +   +F+ L  L+ L L  N +  L +     M  L  ++L
Sbjct:  172 NIEKLDLASNSITD-IGTDHFSSFNTLVTLKLARNHITTLNQFSFSRLRKLESLDLTRNMIREVRFLAFNQLPSLQNVSLARNDVYRLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDL 370          
BLAST of SMED30015272 vs. Ensembl Celegans
Match: sma-10 (Leucine-rich repeats and immunoglobulin-like domains protein sma-10 [Source:UniProtKB/Swiss-Prot;Acc:Q965M2])

HSP 1 Score: 68.1662 bits (165), Expect = 7.545e-12
Identity = 57/210 (27.14%), Postives = 100/210 (47.62%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEE 898
            NI  + +   +I  +   +F  F  L  L +     I  L++  F     L+   +T N +  +    FN   +LQ +SLA N +  + +  F+ C+ L+ +NLS N +  + E    GL +L VL L++N+I      ++S   K+  + L+ N++ SL   SF  +  +  L+L+ N I  +   A  G+ +L  L L +N L +  E
Sbjct:  172 NIEKLDLASNSITDIGTDHFSSFNTLVTLKL-ARNHITTLNQFSFSRLRKLESLDLTRNMIREVRFLAFNQLPSLQNVSLARNDVYRLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDLSSNTLAVCVE 380          

HSP 2 Score: 65.4698 bits (158), Expect = 5.959e-11
Identity = 50/187 (26.74%), Postives = 91/187 (48.66%), Query Frame = 2
Query:  383 RLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSL--DIRSFFN--IHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFS--EMKRL 925
            RLD+G+F     LK   +++N++  +TE      ++L+ L L+ N I+     ++     L++++L  N +  +   +F  L  L  LIL+ N I  +  FA   +  +H ++L+ N L     D    +N  +  +  L   +NQ+R I  +AF+    L+ L L +N +  +    F   E+KRL
Sbjct:  257 RLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDLSSNTLAVCVEDGAVLYNTSMPFLRSLRFTNNQLRVIPKRAFERFPALEELDLTDNPIATIHPEAFEPLELKRL 443          

HSP 3 Score: 63.929 bits (154), Expect = 1.824e-10
Identity = 42/175 (24.00%), Postives = 85/175 (48.57%), Query Frame = 2
Query:  416 HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            HL+K  + SN ++ +T +  +  + ++ + L+ N I  + +       N+  ++L+ N +  I    F     L  L LA N I+ +  F+FS LRK+ S++L  N +  +   +F  + S+  + L  N +  +    F   + L++L+L  N++  + E     +  LE ++L
Sbjct:  124 HLEKLDLRSNLISTVTSEELSYLAAVRSVDLSRNLISYLPKPTTSAKVNIEKLDLASNSITDIGTDHFSSFNTLVTLKLARNHITTLNQFSFSRLRKLESLDLTRNMIREVRFLAFNQLPSLQNVSLARNDVYRLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDL 298          

HSP 4 Score: 62.003 bits (149), Expect = 6.866e-10
Identity = 49/206 (23.79%), Postives = 104/206 (50.49%), Query Frame = 2
Query:  374 IIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED-INCIIRFPKIQLS 988
            +I  L +     +++++K  + SN +T I    F+S +TL  L LA N I  + + +F   + L  ++L+ N++  +    F  L +L  + LA N +  +    F +   +  + L+ N++ ++     F + S+  L L+ NQI+   + ++     L++LSL +N++  L    F  +++LE + L  + I+ + +F  + +S
Sbjct:  158 LISYLPKPTTSAKVNIEKLDLASNSITDIGTDHFSSFNTLVTLKLARNHITTLNQFSFSRLRKLESLDLTRNMIREVRFLAFNQLPSLQNVSLARNDVYRLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANSIDSLHKFALVGMS 363          

HSP 5 Score: 55.0694 bits (131), Expect = 8.998e-8
Identity = 50/200 (25.00%), Postives = 94/200 (47.00%), Query Frame = 2
Query:  341 NLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            N+EKL +    I D +    F +   L   K+  N +T + +  F+    L+ L L  N I+ +  LAF+   +L+ ++L+ N +  + +  F     L  L L+ NR+  +       L  +  ++L++NQ+ S  I S+ +   +  L L+ N+I+ +   +F+ L  L+ L L  N +  L +     M  L  ++L
Sbjct:  172 NIEKLDLASNSITD-IGTDHFSSFNTLVTLKLARNHITTLNQFSFSRLRKLESLDLTRNMIREVRFLAFNQLPSLQNVSLARNDVYRLDDGMFYACEGLKHLNLSTNRVQAVTEGWMFGLTSLEVLDLSYNQIQSFHISSWSHTPKLKWLSLHSNRIQSLPSGSFRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDL 370          
BLAST of SMED30015272 vs. Ensembl Fly
Match: atk (gene:FBgn0036995 transcript:FBtr0331569)

HSP 1 Score: 94.3597 bits (233), Expect = 6.623e-20
Identity = 67/208 (32.21%), Postives = 111/208 (53.37%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRL 925
            +R +  + F+  + LE L +     +   DE        L+   + SNKL  IT+  F++ S L++L L+ N I+ I   AF T ++L +++LS N LL I       L NL  + L++N+IS I+       R +  I L++N ++ L   +F N+  +  L L+ N+IR++   A KGLD LQ   L +NKL+ L++ +F E+  L
Sbjct:  585 LRQLKDTSFIGIQRLELLHLQ-ENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDI-SVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSL 790          

HSP 2 Score: 63.929 bits (154), Expect = 2.507e-10
Identity = 59/225 (26.22%), Postives = 104/225 (46.22%), Query Frame = 2
Query:  272 ITAIMINPGNIRSVPASYFVDFR--NLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            +  I +    I S+PA+   D +  NL  L ++    I++L    F+  + L+   +  N+L  + +  F     L+ L L  N +    E A      LR +NL  N L  I +  F     L  L L+ N I  I P AF + R +  ++L+ N LL + +    N++++  + L+ NQI  I      G  N+  + L NN ++ L++  F  + +L+ ++L
Sbjct:  525 VERISLKGNQITSLPAAASKDLQLPNLRMLDLSQ-NRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISV-GLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDL 747          

HSP 3 Score: 60.8474 bits (146), Expect = 2.203e-9
Identity = 49/210 (23.33%), Postives = 103/210 (49.05%), Query Frame = 2
Query:  374 IIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMK-RLETVELDE---DINCIIRFPKIQLSE 991
            +I  L +G FRN   L+   ++SN++  +          LQE  LA+N +  + +  F    +L   +  +N L  I  ++F    +L  L L++N    ++     S+R +  ++L+ N +  +       ++ ++ L +++NQI  I    F+ +  L+ LS++NN+L  ++E  F  ++  +  +++D    D NC +++  + L E
Sbjct:  727 LIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPIDCNCEMQWLSVWLQE 936          

HSP 4 Score: 58.9214 bits (141), Expect = 1.038e-8
Identity = 58/233 (24.89%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTII-------TEKLFNSCSTLQEL--------------SLANNTIKVIFELAFHTCK--NLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            V +       +L +L ++  G+I+ L    FR+   L+   ++SN+LT I        E+LF   ++  +L              SL  N I  +   A    +  NLR ++LS N +  +    F+G + L VL LA N +  +K  +F  ++++  + L  NQL   D R+   +  +  L L  N++  I+   F     L+ L L  N +  +  + F   + LE ++L
Sbjct:  445 VDSQLLAGLPSLRRLDLSENGLIE-LAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDL 676          

HSP 5 Score: 57.7658 bits (138), Expect = 2.214e-8
Identity = 66/283 (23.32%), Postives = 114/283 (40.28%), Query Frame = 2
Query:  248 FLNCSTSNITAIMINPGNIRSVPA--SYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAF-------------SSLRKIHS--------------------------------IELNHNQLLSLDIRSFFNIH-SMIRLL-LNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
             L  S S + A+ +    I  V A  +       L  L ++G  ++  L  G  R    L++  +  N L +I      +   L+EL + NN++     L F     L+ ++L+ N    +  +   GL +L  L L+ N +  + P +F             + L KIHS                                I L  NQ+ SL   +  ++    +R+L L+ N+I  +    F+G   L+ LSL  N+L  L+++ F  ++RLE + L E+
Sbjct:  326 LLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSG-NLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQEN 607          

HSP 6 Score: 57.3806 bits (137), Expect = 2.607e-8
Identity = 57/207 (27.54%), Postives = 92/207 (44.44%), Query Frame = 2
Query:  326 FVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEK--LFNSCSTLQELSLANNTIKVIFELA--FHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETV 934
            FVD  NL +L +N   I + L  G F     LK   + +N +  I  +  L  S S ++ + + NN I  +  L         LR++++S NLL  +      G   L  L L HN +  I+  A  ++  +  + + +N L S     F+N+  +  L L  NQ   +  +   GL +L+ L L  N L+ L  + F     LET+
Sbjct:  278 FVDLPNLSELHLNDNRITE-LQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETL 483          

HSP 7 Score: 51.9878 bits (123), Expect = 1.256e-6
Identity = 51/181 (28.18%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  449 LTIITEKL-----FNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKT-FEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDI--RSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +TI +E+L     F+   +L  LS+    ++ +    F     L+ I+++    L   E   F+GL++L  L L+HN +++I   A S L  + S++L+HNQ+  + +  R   ++  + +L L++N I  I   +F  L NL  L L +N++  L+   F    +L+T+ L    N +IR
Sbjct:  142 ITIQSEELKHLPDFSGLLSLTYLSVQTGALQELPSHLFRHLPKLQHIHITGGSGLTRLEAGLFDGLISLKNLDLSHNGLNWIHLRALSRLPNLVSLKLSHNQISDVGMVGRIVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQ---NNLIR 319          

HSP 8 Score: 49.6766 bits (117), Expect = 6.413e-6
Identity = 43/175 (24.57%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  371 GIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTF--EGLVNLYVLILAHNRISFIKPFA--FSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL 883
            G++ R    I ++  HLKK ++ +N +T+I +  F     L EL L +N I  +   AF     L+ I L +NL+  I+ ++        +  + + +N I  ++       +L ++  ++++ N L  L   +     ++ +L LN N +R I   A   +  L+ L ++NN L
Sbjct:  248 GMVGR----IVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSL 418          
BLAST of SMED30015272 vs. Ensembl Fly
Match: atk (gene:FBgn0036995 transcript:FBtr0331570)

HSP 1 Score: 94.3597 bits (233), Expect = 6.623e-20
Identity = 67/208 (32.21%), Postives = 111/208 (53.37%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRL 925
            +R +  + F+  + LE L +     +   DE        L+   + SNKL  IT+  F++ S L++L L+ N I+ I   AF T ++L +++LS N LL I       L NL  + L++N+IS I+       R +  I L++N ++ L   +F N+  +  L L+ N+IR++   A KGLD LQ   L +NKL+ L++ +F E+  L
Sbjct:  585 LRQLKDTSFIGIQRLELLHLQ-ENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDI-SVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSL 790          

HSP 2 Score: 63.929 bits (154), Expect = 2.507e-10
Identity = 59/225 (26.22%), Postives = 104/225 (46.22%), Query Frame = 2
Query:  272 ITAIMINPGNIRSVPASYFVDFR--NLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            +  I +    I S+PA+   D +  NL  L ++    I++L    F+  + L+   +  N+L  + +  F     L+ L L  N +    E A      LR +NL  N L  I +  F     L  L L+ N I  I P AF + R +  ++L+ N LL + +    N++++  + L+ NQI  I      G  N+  + L NN ++ L++  F  + +L+ ++L
Sbjct:  525 VERISLKGNQITSLPAAASKDLQLPNLRMLDLSQ-NRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISV-GLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDL 747          

HSP 3 Score: 60.8474 bits (146), Expect = 2.203e-9
Identity = 49/210 (23.33%), Postives = 103/210 (49.05%), Query Frame = 2
Query:  374 IIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMK-RLETVELDE---DINCIIRFPKIQLSE 991
            +I  L +G FRN   L+   ++SN++  +          LQE  LA+N +  + +  F    +L   +  +N L  I  ++F    +L  L L++N    ++     S+R +  ++L+ N +  +       ++ ++ L +++NQI  I    F+ +  L+ LS++NN+L  ++E  F  ++  +  +++D    D NC +++  + L E
Sbjct:  727 LIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPIDCNCEMQWLSVWLQE 936          

HSP 4 Score: 58.9214 bits (141), Expect = 1.038e-8
Identity = 58/233 (24.89%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTII-------TEKLFNSCSTLQEL--------------SLANNTIKVIFELAFHTCK--NLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            V +       +L +L ++  G+I+ L    FR+   L+   ++SN+LT I        E+LF   ++  +L              SL  N I  +   A    +  NLR ++LS N +  +    F+G + L VL LA N +  +K  +F  ++++  + L  NQL   D R+   +  +  L L  N++  I+   F     L+ L L  N +  +  + F   + LE ++L
Sbjct:  445 VDSQLLAGLPSLRRLDLSENGLIE-LAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDL 676          

HSP 5 Score: 57.7658 bits (138), Expect = 2.214e-8
Identity = 66/283 (23.32%), Postives = 114/283 (40.28%), Query Frame = 2
Query:  248 FLNCSTSNITAIMINPGNIRSVPA--SYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAF-------------SSLRKIHS--------------------------------IELNHNQLLSLDIRSFFNIH-SMIRLL-LNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
             L  S S + A+ +    I  V A  +       L  L ++G  ++  L  G  R    L++  +  N L +I      +   L+EL + NN++     L F     L+ ++L+ N    +  +   GL +L  L L+ N +  + P +F             + L KIHS                                I L  NQ+ SL   +  ++    +R+L L+ N+I  +    F+G   L+ LSL  N+L  L+++ F  ++RLE + L E+
Sbjct:  326 LLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSG-NLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQEN 607          

HSP 6 Score: 57.3806 bits (137), Expect = 2.607e-8
Identity = 57/207 (27.54%), Postives = 92/207 (44.44%), Query Frame = 2
Query:  326 FVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEK--LFNSCSTLQELSLANNTIKVIFELA--FHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETV 934
            FVD  NL +L +N   I + L  G F     LK   + +N +  I  +  L  S S ++ + + NN I  +  L         LR++++S NLL  +      G   L  L L HN +  I+  A  ++  +  + + +N L S     F+N+  +  L L  NQ   +  +   GL +L+ L L  N L+ L  + F     LET+
Sbjct:  278 FVDLPNLSELHLNDNRITE-LQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETL 483          

HSP 7 Score: 51.9878 bits (123), Expect = 1.256e-6
Identity = 51/181 (28.18%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  449 LTIITEKL-----FNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKT-FEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDI--RSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +TI +E+L     F+   +L  LS+    ++ +    F     L+ I+++    L   E   F+GL++L  L L+HN +++I   A S L  + S++L+HNQ+  + +  R   ++  + +L L++N I  I   +F  L NL  L L +N++  L+   F    +L+T+ L    N +IR
Sbjct:  142 ITIQSEELKHLPDFSGLLSLTYLSVQTGALQELPSHLFRHLPKLQHIHITGGSGLTRLEAGLFDGLISLKNLDLSHNGLNWIHLRALSRLPNLVSLKLSHNQISDVGMVGRIVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQ---NNLIR 319          

HSP 8 Score: 49.6766 bits (117), Expect = 6.413e-6
Identity = 43/175 (24.57%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  371 GIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTF--EGLVNLYVLILAHNRISFIKPFA--FSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL 883
            G++ R    I ++  HLKK ++ +N +T+I +  F     L EL L +N I  +   AF     L+ I L +NL+  I+ ++        +  + + +N I  ++       +L ++  ++++ N L  L   +     ++ +L LN N +R I   A   +  L+ L ++NN L
Sbjct:  248 GMVGR----IVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSL 418          
BLAST of SMED30015272 vs. Ensembl Fly
Match: atk (gene:FBgn0036995 transcript:FBtr0078223)

HSP 1 Score: 94.3597 bits (233), Expect = 6.623e-20
Identity = 67/208 (32.21%), Postives = 111/208 (53.37%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRL 925
            +R +  + F+  + LE L +     +   DE        L+   + SNKL  IT+  F++ S L++L L+ N I+ I   AF T ++L +++LS N LL I       L NL  + L++N+IS I+       R +  I L++N ++ L   +F N+  +  L L+ N+IR++   A KGLD LQ   L +NKL+ L++ +F E+  L
Sbjct:  585 LRQLKDTSFIGIQRLELLHLQ-ENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDI-SVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSL 790          

HSP 2 Score: 63.929 bits (154), Expect = 2.507e-10
Identity = 59/225 (26.22%), Postives = 104/225 (46.22%), Query Frame = 2
Query:  272 ITAIMINPGNIRSVPASYFVDFR--NLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            +  I +    I S+PA+   D +  NL  L ++    I++L    F+  + L+   +  N+L  + +  F     L+ L L  N +    E A      LR +NL  N L  I +  F     L  L L+ N I  I P AF + R +  ++L+ N LL + +    N++++  + L+ NQI  I      G  N+  + L NN ++ L++  F  + +L+ ++L
Sbjct:  525 VERISLKGNQITSLPAAASKDLQLPNLRMLDLSQ-NRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISV-GLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDL 747          

HSP 3 Score: 60.8474 bits (146), Expect = 2.203e-9
Identity = 49/210 (23.33%), Postives = 103/210 (49.05%), Query Frame = 2
Query:  374 IIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMK-RLETVELDE---DINCIIRFPKIQLSE 991
            +I  L +G FRN   L+   ++SN++  +          LQE  LA+N +  + +  F    +L   +  +N L  I  ++F    +L  L L++N    ++     S+R +  ++L+ N +  +       ++ ++ L +++NQI  I    F+ +  L+ LS++NN+L  ++E  F  ++  +  +++D    D NC +++  + L E
Sbjct:  727 LIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPIDCNCEMQWLSVWLQE 936          

HSP 4 Score: 58.9214 bits (141), Expect = 1.038e-8
Identity = 58/233 (24.89%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTII-------TEKLFNSCSTLQEL--------------SLANNTIKVIFELAFHTCK--NLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            V +       +L +L ++  G+I+ L    FR+   L+   ++SN+LT I        E+LF   ++  +L              SL  N I  +   A    +  NLR ++LS N +  +    F+G + L VL LA N +  +K  +F  ++++  + L  NQL   D R+   +  +  L L  N++  I+   F     L+ L L  N +  +  + F   + LE ++L
Sbjct:  445 VDSQLLAGLPSLRRLDLSENGLIE-LAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDL 676          

HSP 5 Score: 57.7658 bits (138), Expect = 2.214e-8
Identity = 66/283 (23.32%), Postives = 114/283 (40.28%), Query Frame = 2
Query:  248 FLNCSTSNITAIMINPGNIRSVPA--SYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAF-------------SSLRKIHS--------------------------------IELNHNQLLSLDIRSFFNIH-SMIRLL-LNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
             L  S S + A+ +    I  V A  +       L  L ++G  ++  L  G  R    L++  +  N L +I      +   L+EL + NN++     L F     L+ ++L+ N    +  +   GL +L  L L+ N +  + P +F             + L KIHS                                I L  NQ+ SL   +  ++    +R+L L+ N+I  +    F+G   L+ LSL  N+L  L+++ F  ++RLE + L E+
Sbjct:  326 LLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSG-NLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQEN 607          

HSP 6 Score: 57.3806 bits (137), Expect = 2.607e-8
Identity = 57/207 (27.54%), Postives = 92/207 (44.44%), Query Frame = 2
Query:  326 FVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEK--LFNSCSTLQELSLANNTIKVIFELA--FHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETV 934
            FVD  NL +L +N   I + L  G F     LK   + +N +  I  +  L  S S ++ + + NN I  +  L         LR++++S NLL  +      G   L  L L HN +  I+  A  ++  +  + + +N L S     F+N+  +  L L  NQ   +  +   GL +L+ L L  N L+ L  + F     LET+
Sbjct:  278 FVDLPNLSELHLNDNRITE-LQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETL 483          

HSP 7 Score: 51.9878 bits (123), Expect = 1.256e-6
Identity = 51/181 (28.18%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  449 LTIITEKL-----FNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKT-FEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDI--RSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +TI +E+L     F+   +L  LS+    ++ +    F     L+ I+++    L   E   F+GL++L  L L+HN +++I   A S L  + S++L+HNQ+  + +  R   ++  + +L L++N I  I   +F  L NL  L L +N++  L+   F    +L+T+ L    N +IR
Sbjct:  142 ITIQSEELKHLPDFSGLLSLTYLSVQTGALQELPSHLFRHLPKLQHIHITGGSGLTRLEAGLFDGLISLKNLDLSHNGLNWIHLRALSRLPNLVSLKLSHNQISDVGMVGRIVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQ---NNLIR 319          

HSP 8 Score: 49.6766 bits (117), Expect = 6.413e-6
Identity = 43/175 (24.57%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  371 GIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTF--EGLVNLYVLILAHNRISFIKPFA--FSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL 883
            G++ R    I ++  HLKK ++ +N +T+I +  F     L EL L +N I  +   AF     L+ I L +NL+  I+ ++        +  + + +N I  ++       +L ++  ++++ N L  L   +     ++ +L LN N +R I   A   +  L+ L ++NN L
Sbjct:  248 GMVGR----IVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSL 418          
BLAST of SMED30015272 vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0075614)

HSP 1 Score: 87.0409 bits (214), Expect = 1.301e-17
Identity = 69/247 (27.94%), Postives = 126/247 (51.01%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLF-NSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIY--EKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGEN 1042
            +PA+ F   R L  L +N  GI    D+ +   + +L+   ++SNK+  +  +LF      +QE+ L NN+I V+    F     L+ ++LS N +   +  + TF GL+ L +L L+HN+++ ++P  FS L  +  + L HNQL ++   +F  ++++  LLL+ N+++ +   A  GL  L  LSL NN L+ +    F     L+ + L+ +        +++     +  +R  R+   GEN
Sbjct:  292 LPANGFGTLRRLRVLSVNNNGISMIADKALSGLK-NLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGN--------QLKTVPLALRNMRHLRTVDLGEN 529          

HSP 2 Score: 70.0922 bits (170), Expect = 3.092e-12
Identity = 64/240 (26.67%), Postives = 111/240 (46.25%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLY------------------------VLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFF-NIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEE--SMFSEMKRLETVEL 940
            + ++ A  F    NL  L+++    +  LD         L    + +N L  +    F +CS LQ+L+L  N +K +  LA    ++LR ++L  N++  + +  F+GL NLY                        +L LA NRI+ ++P AF     I ++ L+ N+L   DI   F N+ S++ L ++DN++             LQ+L L  N+L  L     + SE+K L+T+++
Sbjct:  436 LENIAADTFAPMNNLHTLLLSH-NKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTV-PLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNEL--NDINGLFSNMPSLLWLNISDNRLESFDYGHVPS--TLQWLDLHKNRLSSLSNRFGLDSELK-LQTLDV 668          

HSP 3 Score: 68.9366 bits (167), Expect = 7.352e-12
Identity = 70/285 (24.56%), Postives = 140/285 (49.12%), Query Frame = 2
Query:  146 VVQSHQSVFCPVNWEITSIIVSIT-------MPYKSDW---DNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNR-------IHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTF-EGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLS--LDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
             +++H  ++  +N+EI +   S+T       +   + W   DN+F  C+ S ++A+ ++   ++ V     + FR+  K   NG        E   ++        + L+   ++ N   ++    F +   L+ LS+ NN I +I + A    KNL+ +NLS N ++ +  + F E    +  + L +N IS + P  FS+L ++ +++L+ NQ+ S  +D  +F  +  ++ L L+ N++  +  + F  L  LQ L+L++N+L  +    F+ M  L T+ L
Sbjct:  176 TLRTHNILWPALNFEIEADAFSVTRRLERLDLSSNNIWSLPDNIF--CTLSELSALNMSENRLQDVNE---LGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLL 455          
BLAST of SMED30015272 vs. Ensembl Fly
Match: Toll-6 (gene:FBgn0036494 transcript:FBtr0306307)

HSP 1 Score: 87.0409 bits (214), Expect = 1.301e-17
Identity = 69/247 (27.94%), Postives = 126/247 (51.01%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLF-NSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIY--EKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGEN 1042
            +PA+ F   R L  L +N  GI    D+ +   + +L+   ++SNK+  +  +LF      +QE+ L NN+I V+    F     L+ ++LS N +   +  + TF GL+ L +L L+HN+++ ++P  FS L  +  + L HNQL ++   +F  ++++  LLL+ N+++ +   A  GL  L  LSL NN L+ +    F     L+ + L+ +        +++     +  +R  R+   GEN
Sbjct:  292 LPANGFGTLRRLRVLSVNNNGISMIADKALSGLK-NLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGN--------QLKTVPLALRNMRHLRTVDLGEN 529          

HSP 2 Score: 70.0922 bits (170), Expect = 3.092e-12
Identity = 64/240 (26.67%), Postives = 111/240 (46.25%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLY------------------------VLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFF-NIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEE--SMFSEMKRLETVEL 940
            + ++ A  F    NL  L+++    +  LD         L    + +N L  +    F +CS LQ+L+L  N +K +  LA    ++LR ++L  N++  + +  F+GL NLY                        +L LA NRI+ ++P AF     I ++ L+ N+L   DI   F N+ S++ L ++DN++             LQ+L L  N+L  L     + SE+K L+T+++
Sbjct:  436 LENIAADTFAPMNNLHTLLLSH-NKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTV-PLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNEL--NDINGLFSNMPSLLWLNISDNRLESFDYGHVPS--TLQWLDLHKNRLSSLSNRFGLDSELK-LQTLDV 668          

HSP 3 Score: 68.9366 bits (167), Expect = 7.352e-12
Identity = 70/285 (24.56%), Postives = 140/285 (49.12%), Query Frame = 2
Query:  146 VVQSHQSVFCPVNWEITSIIVSIT-------MPYKSDW---DNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNR-------IHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTF-EGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLS--LDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
             +++H  ++  +N+EI +   S+T       +   + W   DN+F  C+ S ++A+ ++   ++ V     + FR+  K   NG        E   ++        + L+   ++ N   ++    F +   L+ LS+ NN I +I + A    KNL+ +NLS N ++ +  + F E    +  + L +N IS + P  FS+L ++ +++L+ NQ+ S  +D  +F  +  ++ L L+ N++  +  + F  L  LQ L+L++N+L  +    F+ M  L T+ L
Sbjct:  176 TLRTHNILWPALNFEIEADAFSVTRRLERLDLSSNNIWSLPDNIF--CTLSELSALNMSENRLQDVNE---LGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLL 455          
BLAST of SMED30015272 vs. Ensembl Zebrafish
Match: igfals (insulin-like growth factor binding protein, acid labile subunit [Source:ZFIN;Acc:ZDB-GENE-061009-25])

HSP 1 Score: 104.375 bits (259), Expect = 2.624e-23
Identity = 65/211 (30.81%), Postives = 116/211 (54.98%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            +P + F D   L +LI+ G   +  L   +F+    LK+  +T N L +I   +F     LQ+L L  N I  +   AF   K+LR+++LS N L  ++++TF GL +L+VL L++N I+ ++P  F  L+ +  + L HNQ+ +L +R F  +  +  L L +N++++  M  F GL++L  + L  +    L + +F  + +L ++ LD
Sbjct:  193 LPETGFQDLHGLRELILAG-NRLAYLQPQLFQGLNELKELDLTGNYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLD 402          

HSP 2 Score: 82.0333 bits (201), Expect = 4.851e-16
Identity = 71/239 (29.71%), Postives = 115/239 (48.12%), Query Frame = 2
Query:  257 CSTSNITAIMIN-PGNIRSV----------PASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            CST N T +  + P + RS+          PA  F    NLE L +    ++  LD   FR    L    +  N L  ++  +F   S L  LSL NN +  I +  F    ++  +NL  NLL  + E  F+ L  L  LILA NR+++++P  F  L ++  ++L  N L  +    F  +  + +L L  NQI  ++ +AF G+ +L++L L  N+L +L +  F  ++ L  + L
Sbjct:   68 CSTRNFTQVPSDIPLSTRSLWLDGNLFSNLPAGAFEKLTNLEFLNLQS-SLLVSLDAHAFRGLNSLAHLHLERNNLRSLSGLVFQGTSNLATLSLNNNQMFRIDDRLFAGMSHMWLLNLGWNLLSVLPETGFQDLHGLRELILAGNRLAYLQPQLFQGLNELKELDLTGNYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRL 305          

HSP 3 Score: 72.4034 bits (176), Expect = 4.570e-13
Identity = 58/216 (26.85%), Postives = 111/216 (51.39%), Query Frame = 2
Query:  296 GN-IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            GN ++ + A+ F+    L+KL + G   I  +    F     L+   ++ N+LT++ ++ F    +L  L L+NN+I  +    F   + L  + L HN +  +  + FEGL +L VL L +NR+   +   F  L  +  ++L  +   SL  + F  +  +  + L+ + +  +S ++F GL  L+ L L++N + L+E   F E++RL+ ++L
Sbjct:  235 GNYLKVIKANVFLKLPKLQKLYL-GQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDL 449          

HSP 4 Score: 71.2478 bits (173), Expect = 1.199e-12
Identity = 57/228 (25.00%), Postives = 108/228 (47.37%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDI--NCIIRFPK 976
            +I S+    F D + LE+L +     I  L   +F    HL+   + +N+L       F   + L  + L  +    + +  F     L  I+L  + L  +  ++F GL  L  L L HN IS ++  +F  L+++  ++L  N+L ++   +F+ + ++  LLL+ N + ++  +A   L +L +L L  NKL L+  +    + RL  + L ++I  N  +  P+
Sbjct:  309 SINSLRPGTFRDLQYLEELCLYH-NQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDLRFNKLTTITSNTFYGLKNLDYLLLSGNLLHNLPAEALLPLQHLSWLDLSGNKLELILNATIYMLPRLRYLNLKDNILVNLPVSIPE 535          
BLAST of SMED30015272 vs. Ensembl Zebrafish
Match: igfals (insulin-like growth factor binding protein, acid labile subunit [Source:ZFIN;Acc:ZDB-GENE-061009-25])

HSP 1 Score: 104.375 bits (259), Expect = 2.624e-23
Identity = 65/211 (30.81%), Postives = 116/211 (54.98%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            +P + F D   L +LI+ G   +  L   +F+    LK+  +T N L +I   +F     LQ+L L  N I  +   AF   K+LR+++LS N L  ++++TF GL +L+VL L++N I+ ++P  F  L+ +  + L HNQ+ +L +R F  +  +  L L +N++++  M  F GL++L  + L  +    L + +F  + +L ++ LD
Sbjct:  193 LPETGFQDLHGLRELILAG-NRLAYLQPQLFQGLNELKELDLTGNYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLD 402          

HSP 2 Score: 82.0333 bits (201), Expect = 4.851e-16
Identity = 71/239 (29.71%), Postives = 115/239 (48.12%), Query Frame = 2
Query:  257 CSTSNITAIMIN-PGNIRSV----------PASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            CST N T +  + P + RS+          PA  F    NLE L +    ++  LD   FR    L    +  N L  ++  +F   S L  LSL NN +  I +  F    ++  +NL  NLL  + E  F+ L  L  LILA NR+++++P  F  L ++  ++L  N L  +    F  +  + +L L  NQI  ++ +AF G+ +L++L L  N+L +L +  F  ++ L  + L
Sbjct:   68 CSTRNFTQVPSDIPLSTRSLWLDGNLFSNLPAGAFEKLTNLEFLNLQS-SLLVSLDAHAFRGLNSLAHLHLERNNLRSLSGLVFQGTSNLATLSLNNNQMFRIDDRLFAGMSHMWLLNLGWNLLSVLPETGFQDLHGLRELILAGNRLAYLQPQLFQGLNELKELDLTGNYLKVIKANVFLKLPKLQKLYLGQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRL 305          

HSP 3 Score: 72.4034 bits (176), Expect = 4.570e-13
Identity = 58/216 (26.85%), Postives = 111/216 (51.39%), Query Frame = 2
Query:  296 GN-IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            GN ++ + A+ F+    L+KL + G   I  +    F     L+   ++ N+LT++ ++ F    +L  L L+NN+I  +    F   + L  + L HN +  +  + FEGL +L VL L +NR+   +   F  L  +  ++L  +   SL  + F  +  +  + L+ + +  +S ++F GL  L+ L L++N + L+E   F E++RL+ ++L
Sbjct:  235 GNYLKVIKANVFLKLPKLQKLYL-GQNQIVTVAPRAFVGMKSLRWLDLSRNRLTVLHDETFIGLQSLHVLRLSNNSINSLRPGTFRDLQYLEELCLYHNQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDL 449          

HSP 4 Score: 71.2478 bits (173), Expect = 1.199e-12
Identity = 57/228 (25.00%), Postives = 108/228 (47.37%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDI--NCIIRFPK 976
            +I S+    F D + LE+L +     I  L   +F    HL+   + +N+L       F   + L  + L  +    + +  F     L  I+L  + L  +  ++F GL  L  L L HN IS ++  +F  L+++  ++L  N+L ++   +F+ + ++  LLL+ N + ++  +A   L +L +L L  NKL L+  +    + RL  + L ++I  N  +  P+
Sbjct:  309 SINSLRPGTFRDLQYLEELCLYH-NQIRALGVRVFEGLGHLEVLNLENNRLQEARMGTFMGLNHLAVMKLTGSCFHSLPDQVFKGLSKLHSIHLDRSCLTKVSSQSFSGLTGLRRLFLQHNNISLVERQSFVELQRLQQLDLRFNKLTTITSNTFYGLKNLDYLLLSGNLLHNLPAEALLPLQHLSWLDLSGNKLELILNATIYMLPRLRYLNLKDNILVNLPVSIPE 535          
BLAST of SMED30015272 vs. Ensembl Zebrafish
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 102.449 bits (254), Expect = 1.358e-22
Identity = 89/325 (27.38%), Postives = 158/325 (48.62%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRS----FFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSENVV----------SRLRKFRSCY---KGE---NDLKTPSTTISAK-----------FHLNSSRTSEELKKYSWEKNIDELSSSLIKIQ 1174
            +R V    F     L  L +   GI  RL +G F    +++  ++  N LT +++       TLQ+L L++N+I  I   A+  C+ L  ++LS N L  + E +F GL  L  L + +NRISFI   AF  L  + +++L  N+ +S  I      F  + ++ +L L  N+IR ++ K+F GL+ L+ L L NN +M L+ + FS+MK+L  + L+      +C +++  + ++E               L K RS +   + E   +D   P  T+  +           F  +++ +S+    ++W+K+ + LS   I+ Q
Sbjct:  100 LRRVEGLTFQGLHGLRSLKMQRNGI-SRLMDGAFWGLNNMEVLQLEFNNLTEVSKGWLYGLLTLQQLHLSHNSISRIKPDAWEFCQKLAELDLSWNQLSRLEEGSFVGLSVLEQLHIGNNRISFIADGAFRGLTNLQTLDLKFNE-ISWTIEDMNGPFSALDNLRKLFLQGNRIRSVTRKSFTGLEMLEQLDLSNNAIMSLQANAFSQMKKLSELHLNTSSLLCDCQLKWFSLWVAEQAFLALLNASCAHPHLLKGRSVFSIAQDEFVCDDFPKPQITVQPETQSAIKGNNVTFVCSAASSSDSPMTFAWKKDNELLSEPEIQNQ 422          

HSP 2 Score: 82.8037 bits (203), Expect = 2.589e-16
Identity = 54/171 (31.58%), Postives = 88/171 (51.46%), Query Frame = 2
Query:  416 HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLE 928
            HL+  +++ N+L  +    F     L+ L +  N I  + + AF    N+  + L  N L  + +    GL+ L  L L+HN IS IKP A+   +K+  ++L+ NQL  L+  SF  +  + +L + +N+I  I+  AF+GL NLQ L LK N++    E M      L+
Sbjct:   89 HLQHLELSRNRLRRVEGLTFQGLHGLRSLKMQRNGISRLMDGAFWGLNNMEVLQLEFNNLTEVSKGWLYGLLTLQQLHLSHNSISRIKPDAWEFCQKLAELDLSWNQLSRLEEGSFVGLSVLEQLHIGNNRISFIADGAFRGLTNLQTLDLKFNEISWTIEDMNGPFSALD 259          
BLAST of SMED30015272 vs. Ensembl Zebrafish
Match: si:dkey-182i3.11 (si:dkey-182i3.11 [Source:ZFIN;Acc:ZDB-GENE-121214-258])

HSP 1 Score: 102.064 bits (253), Expect = 2.061e-22
Identity = 88/319 (27.59%), Postives = 146/319 (45.77%), Query Frame = 2
Query:  263 TSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIID-----------------------------------------------RLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDLK-TPSTTISA 1075
            TSN+T++ +   +I S+P + F +  +L+ L ++  G++                                                 L   +F+N   LK+ ++ SN +++I   LF+  S L++L L NN I  +    F   + L+ +++S N L  I    F    NL  L L +N ISFI  F+F +L ++ S++L+HN L  L      N+  +  LLLN+NQI  I +  FKGL+NL+ L L NNK+  +    F+++  L+  +LD   N +   P     E++ + LR     +   N L+  PS   SA
Sbjct:  233 TSNLTSLYLQKNDITSIPDNVFSEILSLKHLDLSYNGLVSISNGSFRSLSQLVYLDLSFNQLQTLTQHVFEDLGKLENLNLYHNKLTSLPNNMFKNLTMLKELQLDSNNISVIPPDLFHPLSALKDLQLDNNHISKLHSHTFKKLRQLKQLDISSNDLTKIPNHLFHK--NLKELNLENNHISFISKFSFKNLHRLQSLKLSHNNLSKLYRELLTNLTRLRELLLNENQIETIPVGFFKGLENLRVLDLSNNKMHFILPDAFNDLSALK--DLDLSFNFLHNLP-----EDIFASLRNLTKLHLQNNKLRYLPSRLFSA 542          

HSP 2 Score: 83.1889 bits (204), Expect = 2.301e-16
Identity = 73/282 (25.89%), Postives = 135/282 (47.87%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCII---------RFPKIQLSENVVS--------RLRKFRSCYKGENDL-KTPS 1060
            N+  + ++   I+S+P  +     NL+ L +N   I+  L  G+    + L   ++  N + +I   +F +C+ L +L L+ N +K +   +F     L  ++L  N L GI     +   NL  L L  N I+ I    FS +  +  ++L++N L+S+   SF ++  ++ L L+ NQ++ ++   F+ L  L+ L+L +NKL  L  +MF  +  L+ ++LD +   +I             +QL  N +S        +LR+ +      NDL K P+
Sbjct:  115 NLQVLDLSNNAIKSLPQMFLYGLINLQTLNLNINQILS-LSYGVLEGPLALTDLQLRDNMIDMIEMNVFENCTYLAKLYLSKNKLKSVGNGSFKGATGLNHLDLGLNGLAGIPTIVLQETSNLTSLYLQKNDITSIPDNVFSEILSLKHLDLSYNGLVSISNGSFRSLSQLVYLDLSFNQLQTLTQHVFEDLGKLENLNLYHNKLTSLPNNMFKNLTMLKELQLDSNNISVIPPDLFHPLSALKDLQLDNNHISKLHSHTFKKLRQLKQLDISSNDLTKIPN 395          

HSP 3 Score: 72.0182 bits (175), Expect = 6.884e-13
Identity = 69/245 (28.16%), Postives = 120/245 (48.98%), Query Frame = 2
Query:  401 FRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDE---DINCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKTPSTTISAKFHLNSSRTSEELKKYS 1126
            F+N   L+  K++ N L+ +  +L  + + L+EL L  N I+ I    F   +NLR ++LS+N +  I    F  L  L  L L+ N +  +    F+SLR +  + L +N+L  L  R F  +  +  L L+ N I+ I    F+GL  L  L +K+N+L  +E+     +++L+ + LD    D + ++     Q   N    ++    C  G+N L  P+   S+   LNS+  S  +K+ +
Sbjct:  420 FKNLHRLQSLKLSHNNLSKLYRELLTNLTRLRELLLNENQIETIPVGFFKGLENLRVLDLSNNKMHFILPDAFNDLSALKDLDLSFNFLHNLPEDIFASLRNLTKLHLQNNKLRYLPSRLFSALVGLEELHLDRNYIQRIHPTQFEGLVKLHELDMKSNQLRSMEDGTLMPLRKLKRIHLDGNPWDCSTVVILYISQWFNNNTQLVKTTPMCSSGQN-LSNPALFPSSL--LNSACFSANIKQLT 661          

HSP 4 Score: 62.3882 bits (150), Expect = 7.132e-10
Identity = 60/211 (28.44%), Postives = 90/211 (42.65%), Query Frame = 2
Query:  422 KKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKT 1054
            K F  T NK+  +  + F+    L+ L L  N   +     + + + L  ++L  N L  +  + FEGL+NL VL L++N I  +       L  + ++ LN NQ+LSL         ++  L L DN I  I M  F+    L  L L  NKL  +    F     L    LD  +N +   P I L E          S Y  +ND+ +
Sbjct:   48 KHFYATRNKIQALPNETFHE---LRVLDLTKNVFNLSLNTNWQSVRGLTHLHLGGNRLRALTPRQFEGLLNLQVLDLSNNAIKSLPQMFLYGLINLQTLNLNINQILSLSYGVLEGPLALTDLQLRDNMIDMIEMNVFENCTYLAKLYLSKNKLKSVGNGSFKGATGLN--HLDLGLNGLAGIPTIVLQET-----SNLTSLYLQKNDITS 248          

HSP 5 Score: 54.6842 bits (130), Expect = 1.976e-7
Identity = 48/174 (27.59%), Postives = 83/174 (47.70%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            L    +  N+L  +T + F     LQ L L+NN IK + ++  +   NL+ +NL+ N +L +     EG + L  L L  N I  I+   F +   +  + L+ N+L S+   SF     +  L L  N +  I     +   NL  L L+ N +  + +++FSE+  L+ ++L
Sbjct:   92 LTHLHLGGNRLRALTPRQFEGLLNLQVLDLSNNAIKSLPQMFLYGLINLQTLNLNINQILSLSYGVLEGPLALTDLQLRDNMIDMIEMNVFENCTYLAKLYLSKNKLKSVGNGSFKGATGLNHLDLGLNGLAGIPTIVLQETSNLTSLYLQKNDITSIPDNVFSEILSLKHLDL 265          
BLAST of SMED30015272 vs. Ensembl Zebrafish
Match: lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:ZFIN;Acc:ZDB-GENE-031113-23])

HSP 1 Score: 97.8265 bits (242), Expect = 5.141e-21
Identity = 61/194 (31.44%), Postives = 101/194 (52.06%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQL---LSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            I +L +G F     ++   +  N L  +         +L +L LANN+I       +  C+ LR +NLS+N L  + E +F  LVNL  L L HN IS I   AF  L  + ++EL+HN +   +     +F  + ++ +L L  N+I+ ++ KAF GL+ L++L+L  N +  ++   FS+MK L  + +  D
Sbjct:  214 ISKLTDGAFWGLARMRVLHLDYNSLREVNSGSLYGLESLLQLYLANNSISNFNPEGWGFCERLRELNLSYNNLTKLSEGSFAKLVNLISLRLGHNSISHITEGAFRGLSSLRTLELDHNDISGTIEDTSGAFTGLENLNKLTLFGNKIKSVAKKAFSGLEALEHLNLGENAIRSIQPEAFSKMKNLRYLHIQSD 407          

HSP 2 Score: 60.8474 bits (146), Expect = 2.671e-9
Identity = 70/271 (25.83%), Postives = 120/271 (44.28%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNL----RFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKTPSTTISAKFHLNSSRTSEELKKYSWEKNIDELSSSLIKIQN 1177
            I RL+  + +N   L+   +++N +T + E  F     +++L L++N I     L F   KNL    + + LS N L  +  K  E L  L  L L+ NR+  I+   F  L  +  ++L  N +  L   +F+ +  M  L L+ N +R+++  +  GL++L  L L NN +       +   +RL   EL+   N + +     LSE   ++L    S   G N +   S      F   SS  + EL        I++ S +   ++N
Sbjct:   94 IRRLEGSLLQNFSALETLDLSNNDITELREHCFPLGLQIKDLHLSSNKI---VHLEFGAFKNLAGSLQILRLSRNRLTHLPVKGLE-LPKLTQLELSRNRLRLIEGLTFQGLSSLEVLKLQRNNISKLTDGAFWGLARMRVLHLDYNSLREVNSGSLYGLESLLQLYLANNSISNFNPEGWGFCERLR--ELNLSYNNLTK-----LSEGSFAKLVNLISLRLGHNSI---SHITEGAFRGLSSLRTLELDHNDISGTIEDTSGAFTGLEN 350          

HSP 3 Score: 55.8398 bits (133), Expect = 8.890e-8
Identity = 38/125 (30.40%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFE---LAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLL 742
            + +L EG F   ++L   ++  N ++ ITE  F   S+L+ L L +N I    E    AF   +NL  + L  N +  + +K F GL  L  L L  N I  I+P AFS ++ +  + +  +  L
Sbjct:  286 LTKLSEGSFAKLVNLISLRLGHNSISHITEGAFRGLSSLRTLELDHNDISGTIEDTSGAFTGLENLNKLTLFGNKIKSVAKKAFSGLEALEHLNLGENAIRSIQPEAFSKMKNLRYLHIQSDSFL 410          
BLAST of SMED30015272 vs. Ensembl Xenopus
Match: IGFALS (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:100489984])

HSP 1 Score: 97.0561 bits (240), Expect = 1.080e-20
Identity = 56/184 (30.43%), Postives = 109/184 (59.24%), Query Frame = 2
Query:  398 IFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            IF++   L +  +  NK+ I+ E+ F   + L+ LSL +N ++ I   +F    N+  INLS N L  + E  F+GL  L+ L +  + +S IKP  F+ L  I  + L +N++++++  SF ++H ++ L L  N++  ++ ++F GL NL YL L +N+++ +   +FS +++L+ ++L ++
Sbjct:  302 IFKDLQFLVELNLGQNKIKILLERTFEGLAQLELLSLNHNNVQEIRPGSFLGLLNVAVINLSGNCLKSLAEHCFKGLGKLHSLHMESSCLSHIKPQMFAGLSSIRRLFLQNNEIVAIENHSFTDLHGLLELDLRSNKLTHLTTRSFTGLKNLSYLLLSSNQILTISPEVFSPVQQLQWLDLSDN 485          

HSP 2 Score: 96.2857 bits (238), Expect = 1.784e-20
Identity = 65/211 (30.81%), Postives = 112/211 (53.08%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            +P   F D  NL +L++ G  ++  L   +F +   LK+  ++ N L  I   +F       +L L +N I  +   AF   KNLR+++LSHN L  +YE TF GL +L VL L++N ++ ++P  F  L+ +  + L  N++  L  R+F  +  +  L LN N +++I   +F GL N+  ++L  N L  L E  F  + +L ++ ++
Sbjct:  178 LPDMVFHDLLNLRELVLAGNRLV-YLQPSLFLSLGELKELDLSGNSLKGIKANVFTRQQKTHKLYLNHNHISTVAPRAFSGMKNLRWLDLSHNRLTALYEDTFFGLPSLNVLRLSNNSLTSLRPRIFKDLQFLVELNLGQNKIKILLERTFEGLAQLELLSLNHNNVQEIRPGSFLGLLNVAVINLSGNCLKSLAEHCFKGLGKLHSLHME 387          

HSP 3 Score: 92.0485 bits (227), Expect = 4.339e-19
Identity = 75/260 (28.85%), Postives = 129/260 (49.62%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR---------FPKIQLSENVVSRLRKFRSCYKGENDLKT 1054
            I+S+  S F   +NL  L +N    + ++++G+F    +L    +  N L ++ + +F+    L+EL LA N +  +    F +   L+ ++LS N L GI    F      + L L HN IS + P AFS ++ +  ++L+HN+L +L   +FF + S+  L L++N +  +  + FK L  L  L+L  NK+ +L E  F  + +LE + L+ +    IR            I LS N +  L +   C+KG   L +
Sbjct:  127 IKSLAPSTFTHTQNLVSLTLNN-NFLTKIEDGLFSGLSNLWYLNLGWNLLVVLPDMVFHDLLNLRELVLAGNRLVYLQPSLFLSLGELKELDLSGNSLKGIKANVFTRQQKTHKLYLNHNHISTVAPRAFSGMKNLRWLDLSHNRLTALYEDTFFGLPSLNVLRLSNNSLTSLRPRIFKDLQFLVELNLGQNKIKILLERTFEGLAQLELLSLNHNNVQEIRPGSFLGLLNVAVINLSGNCLKSLAEH--CFKGLGKLHS 383          

HSP 4 Score: 87.8113 bits (216), Expect = 9.360e-18
Identity = 68/252 (26.98%), Postives = 117/252 (46.43%), Query Frame = 2
Query:  257 CSTSNITAIMINP-----------GNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKI 979
            CS+ N+T +   P            N+ +V A  F +  +L+ L +    +   L++        L    +  N +  +    F     L  L+L NN +  I +  F    NL ++NL  NLL+ + +  F  L+NL  L+LA NR+ +++P  F SL ++  ++L+ N L  +    F       +L LN N I  ++ +AF G+ NL++L L +N+L  L E  F  +  L  + L  +    +R P+I
Sbjct:   53 CSSRNLTRVPEPPPPAARSLWLDGNNLTTVQAGAFRNLSHLDFLNLQSSQVAS-LEQQALHGLKALAHLHLERNMIKSLAPSTFTHTQNLVSLTLNNNFLTKIEDGLFSGLSNLWYLNLGWNLLVVLPDMVFHDLLNLRELVLAGNRLVYLQPSLFLSLGELKELDLSGNSLKGIKANVFTRQQKTHKLYLNHNHISTVAPRAFSGMKNLRWLDLSHNRLTALYEDTFFGLPSLNVLRLSNNSLTSLR-PRI 302          
BLAST of SMED30015272 vs. Ensembl Xenopus
Match: LRIG3 (leucine-rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:100151727])

HSP 1 Score: 96.6709 bits (239), Expect = 1.998e-20
Identity = 93/338 (27.51%), Postives = 164/338 (48.52%), Query Frame = 2
Query:  266 SNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSENVVSRLRKF--RSC-----YKGE------------NDLKTPSTTISAK-----------FHLNSSRTSEELKKYSWEKNIDELSSSLIK 1168
            SN+  + +N   I+ +    F    +L+ L I    +I RL +G F     ++  ++  N+LT IT+        LQ+L L+ N I  I   A+  C+ L  ++L+ N L  + E +F GL  L  L + +N+I+FI   AF  L  ++S++L  N++ S  I     +F  +  + RL+L DN+I  I+ KAF  LD L+YL L +N +  ++ + FS+MK L+ + L+      +C +++    L+E   S+ + F   SC      KG+            +D   P  T+  +           F  +++ +SE    ++W+K+ + L  S I+
Sbjct:  211 SNLQHLELNRNRIKEILGLTFQGLDSLKSLRIQR-NLITRLMDGAFWGLSTMEILQLDHNRLTEITKGWLYGLLMLQKLHLSQNAISSITPDAWEFCQKLSELDLAFNQLTRLEESSFAGLGLLGGLYIGNNKINFIADGAFRGLSSLNSLDLKSNEI-SWTIEDMNGTFSGLERLKRLILQDNRITSITKKAFSWLDALEYLDLSDNAITSMQTNAFSQMKSLQQLYLNTTSLLCDCQLKWLPKWLAE---SKFQTFVNASCGHPQILKGKSIFAVSPDDFVCDDFPKPQITVQPETQSAIKGSNVTFICSAASSSESPMTFAWKKDNELLHDSEIE 543          

HSP 2 Score: 77.7962 bits (190), Expect = 2.054e-14
Identity = 65/219 (29.68%), Postives = 104/219 (47.49%), Query Frame = 2
Query:  377 IDRLDEGIFRN-RIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNR------------------------ISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESM---FSEMKRLETVELDED 949
            I  +  G F N    L+  K+  N+++ I  K+F   S LQ L L  N IK I  L F    +L+ + +  NL+  + +  F GL  + +L L HNR                        IS I P A+   +K+  ++L  NQL  L+  SF  +  +  L + +N+I  I+  AF+GL +L  L LK+N++    E M   FS ++RL+ + L ++
Sbjct:  175 ISTMQSGAFDNLSATLQVLKLNKNRISYIPSKMFK-LSNLQHLELNRNRIKEILGLTFQGLDSLKSLRIQRNLITRLMDGAFWGLSTMEILQLDHNRLTEITKGWLYGLLMLQKLHLSQNAISSITPDAWEFCQKLSELDLAFNQLTRLEESSFAGLGLLGGLYIGNNKINFIADGAFRGLSSLNSLDLKSNEISWTIEDMNGTFSGLERLKRLILQDN 392          

HSP 3 Score: 68.5514 bits (166), Expect = 1.625e-11
Identity = 57/212 (26.89%), Postives = 114/212 (53.77%), Query Frame = 2
Query:  407 NRIH-LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRK-IHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---------INCIIRFPKIQLSENVVSRL 1009
            N +H L++ ++ +N+L I+ + L    + +   SL NN I+VI        ++L  ++LS+NL+  +   +F  L  L  L + +NRIS ++  AF +L   +  ++LN N++  +  +  F + ++  L LN N+I++I    F+GLD+L+ L ++ N +  L +  F  +  +E ++LD +         +  ++   K+ LS+N +S +
Sbjct:   90 NHLHNLRELRLNNNELQIVPD-LGPLSANITLFSLTNNKIEVILPEHLKPYQSLETLDLSNNLITELRAGSFPTL-QLKYLYINNNRISTMQSGAFDNLSATLQVLKLNKNRISYIPSK-MFKLSNLQHLELNRNRIKEILGLTFQGLDSLKSLRIQRNLITRLMDGAFWGLSTMEILQLDHNRLTEITKGWLYGLLMLQKLHLSQNAISSI 298          
BLAST of SMED30015272 vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 88.1965 bits (217), Expect = 9.687e-18
Identity = 65/215 (30.23%), Postives = 115/215 (53.49%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRS----FFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETV 934
            I+ V +  F    +L+ L +   GI+  +D G F    ++++ ++  N +T I +       +LQ+L ++ N +  I   A+  C+ L  ++LS+N L  + +  F GL +L  + L  NRI+ I    F  L  +  ++L +N++ S  I      F  +  +  L+L  N+I+ I+MKAF GLD+LQ+L L NN ++ ++E+ FS MK  E +
Sbjct:  155 IKIVESLTFQGLDSLKSLKLQRNGIVKLMD-GAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEI-SWAIEDSNEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSLQHLDLSNNAILSVQENGFSFMKLQELI 367          

HSP 2 Score: 83.1889 bits (204), Expect = 4.155e-16
Identity = 54/176 (30.68%), Postives = 96/176 (54.55%), Query Frame = 2
Query:  416 HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL-MLLEES--MFSEMKRLETV 934
            HL+  ++  N++ I+    F    +L+ L L  N I  + + AF    N+  + L +N +  I +    GL +L  L ++ N +  I P A+   +K+  ++L++NQL  LD  +F  + S+ ++ L DN+I  I+   FKGL NL  L L+NN++   +E+S  +F+ + RL T+
Sbjct:  144 HLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDSNEVFAGLSRLHTL 319          

HSP 3 Score: 54.6842 bits (130), Expect = 2.884e-7
Identity = 49/194 (25.26%), Postives = 94/194 (48.45%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKT---FEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLN-DNQIRDISMKAFK 838
            N+  + +   N+  +   +    R+L++L I+    + R+    +     L    ++ N+L  + +  F   S+L++++L +N I  I E  F    NL  ++L +N +    E +   F GL  L+ LIL  N+I  I   AF+ L  +  ++L++N +LS+   + F+   +  L+LN  N + D  +K F 
Sbjct:  192 NMEQLELEYNNVTDINKGWLYGLRSLQQLYISQ-NAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDSNEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSLQHLDLSNNAILSVQ-ENGFSFMKLQELILNTSNLLCDCQLKWFP 383          

HSP 4 Score: 51.2174 bits (121), Expect = 3.759e-6
Identity = 51/189 (26.98%), Postives = 92/189 (48.68%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAF-HTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            I  L+  + +  + L+   ++SN LT I    F     L+ L+L+NN I  +    F +   +L  + L+ N +  I  K+F+ L +L  L L  NRI  ++   F  L  + S++L  N ++ L   +FF + +M +L L  N + DI+     GL +LQ L +  N +  +    +   ++L  ++L
Sbjct:   60 IGELNGDLLQQYLSLETLDLSSNLLTEIKSFYFPRMP-LKYLNLSNNRIATLEAGCFDNLSSSLLVLKLNRNRINVIQPKSFK-LPHLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDL 246          
BLAST of SMED30015272 vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 88.1965 bits (217), Expect = 1.059e-17
Identity = 65/215 (30.23%), Postives = 115/215 (53.49%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRS----FFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETV 934
            I+ V +  F    +L+ L +   GI+  +D G F    ++++ ++  N +T I +       +LQ+L ++ N +  I   A+  C+ L  ++LS+N L  + +  F GL +L  + L  NRI+ I    F  L  +  ++L +N++ S  I      F  +  +  L+L  N+I+ I+MKAF GLD+LQ+L L NN ++ ++E+ FS MK  E +
Sbjct:  142 IKIVESLTFQGLDSLKSLKLQRNGIVKLMD-GAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEI-SWAIEDSNEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSLQHLDLSNNAILSVQENGFSFMKLQELI 354          

HSP 2 Score: 82.8037 bits (203), Expect = 4.382e-16
Identity = 54/176 (30.68%), Postives = 96/176 (54.55%), Query Frame = 2
Query:  416 HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL-MLLEES--MFSEMKRLETV 934
            HL+  ++  N++ I+    F    +L+ L L  N I  + + AF    N+  + L +N +  I +    GL +L  L ++ N +  I P A+   +K+  ++L++NQL  LD  +F  + S+ ++ L DN+I  I+   FKGL NL  L L+NN++   +E+S  +F+ + RL T+
Sbjct:  131 HLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDSNEVFAGLSRLHTL 306          

HSP 3 Score: 55.0694 bits (131), Expect = 2.850e-7
Identity = 49/194 (25.26%), Postives = 94/194 (48.45%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKT---FEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLN-DNQIRDISMKAFK 838
            N+  + +   N+  +   +    R+L++L I+    + R+    +     L    ++ N+L  + +  F   S+L++++L +N I  I E  F    NL  ++L +N +    E +   F GL  L+ LIL  N+I  I   AF+ L  +  ++L++N +LS+   + F+   +  L+LN  N + D  +K F 
Sbjct:  179 NMEQLELEYNNVTDINKGWLYGLRSLQQLYISQ-NAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDSNEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSLQHLDLSNNAILSVQ-ENGFSFMKLQELILNTSNLLCDCQLKWFP 370          

HSP 4 Score: 51.2174 bits (121), Expect = 3.557e-6
Identity = 51/189 (26.98%), Postives = 92/189 (48.68%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAF-HTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            I  L+  + +  + L+   ++SN LT I    F     L+ L+L+NN I  +    F +   +L  + L+ N +  I  K+F+ L +L  L L  NRI  ++   F  L  + S++L  N ++ L   +FF + +M +L L  N + DI+     GL +LQ L +  N +  +    +   ++L  ++L
Sbjct:   47 IGELNGDLLQQYLSLETLDLSSNLLTEIKSFYFPRMP-LKYLNLSNNRIATLEAGCFDNLSSSLLVLKLNRNRINVIQPKSFK-LPHLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDL 233          
BLAST of SMED30015272 vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 87.8113 bits (216), Expect = 1.294e-17
Identity = 65/215 (30.23%), Postives = 115/215 (53.49%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRS----FFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETV 934
            I+ V +  F    +L+ L +   GI+  +D G F    ++++ ++  N +T I +       +LQ+L ++ N +  I   A+  C+ L  ++LS+N L  + +  F GL +L  + L  NRI+ I    F  L  +  ++L +N++ S  I      F  +  +  L+L  N+I+ I+MKAF GLD+LQ+L L NN ++ ++E+ FS MK  E +
Sbjct:  210 IKIVESLTFQGLDSLKSLKLQRNGIVKLMD-GAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEI-SWAIEDSNEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSLQHLDLSNNAILSVQENGFSFMKLQELI 422          

HSP 2 Score: 83.1889 bits (204), Expect = 3.754e-16
Identity = 54/176 (30.68%), Postives = 96/176 (54.55%), Query Frame = 2
Query:  416 HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL-MLLEES--MFSEMKRLETV 934
            HL+  ++  N++ I+    F    +L+ L L  N I  + + AF    N+  + L +N +  I +    GL +L  L ++ N +  I P A+   +K+  ++L++NQL  LD  +F  + S+ ++ L DN+I  I+   FKGL NL  L L+NN++   +E+S  +F+ + RL T+
Sbjct:  199 HLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDSNEVFAGLSRLHTL 374          

HSP 3 Score: 54.299 bits (129), Expect = 4.062e-7
Identity = 48/184 (26.09%), Postives = 90/184 (48.91%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKT---FEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLN-DNQIRDISMKAFK 838
            N+  +   +    R+L++L I+    + R+    +     L    ++ N+L  + +  F   S+L++++L +N I  I E  F    NL  ++L +N +    E +   F GL  L+ LIL  N+I  I   AF+ L  +  ++L++N +LS+   + F+   +  L+LN  N + D  +K F 
Sbjct:  257 NVTDINKGWLYGLRSLQQLYISQ-NAVHRISPDAWEFCQKLLDLDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDSNEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSLQHLDLSNNAILSVQ-ENGFSFMKLQELILNTSNLLCDCQLKWFP 438          

HSP 4 Score: 52.7582 bits (125), Expect = 1.452e-6
Identity = 71/285 (24.91%), Postives = 130/285 (45.61%), Query Frame = 2
Query:  104 CPNHCQCDG-VVKCSVVQSHQSVFCPVNWEITSIIVSITMPYKSDW---DNLFLNCSTSNITAIMINPGNIRSVPA-SYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAF-HTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            CP+ C C+G ++ CS  +  +    P+   ITS+ +S       +W    N  L     ++  + +N   + ++P          L  L+ N    I  L+  + +  + L+   ++SN LT I    F     L+ L+L+NN I  +    F +   +L  + L+ N +  I  K+F+ L +L  L L  NRI  ++   F  L  + S++L  N ++ L   +FF + +M +L L  N + DI+     GL +LQ L +  N +  +    +   ++L  ++L
Sbjct:   28 CPSPCVCEGRLLDCSRRRLARLPAAPLPEGITSLEISY------NWLTVSNSSLVPELYSLQEVKMNFNELTAIPHLGEPTANITLLSLVHNK---IGELNGDLLQQYLSLETLDLSSNLLTEIKSFYFPRMP-LKYLNLSNNRIATLEAGCFDNLSSSLLVLKLNRNRINVIQPKSFK-LPHLQYLELRRNRIKIVESLTFQGLDSLKSLKLQRNGIVKLMDGAFFGLDNMEQLELEYNNVTDINKGWLYGLRSLQQLYISQNAVHRISPDAWEFCQKLLDLDL 301          
BLAST of SMED30015272 vs. Ensembl Mouse
Match: Igfals (insulin-like growth factor binding protein, acid labile subunit [Source:MGI Symbol;Acc:MGI:107973])

HSP 1 Score: 117.472 bits (293), Expect = 1.554e-27
Identity = 71/219 (32.42%), Postives = 118/219 (53.88%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +P + F    NL +L++ G   +  L   +      L++  ++ N L  +   +F     LQ+L L  N I  +   AF   K LR+++LSHN + G+ E TF GL+ L+VL LAHN I+ ++P  F  L  +  ++L HN++  L  ++F  +  +  L LNDNQI ++ + AF GL N+  ++L  N L  L E +F  + RL ++ L+   +C+ R
Sbjct:  185 LPDTVFQGLGNLHELVLAG-NKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEH--SCLGR 400          

HSP 2 Score: 87.8113 bits (216), Expect = 6.991e-18
Identity = 77/295 (26.10%), Postives = 126/295 (42.71%), Query Frame = 2
Query:  257 CSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAF------------------------SSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKTPSTTI 1069
            C    +  + ++   +RSV A+ F+    L+KL ++   +I  +    F     L+   ++ N++  + E  F     L  L LA+N I  +    F     L  + L HN +  + EKTFEGL  L VL L  N+I  +K  AF                          L ++HS+ L H+ L  + + +F  +  + RL L DN I  I  ++  GL  L  L L  N+L  L   +F  + +LE + L  +           LSE+V+  L++        N L+TP+  +
Sbjct:  215 CGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLD-RNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYLLLSNN-------QLTMLSEDVLGPLQRAFWLDLSHNRLETPAEGL 501          

HSP 3 Score: 67.3958 bits (163), Expect = 1.859e-11
Identity = 62/269 (23.05%), Postives = 117/269 (43.49%), Query Frame = 2
Query:  206 VSITMPYKSDWDNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLL------------------LG------IYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            V+ T  Y    D L + CS+ N+T +   P +I     + ++D  NL  +               F+N   L    +  + L  +  +       L  L L  N ++ +    F    +L  ++L +NLL                  LG      + +  F+GL NL+ L+LA N++++++P     L ++  ++L+ N L S+    F ++  + +L L+ N I  ++ +AF G+  L++L L +N++  L E  F  +  L  + L
Sbjct:   43 VTCTCSYDDYTDELSVFCSSRNLTQL---PDSIPVSTRALWLDGNNLSSI-----------PSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRL 297          

HSP 4 Score: 57.7658 bits (138), Expect = 2.561e-8
Identity = 64/249 (25.70%), Postives = 104/249 (41.77%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKA------------------------FKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDE---DINCIIR 967
            I S+    F D   LE+L + G   I +L E  F     L+   +  N++  +    F     +  ++L+ N ++ + E  F     L  ++L H+ L  I   TF GL  L  L L  N IS I+  + + L ++  ++L  NQL  L  + F  +  +  LLL++NQ+  +S                           F  L  L+YL+L+NN L       F     LE + LD    D +C ++
Sbjct:  302 ITSLRPRTFKDLHFLEELQL-GHNRIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYLLLSNNQLTMLSEDVLGPLQRAFWLDLSHNRLETPAEGLFSSLGRLRYLNLRNNSL-----QTFVPQPGLERLWLDANPWDCSCPLK 544          

HSP 5 Score: 56.6102 bits (135), Expect = 5.456e-8
Identity = 46/169 (27.22%), Postives = 73/169 (43.20%), Query Frame = 2
Query:  494 QELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED------INCIIRFPKIQ 982
            + L L  N +  I   AF    +L F+NL  + L  +  +   GL NLY L L  N +  +    F     + S+ L +N L  L+   F  +  +  L L  N +  +    F+GL NL  L L  NKL  L+ ++   +  L  ++L  +       N  I  P++Q
Sbjct:   77 RALWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQ 245          
BLAST of SMED30015272 vs. Ensembl Mouse
Match: Lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:MGI Symbol;Acc:MGI:2443955])

HSP 1 Score: 100.523 bits (249), Expect = 9.695e-22
Identity = 84/330 (25.45%), Postives = 160/330 (48.48%), Query Frame = 2
Query:  281 IMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSEN----------VVSRLRKFRSCYKGE------NDLKTPSTTISAK-----------FHLNSSRTSEELKKYSWEKNIDELSSSLIK 1168
            + +N   I++V    F     L+ L +   G+   +D G F    +++  ++  N LT IT+        L+EL L+ N I  I   A+  C+ L  ++L+ N L  + + +F GL  L  L + +N++S+I   AF  L  + +++L +N++ S  I     +F  +  + +L+L  N+IR I+ KAF GLD L++L L  N +M L+ + FS+MK+L+ + L+      +C +R+    ++EN             +L K RS +         +D   P  T+  +           F  +++ +S+    ++W+K+ + L  + ++
Sbjct:  220 LELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMD-GAFWGLSNMEVLQLDHNNLTEITKGWLYGLLMLRELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNALHIGNNKVSYIADCAFRGLTSLKTLDLRNNEI-SWTIEDMSGAFSGLDRLRQLILQGNRIRSITKKAFAGLDTLEHLDLSGNAIMSLQSNAFSQMKKLQQLHLNTSSLLCDCQLRWLPQWVAENNFQSFVNASCAHPQLLKGRSIFTVSPDGFVCDDFPKPQITVQPETQSAIKGSDVSFTCSAASSSDSPMTFAWKKDNEALQDAEME 547          

HSP 2 Score: 76.6406 bits (187), Expect = 3.217e-14
Identity = 59/205 (28.78%), Postives = 95/205 (46.34%), Query Frame = 2
Query:  368 PGIIDRLDEGIF-----RNRI-----------HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESM---FSEMKRL 925
            PG  D L   +      RNRI            L+  ++  NK+  +    F     L+ L +  N +  + + AF    N+  + L HN L  I +    GL+ L  L L+ N I+ I P A+   +K+  ++L  N L  LD  SF  +  +  L + +N++  I+  AF+GL +L+ L L+NN++    E M   FS + RL
Sbjct:  184 PGYFDNLASTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEVLQLDHNNLTEITKGWLYGLLMLRELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNALHIGNNKVSYIADCAFRGLTSLKTLDLRNNEISWTIEDMSGAFSGLDRL 388          

HSP 3 Score: 61.2326 bits (147), Expect = 2.143e-9
Identity = 59/246 (23.98%), Postives = 122/246 (49.59%), Query Frame = 2
Query:  338 RNLEKLIINGPGIIDRLDEGIFRNRIH------------LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRK-IHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---------INCIIRFPKIQLSENVVSRL 1009
            R L +L    P  + RLD  +  NR+             L++ K+ +N+L  I   L +  + +++LSLA N I  I        ++L  ++LS+N +  +  +T    + L  L + +NR+S ++P  F +L   +  ++LN N++ ++  +  F +  +  L LN N+I+++    F+GL  L+ L ++ N +  L +  F  +  +E ++LD +         +  ++   ++ LS+N ++R+
Sbjct:   63 RRLVRLPDPLPAWVTRLD--LSHNRLSFIQTSSLSHLQSLQEVKLNNNELETIP-NLGSISANIRQLSLAGNAIDKILPEQLEAFQSLETLDLSNNNISEL--RTAFPPLQLKYLYINNNRVSSMEPGYFDNLASTLLVLKLNRNRISAIPPK-MFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEVLQLDHNNLTEITKGWLYGLLMLRELHLSQNAINRI 302          
BLAST of SMED30015272 vs. Ensembl Mouse
Match: Chadl (chondroadherin-like [Source:MGI Symbol;Acc:MGI:3036284])

HSP 1 Score: 94.3597 bits (233), Expect = 5.948e-20
Identity = 68/243 (27.98%), Postives = 116/243 (47.74%), Query Frame = 2
Query:  296 GNIRSV-PASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFR 1021
            GNI  V PA+ F D  +L  L +     ++ + EG FR    L    + SN+L+ + ++  +   +L+ L L  N ++ +    F    +L  +NL+HN L+ +    F+GL+    L L+HN +S + P A + L  +  + L+HN+L +L   +     S+ RL L  N +     +    L  L+ L+L +  L  L    F+   RL T++L    N +   P +Q    V  +LR+ R
Sbjct:   70 GNILKVLPAAAFQDLPHLTHLDLRN-CQVEMVAEGAFRGLGRLLLLNLASNRLSTLPQEALDGLGSLRRLELEGNMLEELRPGTFGALGSLTTLNLAHNALVYLPAMAFQGLLRTRWLQLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGAALSQARSLARLELGHNPLTYTGEEDGLALPGLRELALDHGSLQALGPRAFAHCPRLHTLDLRG--NQLTTLPPLQ----VPGQLRRLR 305          

HSP 2 Score: 68.1662 bits (165), Expect = 1.500e-11
Identity = 47/176 (26.70%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  422 KKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            ++  +  N L ++    F     L  L L N  ++++ E AF     L  +NL+ N L  + ++  +GL +L  L L  N +  ++P  F +L  + ++ L HN L+ L   +F  +     L L+ N +  ++ +A  GL  L+ LSL +N+L  L  +  S+ + L  +EL  +
Sbjct:   64 QRLDLQGNILKVLPAAAFQDLPHLTHLDLRNCQVEMVAEGAFRGLGRLLLLNLASNRLSTLPQEALDGLGSLRRLELEGNMLEELRPGTFGALGSLTTLNLAHNALVYLPAMAFQGLLRTRWLQLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGAALSQARSLARLELGHN 239          

HSP 3 Score: 53.5286 bits (127), Expect = 5.283e-7
Identity = 35/152 (23.03%), Postives = 64/152 (42.11%), Query Frame = 2
Query:  494 QELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            Q L L  N    +   AF   ++L  ++L H  +  +      GL  L  L L+HN++S +   A      +  + L HN+ L +   +   + +++ L L DN +  ++     G   L+ L L  N +  +        + LE + LD +
Sbjct:  427 QLLDLRRNHFPSVPRAAFPGLRHLVSLHLQHCGVAELEPGALAGLDRLLYLYLSHNQLSGLSAAALEGAPNLGYLYLEHNRFLRIPGTALRALPTLVSLHLQDNAVDRLAPGDLAGARALRCLYLSGNHITQVSPGALGPARELEKLHLDRN 578          
BLAST of SMED30015272 vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 92.8189 bits (229), Expect = 2.431e-19
Identity = 58/191 (30.37%), Postives = 105/191 (54.97%), Query Frame = 2
Query:  350 KLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQL---LSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSE 913
            K+  NG   I +L +G F    ++++ ++  N LT + +        LQ+L ++ N I+ I   A+  C+ L  ++LS+N L  + E  F GL  L  L L  NR++ I    F  L  + +++L +N +   +     +F  + S+ +L+L  N+I+ ++ KAF GL++L+YL L NN +M ++E+ FS+
Sbjct:  244 KMQRNG---ISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAFSQ 431          

HSP 2 Score: 83.1889 bits (204), Expect = 3.348e-16
Identity = 60/204 (29.41%), Postives = 97/204 (47.55%), Query Frame = 2
Query:  371 GIIDRLDEGIF-----RNRI-----------HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEES---MFSEMKRL 925
            G  D L + +      RNRI           HL+  ++  N++ I+    F    +L+ L +  N I  + + AF    N+  + L HN L G+ +    GL  L  L ++ N I  I P A+   +++  ++L++NQL  LD  +F  +  + RL L DN++  I+   F+ L NLQ L L+NN +    E     FS +K L
Sbjct:  184 GCFDNLSDSLLVVKLNRNRISMIPPKVFKLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSL 387          

HSP 3 Score: 73.9442 bits (180), Expect = 2.158e-13
Identity = 81/338 (23.96%), Postives = 149/338 (44.08%), Query Frame = 2
Query:   17 ERRKM---LFHLVFIKSIFHFIEFIEMTTRNICPNHCQCD-GVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYK--SDWDNL--------------------FLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCS-TLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            E+R++   L  L  +  +   +  +      +CP  C C   ++ CS  +     +  ++  + S I S+ + +   S+W+N                     +    T NIT + +    I  + A  F  +  LE L ++   II  +    F  R+ LK   +++N+++ +    F++ S +L  + L  N I +I    F    +L+F+ L  N +  +   TF+GL +L  L +  N IS +K  AF  L  +  +EL HN L  ++    + +  + +L ++ N I  IS  A++    L  L L  N+L  L+ES F  +  LE + L ++
Sbjct:   10 EQRRLGCGLGPLARLLILAQALRLLPAARAGLCPAPCACRLPLLDCSRRKLPAPSWRALSGPLPSDISSLDLSHNRLSNWNNTLESQTLQEVKMNYNELTEIPYFGEPTPNITLLSLVHNLIPEINAEAFELYSALESLDLSS-NIISEIKTSSFP-RMSLKYLNLSNNRISTLEAGCFDNLSDSLLVVKLNRNRISMIPPKVFK-LPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDN 344          

HSP 4 Score: 58.5362 bits (140), Expect = 1.508e-8
Identity = 44/172 (25.58%), Postives = 83/172 (48.26%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYE---KTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIH 775
            N+  + +   N+  V   +    R L++L ++    I+++    +     L +  ++ N+LT + E  F   S L+ L+L +N +  I +  F    NL+ ++L +N +    E   + F GL +L  LIL  NRI  +   AF  L  +  ++LN+N ++S+   +F   H
Sbjct:  263 NMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQ-NAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAFSQTH 433          
BLAST of SMED30015272 vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 92.8189 bits (229), Expect = 2.688e-19
Identity = 58/191 (30.37%), Postives = 105/191 (54.97%), Query Frame = 2
Query:  350 KLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQL---LSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSE 913
            K+  NG   I +L +G F    ++++ ++  N LT + +        LQ+L ++ N I+ I   A+  C+ L  ++LS+N L  + E  F GL  L  L L  NR++ I    F  L  + +++L +N +   +     +F  + S+ +L+L  N+I+ ++ KAF GL++L+YL L NN +M ++E+ FS+
Sbjct:  244 KMQRNG---ISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAFSQ 431          

HSP 2 Score: 82.8037 bits (203), Expect = 3.633e-16
Identity = 60/204 (29.41%), Postives = 97/204 (47.55%), Query Frame = 2
Query:  371 GIIDRLDEGIF-----RNRI-----------HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEES---MFSEMKRL 925
            G  D L + +      RNRI           HL+  ++  N++ I+    F    +L+ L +  N I  + + AF    N+  + L HN L G+ +    GL  L  L ++ N I  I P A+   +++  ++L++NQL  LD  +F  +  + RL L DN++  I+   F+ L NLQ L L+NN +    E     FS +K L
Sbjct:  184 GCFDNLSDSLLVVKLNRNRISMIPPKVFKLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSL 387          

HSP 3 Score: 73.9442 bits (180), Expect = 2.221e-13
Identity = 81/338 (23.96%), Postives = 149/338 (44.08%), Query Frame = 2
Query:   17 ERRKM---LFHLVFIKSIFHFIEFIEMTTRNICPNHCQCD-GVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYK--SDWDNL--------------------FLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCS-TLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            E+R++   L  L  +  +   +  +      +CP  C C   ++ CS  +     +  ++  + S I S+ + +   S+W+N                     +    T NIT + +    I  + A  F  +  LE L ++   II  +    F  R+ LK   +++N+++ +    F++ S +L  + L  N I +I    F    +L+F+ L  N +  +   TF+GL +L  L +  N IS +K  AF  L  +  +EL HN L  ++    + +  + +L ++ N I  IS  A++    L  L L  N+L  L+ES F  +  LE + L ++
Sbjct:   10 EQRRLGCGLGPLARLLILAQALRLLPAARAGLCPAPCACRLPLLDCSRRKLPAPSWRALSGPLPSDISSLDLSHNRLSNWNNTLESQTLQEVKMNYNELTEIPYFGEPTPNITLLSLVHNLIPEINAEAFELYSALESLDLSS-NIISEIKTSSFP-RMSLKYLNLSNNRISTLEAGCFDNLSDSLLVVKLNRNRISMIPPKVFK-LPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDN 344          

HSP 4 Score: 58.5362 bits (140), Expect = 1.647e-8
Identity = 44/172 (25.58%), Postives = 83/172 (48.26%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYE---KTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIH 775
            N+  + +   N+  V   +    R L++L ++    I+++    +     L +  ++ N+LT + E  F   S L+ L+L +N +  I +  F    NL+ ++L +N +    E   + F GL +L  LIL  NRI  +   AF  L  +  ++LN+N ++S+   +F   H
Sbjct:  263 NMEELELEHNNLTGVNKGWLYGLRMLQQLYMSQ-NAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKSVTQKAFIGLESLEYLDLNNNAIMSIQENAFSQTH 433          
BLAST of SMED30015272 vs. UniProt/SwissProt
Match: sp|P35859|ALS_RAT (Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus OX=10116 GN=Igfals PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.039e-27
Identity = 70/211 (33.18%), Postives = 115/211 (54.50%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            +P + F    NL +L++ G   +  L   +F     L++  ++ N L  +   +F     LQ+L L  N I  +   AF   K LR+++LSHN + G+ E TF GL+ L+VL LAHN I+ ++P  F  L  +  ++L HN++  L  R+F  +  +  L LNDNQI ++ + AF GL N+  ++L  N L  L E +F  + +L ++ L+
Sbjct:  185 LPDTVFQGLGNLHELVLAG-NKLTYLQPALFCGLGELRELDLSRNALRSVKANVFVHLPRLQKLYLDRNLITAVAPGAFLGMKALRWLDLSHNRVAGLMEDTFPGLLGLHVLRLAHNAIASLRPRTFKDLHFLEELQLGHNRIRQLGERTFEGLGQLEVLTLNDNQITEVRVGAFSGLFNVAVMNLSGNCLRSLPERVFQGLDKLHSLHLE 394          

HSP 2 Score: 90.8929 bits (224), Expect = 5.104e-18
Identity = 69/248 (27.82%), Postives = 109/248 (43.95%), Query Frame = 2
Query:  257 CSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFS------------------------SLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLE 928
            C    +  + ++   +RSV A+ FV    L+KL ++   +I  +  G F     L+   ++ N++  + E  F     L  L LA+N I  +    F     L  + L HN +  + E+TFEGL  L VL L  N+I+ ++  AFS                         L K+HS+ L H+ L  + + +F  +  + RL L DN I  I  ++  GL  L  L L  N+L  L   +F  +  LE
Sbjct:  215 CGLGELRELDLSRNALRSVKANVFVHLPRLQKLYLD-RNLITAVAPGAFLGMKALRWLDLSHNRVAGLMEDTFPGLLGLHVLRLAHNAIASLRPRTFKDLHFLEELQLGHNRIRQLGERTFEGLGQLEVLTLNDNQITEVRVGAFSGLFNVAVMNLSGNCLRSLPERVFQGLDKLHSLHLEHSCLGHVRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTTNRLTHLPRQLFQGLGHLE 461          

HSP 3 Score: 82.0333 bits (201), Expect = 3.596e-15
Identity = 72/290 (24.83%), Postives = 141/290 (48.62%), Query Frame = 2
Query:  206 VSITMPYKSDWDNLFLNCSTSNIT-----------AIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR---------FPKIQLSENVVSRLRK 1015
            V+ T  +    D L + CS+ N+T           A+ ++  N+ S+P++ F +  +L+ L + G   +  L+        +L    +  N+L  +   LF    +L  LSL++N +  + E  F    +L  +NL  N L+ + +  F+GL NL+ L+LA N++++++P  F  L ++  ++L+ N L S+    F ++  + +L L+ N I  ++  AF G+  L++L L +N++  L E  F  +  L  + L  +    +R           ++QL  N + +L +
Sbjct:   43 VACTCSHDDYTDELSVFCSSKNLTHLPDDIPVSTRALWLDGNNLSSIPSAAFQNLSSLDFLNLQG-SWLRSLEPQALLGLQNLYYLHLERNRLRNLAVGLFTHTPSLASLSLSSNLLGRLEEGLFQGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALFCGLGELRELDLSRNALRSVKANVFVHLPRLQKLYLDRNLITAVAPGAFLGMKALRWLDLSHNRVAGLMEDTFPGLLGLHVLRLAHNAIASLRPRTFKDLHFLEELQLGHNRIRQLGE 331          
BLAST of SMED30015272 vs. UniProt/SwissProt
Match: sp|P70389|ALS_MOUSE (Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus OX=10090 GN=Igfals PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.087e-26
Identity = 71/219 (32.42%), Postives = 118/219 (53.88%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +P + F    NL +L++ G   +  L   +      L++  ++ N L  +   +F     LQ+L L  N I  +   AF   K LR+++LSHN + G+ E TF GL+ L+VL LAHN I+ ++P  F  L  +  ++L HN++  L  ++F  +  +  L LNDNQI ++ + AF GL N+  ++L  N L  L E +F  + RL ++ L+   +C+ R
Sbjct:  185 LPDTVFQGLGNLHELVLAG-NKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEH--SCLGR 400          

HSP 2 Score: 87.8113 bits (216), Expect = 4.678e-17
Identity = 77/295 (26.10%), Postives = 126/295 (42.71%), Query Frame = 2
Query:  257 CSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAF------------------------SSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKTPSTTI 1069
            C    +  + ++   +RSV A+ F+    L+KL ++   +I  +    F     L+   ++ N++  + E  F     L  L LA+N I  +    F     L  + L HN +  + EKTFEGL  L VL L  N+I  +K  AF                          L ++HS+ L H+ L  + + +F  +  + RL L DN I  I  ++  GL  L  L L  N+L  L   +F  + +LE + L  +           LSE+V+  L++        N L+TP+  +
Sbjct:  215 CGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLD-RNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYLLLSNN-------QLTMLSEDVLGPLQRAFWLDLSHNRLETPAEGL 501          

HSP 3 Score: 67.781 bits (164), Expect = 1.101e-10
Identity = 62/269 (23.05%), Postives = 116/269 (43.12%), Query Frame = 2
Query:  206 VSITMPYKSDWDNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLL------------------LG------IYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            V+ T  Y    D L + CS+ N+T +   P  I     + ++D  NL  +               F+N   L    +  + L  +  +       L  L L  N ++ +    F    +L  ++L +NLL                  LG      + +  F+GL NL+ L+LA N++++++P     L ++  ++L+ N L S+    F ++  + +L L+ N I  ++ +AF G+  L++L L +N++  L E  F  +  L  + L
Sbjct:   43 VTCTCSYDDYTDELSVFCSSRNLTQL---PDGIPVSTRALWLDGNNLSSI-----------PSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRL 297          

HSP 4 Score: 57.7658 bits (138), Expect = 1.686e-7
Identity = 64/249 (25.70%), Postives = 104/249 (41.77%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKA------------------------FKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDE---DINCIIR 967
            I S+    F D   LE+L + G   I +L E  F     L+   +  N++  +    F     +  ++L+ N ++ + E  F     L  ++L H+ L  I   TF GL  L  L L  N IS I+  + + L ++  ++L  NQL  L  + F  +  +  LLL++NQ+  +S                           F  L  L+YL+L+NN L       F     LE + LD    D +C ++
Sbjct:  302 ITSLRPRTFKDLHFLEELQL-GHNRIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYLLLSNNQLTMLSEDVLGPLQRAFWLDLSHNRLETPAEGLFSSLGRLRYLNLRNNSL-----QTFVPQPGLERLWLDANPWDCSCPLK 544          

HSP 5 Score: 56.6102 bits (135), Expect = 3.750e-7
Identity = 46/169 (27.22%), Postives = 73/169 (43.20%), Query Frame = 2
Query:  494 QELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED------INCIIRFPKIQ 982
            + L L  N +  I   AF    +L F+NL  + L  +  +   GL NLY L L  N +  +    F     + S+ L +N L  L+   F  +  +  L L  N +  +    F+GL NL  L L  NKL  L+ ++   +  L  ++L  +       N  I  P++Q
Sbjct:   77 RALWLDGNNLSSIPSAAFQNLSSLDFLNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRSVKANVFIHLPRLQ 245          
BLAST of SMED30015272 vs. UniProt/SwissProt
Match: sp|Q7Z2Q7|LRR70_HUMAN (Leucine-rich repeat-containing protein 70 OS=Homo sapiens OX=9606 GN=LRRC70 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 5.401e-23
Identity = 69/226 (30.53%), Postives = 124/226 (54.87%), Query Frame = 2
Query:  272 ITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            + A+ ++  NI  V    FV  R+L  L +N    I RLD GIF+  ++L+   +  N+++ +   +FN   ++Q L+L  N + V+    F     LR ++LS+N +L I E  F+ L NL  L L  N ++ +   AF  L+ +  + L+HN + ++   +F  + ++  LLL +++IR+++   F G++NL++L L +N L  L    FS +K L  ++LD +
Sbjct:   86 LVALYLDNSNILYVYPKAFVQLRHLYFLFLNN-NFIKRLDPGIFKGLLNLRNLYLQYNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSNNNILRISESGFQHLENLACLYLGSNNLTKVPSNAFEVLKSLRRLSLSHNPIEAIQPFAFKGLANLEYLLLKNSRIRNVTRDGFSGINNLKHLILSHNDLENLNSDTFSLLKNLIYLKLDRN 310          

HSP 2 Score: 71.2478 bits (173), Expect = 9.303e-12
Identity = 63/213 (29.58%), Postives = 107/213 (50.23%), Query Frame = 2
Query:  434 MTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED-INCIIRFPKIQLS--ENVV---SRLRKF-RSCYKGENDLK 1051
            +T N ++ I E       +L  L L N+ I  ++  AF   ++L F+ L++N +  +    F+GL+NL  L L +N++SF+    F+ L  +  + L  N+L  L   +F  + ++  L L++N I  IS   F+ L+NL  L L +N L  +  + F  +K L  + L  + I  I  F    L+  E ++   SR+R   R  + G N+LK
Sbjct:   67 LTGNNISYINESELTGLHSLVALYLDNSNILYVYPKAFVQLRHLYFLFLNNNFIKRLDPGIFKGLLNLRNLYLQYNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSNNNILRISESGFQHLENLACLYLGSNNLTKVPSNAFEVLKSLRRLSLSHNPIEAIQPFAFKGLANLEYLLLKNSRIRNVTRDGFSGINNLK 279          

HSP 3 Score: 60.8474 bits (146), Expect = 1.682e-8
Identity = 52/165 (31.52%), Postives = 82/165 (49.70%), Query Frame = 2
Query:  569 FINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDL-KTPS 1060
            F+ L+ N +  I E    GL +L  L L ++ I ++ P AF  LR ++ + LN+N +  LD   F  + ++  L L  NQ+  +    F  L ++QYL+L+ N+L +L    F  M  L  ++L    N I+R     +SE+    L      Y G N+L K PS
Sbjct:   64 FLYLTGNNISYINESELTGLHSLVALYLDNSNILYVYPKAFVQLRHLYFLFLNNNFIKRLDPGIFKGLLNLRNLYLQYNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMVALRILDLSN--NNILR-----ISESGFQHLENLACLYLGSNNLTKVPS 221          
BLAST of SMED30015272 vs. UniProt/SwissProt
Match: sp|O02833|ALS_PAPHA (Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas OX=9557 GN=IGFALS PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 3.355e-22
Identity = 69/219 (31.51%), Postives = 117/219 (53.42%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +P + F     L +L++ G   +  L   +F     L++  ++ N L  I   +F     LQ+L L  N I  +   AF   K LR+++LSHN + G+ E TF GL+ L VL L+HN I+ ++P  F  L  +  ++L HN++  L  RSF  +  +  L L+ NQ++++ + AF GL N+  ++L  N L  L E +F  + +L ++ L+   +C+ R
Sbjct:  185 LPDAAFRGLGGLRELVLAG-NRLAYLQPALFSGLAELRELDLSRNALRAIKANVFAQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFEDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKVGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEG--SCLGR 400          

HSP 2 Score: 90.1225 bits (222), Expect = 8.981e-18
Identity = 66/256 (25.78%), Postives = 119/256 (46.48%), Query Frame = 2
Query:  176 PVNWEITSIIVSITMPYKSDWDNLFLNCSTSNIT-----------AIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFS 910
            P   E  +   +    Y  + + L + CS+ N+T           A+ ++  N+ S+P + F +  +L  L + G G +  L+        +L    +  N+L  +    F     L  L L+NN +  + +  F    NL  +NL  N L  + +  F GL  L  L+LA NR+++++P  FS L ++  ++L+ N L ++    F  +  + +L L+ N I  ++  AF GL  L++L L +N++  L E  F 
Sbjct:   33 PGEAEGPACPATCACSYDDEVNELSVFCSSRNLTRLPDGIPGGTQALWLDSNNLSSIPPAAFRNLSSLAFLNLQG-GQLGSLEPQALLGLENLCHLHLERNQLRSLAVGTFAYTPALALLGLSNNRLSRLEDGLFEGLGNLWDLNLGWNSLAVLPDAAFRGLGGLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFAQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFP 287          

HSP 3 Score: 80.8777 bits (198), Expect = 6.877e-15
Identity = 46/168 (27.38%), Postives = 88/168 (52.38%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKR 922
            L++ ++  N++  + E+ F     L+ L+L +N ++ +   AF    N+  +NLS N L  + E+ F GL  L+ L L  + +  I+P  F+ L  +  + L  N L+ ++ +S + +  ++ L L  NQ+  +  + F+GL  L+YL L +N+L  L       ++R
Sbjct:  316 LEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKVGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFAGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHQLFQGLGKLEYLLLSHNRLAELPADALGPLQR 483          

HSP 4 Score: 73.1738 bits (178), Expect = 2.085e-12
Identity = 59/233 (25.32%), Postives = 104/233 (44.64%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLF-------------NSCSTL-----------QELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLE 928
            +R++ A+ F     L+KL ++   +I  +  G F     L+   ++ N++  + E  F             N+ ++L           +EL L +N I+ + E +F     L  + L HN L  +    F GL N+ V+ L+ N +  +    F  L K+HS+ L  + L  +   +F  +  + RL L DN +  I  ++  GL  L  L L +N+L  L   +F  + +LE
Sbjct:  230 LRAIKANVFAQLPRLQKLYLDR-NLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFEDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKVGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFAGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHQLFQGLGKLE 461          

HSP 5 Score: 62.003 bits (149), Expect = 7.421e-9
Identity = 51/197 (25.89%), Postives = 87/197 (44.16%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDE---GIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL 883
            IR +    F     LE L ++     ++L E   G F    ++    ++ N L  + E++F     L  L L  + +  I    F     LR + L  N L+GI E++  GL  L  L L  N+++ +    F  L K+  + L+HN+L  L   +   +     L ++ N++  +       L  L+YL+L+NN L
Sbjct:  326 IRQLAERSFEGLGQLEVLTLD----HNQLQEVKVGAFLGLTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFAGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHQLFQGLGKLEYLLLSHNRLAELPADALGPLQRAFWLDVSHNRLEALPGSLLASLGRLRYLNLRNNSL 518          

HSP 6 Score: 55.0694 bits (131), Expect = 1.182e-6
Identity = 45/184 (24.46%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNL 853
            ++ V    F+   N+  + ++G   +  L E +FR    L    +  + L  I    F   S L+ L L +N +  I E +      L  ++L+ N L  +  + F+GL  L  L+L+HNR++ +   A   L++   ++++HN+L +L      ++  +  L L +N +R  + +   GL+ L
Sbjct:  350 LQEVKVGAFLGLTNVAVMNLSG-NCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFAGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLTSNQLTHLPHQLFQGLGKLEYLLLSHNRLAELPADALGPLQRAFWLDVSHNRLEALPGSLLASLGRLRYLNLRNNSLRTFTPQP-PGLERL 531          
BLAST of SMED30015272 vs. UniProt/SwissProt
Match: sp|Q6UXM1|LRIG3_HUMAN (Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 8.941e-22
Identity = 74/245 (30.20%), Postives = 131/245 (53.47%), Query Frame = 2
Query:  281 IMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSEN 994
            + +N   I++V    F     L+ L +   G+   +D G F    +++  ++  N LT IT+        LQEL L+ N I  I   A+  C+ L  ++L+ N L  + + +F GL  L  L + +NR+S+I   AF  L  + +++L +N++ S  I     +F  +  + RL+L  N+IR I+ KAF GLD L++L L +N +M L+ + FS+MK+L+ + L+      +C +++    ++EN
Sbjct:  220 LELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMD-GAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEI-SWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAEN 462          

HSP 2 Score: 75.8702 bits (185), Expect = 3.833e-13
Identity = 59/205 (28.78%), Postives = 95/205 (46.34%), Query Frame = 2
Query:  368 PGIIDRLDEGIF-----RNRI-----------HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESM---FSEMKRL 925
            PG  D L   +      RNRI            L+  ++  NK+  +    F     L+ L +  N +  + + AF    N+  + L HN L  I +    GL+ L  L L+ N I+ I P A+   +K+  ++L  N L  LD  SF  +  +  L + +N++  I+  AF+GL +L+ L LKNN++    E M   FS + +L
Sbjct:  184 PGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKL 388          

HSP 3 Score: 55.4546 bits (132), Expect = 1.148e-6
Identity = 46/181 (25.41%), Postives = 85/181 (46.96%), Query Frame = 2
Query:  266 SNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEK---TFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLN 799
            SN+  + ++  N+  +   +      L++L ++    I+R+    +     L +  +T N L+ + +  F   S L  L + NN +  I + AF    +L+ ++L +N +    E     F GL  L  LIL  NRI  I   AF+ L  +  ++L+ N ++SL   +F  +  + +L LN
Sbjct:  263 SNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQ-NAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQLHLN 442          

HSP 4 Score: 54.299 bits (129), Expect = 2.386e-6
Identity = 51/207 (24.64%), Postives = 104/207 (50.24%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRK-IHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---------INCIIRFPKIQLSENVVSRL 1009
            L++ K+ +N+L  I   L    + +  LSLA N I  I        ++L  ++LS N +  + +  F  L  L  L L  NR++ ++P  F +L   +  ++LN N++ ++  +  F +  +  L LN N+I+++    F+GL  L+ L ++ N +  L +  F  +  +E ++LD +         +  ++   ++ LS+N ++R+
Sbjct:  100 LREVKLNNNELETIP-NLGPVSANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISEL-QTAFPAL-QLKYLYLNSNRVTSMEPGYFDNLANTLLVLKLNRNRISAIPPK-MFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRI 302          
BLAST of SMED30015272 vs. TrEMBL
Match: A0A2Y9KGX6 (insulin-like growth factor-binding protein complex acid labile subunit OS=Enhydra lutris kenyoni OX=391180 GN=LOC111156079 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 7.529e-28
Identity = 74/220 (33.64%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRF 970
            +P + F     L +L++ G   +  L   +FR    L++  ++ N L  +   +F     LQ+L L  N I  +   AF   K LR+++LSHN + G+ E TF GL+ L+VL L+HN ++ ++P AF  L  +  ++L+HN+L  L  R+F  +  +  L LNDNQIR+I   AF GL +L  ++L  N L  L   +F  + RL ++ L+    C+ R 
Sbjct:  185 LPDAAFHGLAGLRELVLAG-NRLAYLQPPLFRGLAELRELDLSRNALRSVKADVFVKLPRLQKLYLERNLIAAVAPGAFLGMKALRWLDLSHNRVSGLLEDTFPGLLGLHVLRLSHNALAGLRPRAFKDLHFLEELQLSHNRLRQLPDRAFEGLGQLEVLTLNDNQIREIEAGAFAGLRSLAVMNLSGNCLRTLPPQLFLGLGRLHSLHLER--GCLGRL 401          

HSP 2 Score: 95.5153 bits (236), Expect = 4.848e-17
Identity = 73/280 (26.07%), Postives = 128/280 (45.71%), Query Frame = 2
Query:  239 DNLFLNCSTSNIT-----------AIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR---------FPKIQLSENVVSRLRKF 1018
            D L + CS+ N+T           A+ ++  N+ S+PA+ F +  +L  L + G G+     E +      L+   +  N+L  +  + F     L  L L NN +  + +  F     L  +NL  N L  + +  F GL  L  L+LA NR+++++P  F  L ++  ++L+ N L S+    F  +  + +L L  N I  ++  AF G+  L++L L +N++  L E  F  +  L  + L  +    +R           ++QLS N   RLR+ 
Sbjct:   54 DQLSVFCSSRNLTRLPDGIPHGARALWLDGNNLSSIPAAAFRNLSSLAFLNLQGSGLASLEPEALL-GLQRLRHLHLERNQLRGLAARTFLHTPGLASLGLGNNHLGRLDDGLFQGLAGLWDLNLGWNGLAVLPDAAFHGLAGLRELVLAGNRLAYLQPPLFRGLAELRELDLSRNALRSVKADVFVKLPRLQKLYLERNLIAAVAPGAFLGMKALRWLDLSHNRVSGLLEDTFPGLLGLHVLRLSHNALAGLRPRAFKDLHFLEELQLSHN---RLRQL 329          

HSP 3 Score: 85.5001 bits (210), Expect = 6.899e-14
Identity = 66/225 (29.33%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPK 976
            +RSV A  FV    L+KL +    +I  +  G F     L+   ++ N+++ + E  F     L  L L++N +  +   AF     L  + LSHN L  + ++ FEGL  L VL L  N+I  I+  AF+ LR +  + L+ N L +L  + F  +  +  L L    +  +   AF GL  L+ L LK+N +  ++E     +  L+  ELD   N +   P 
Sbjct:  230 LRSVKADVFVKLPRLQKLYLER-NLIAAVAPGAFLGMKALRWLDLSHNRVSGLLEDTFPGLLGLHVLRLSHNALAGLRPRAFKDLHFLEELQLSHNRLRQLPDRAFEGLGQLEVLTLNDNQIREIEAGAFAGLRSLAVMNLSGNCLRTLPPQLFLGLGRLHSLHLERGCLGRLWPHAFAGLSGLRRLFLKHNGIAAVDEQGLGGLAELQ--ELDLTANQLTHLPG 451          

HSP 4 Score: 80.1073 bits (196), Expect = 4.610e-12
Identity = 54/197 (27.41%), Postives = 98/197 (49.75%), Query Frame = 2
Query:  401 FRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSE 991
            F++   L++ +++ N+L  + ++ F     L+ L+L +N I+ I   AF   ++L  +NLS N L  +  + F GL  L+ L L    +  + P AF+ L  +  + L HN + ++D +    +  +  L L  NQ+  +  +AF+GL  L+YL L  N+L  L       ++R+    LD   N +   P+  L +
Sbjct:  310 FKDLHFLEELQLSHNRLRQLPDRAFEGLGQLEVLTLNDNQIREIEAGAFAGLRSLAVMNLSGNCLRTLPPQLFLGLGRLHSLHLERGCLGRLWPHAFAGLSGLRRLFLKHNGIAAVDEQGLGGLAELQELDLTANQLTHLPGQAFQGLGKLEYLLLSGNRLAALAADALRPLRRV--FWLDVSHNRLEALPEADLPQ 504          
BLAST of SMED30015272 vs. TrEMBL
Match: M3YVX4 (Insulin like growth factor binding protein acid labile subunit OS=Mustela putorius furo OX=9669 GN=IGFALS PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.138e-26
Identity = 73/219 (33.33%), Postives = 117/219 (53.42%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +P + F     L +L++ G   +  L   +FR    L++  ++ N L  +   +F     LQ+L L  N I  +   AF   K LR+++LSHN +  + E TF GL+ L+VL L+HN ++ ++P AF  L  +  ++L HN+L  L  R+F  +  +  L LNDNQIR+I   AF GL +L  ++L  N L  L   +F  + RL ++ L+    C+ R
Sbjct:  185 LPDAAFHGLAGLHELVLAG-NRLTYLQPPLFRGLAELRELDLSRNALRSVKADVFVKLPRLQKLYLERNLIAAVAPGAFLGMKALRWLDLSHNRVSSLLEDTFPGLLGLHVLRLSHNALASLRPRAFKDLHFLEELQLGHNRLRQLPDRAFEGLGQLEVLTLNDNQIREIEAGAFAGLRSLAVMNLSGNCLRTLPPQLFLGLGRLHSLHLER--GCLGR 400          

HSP 2 Score: 96.6709 bits (239), Expect = 1.892e-17
Identity = 73/280 (26.07%), Postives = 128/280 (45.71%), Query Frame = 2
Query:  239 DNLFLNCSTSNIT-----------AIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR---------FPKIQLSENVVSRLRKF 1018
            D L + CS+ N+T           A+ ++  N+ S+PA+ F +  +L  L + G G+     E +      L+   +  N+L  +  + F     L  L L NN +  + E  F     L  +NL  N L  + +  F GL  L+ L+LA NR+++++P  F  L ++  ++L+ N L S+    F  +  + +L L  N I  ++  AF G+  L++L L +N++  L E  F  +  L  + L  +    +R           ++QL  N   RLR+ 
Sbjct:   54 DQLSVFCSSRNLTQLPDGIPLGTRALWLDGNNLSSIPAAAFRNLSSLAFLNLQGSGLASLEPEALL-GLQRLRHLHLERNQLRGLAARTFLHTPGLASLGLGNNLLGRLDEGLFQGLAGLWDLNLGWNSLAVLPDAAFHGLAGLHELVLAGNRLTYLQPPLFRGLAELRELDLSRNALRSVKADVFVKLPRLQKLYLERNLIAAVAPGAFLGMKALRWLDLSHNRVSSLLEDTFPGLLGLHVLRLSHNALASLRPRAFKDLHFLEELQLGHN---RLRQL 329          

HSP 3 Score: 87.8113 bits (216), Expect = 1.312e-14
Identity = 54/197 (27.41%), Postives = 98/197 (49.75%), Query Frame = 2
Query:  401 FRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSE 991
            F++   L++ ++  N+L  + ++ F     L+ L+L +N I+ I   AF   ++L  +NLS N L  +  + F GL  L+ L L    +  I+P  F+ L  +  + L HN ++++D +    +  +  L L  NQ+  +  +AF+GL  L+YL L  N+L+ L       ++      LD   NC+   P+  L +
Sbjct:  310 FKDLHFLEELQLGHNRLRQLPDRAFEGLGQLEVLTLNDNQIREIEAGAFAGLRSLAVMNLSGNCLRTLPPQLFLGLGRLHSLHLERGCLGRIRPRTFTGLSGLRRLFLKHNGIVAVDEQGLGGLAELQELDLTANQLTHLPGQAFQGLGKLEYLLLSGNRLVALAADTLRPLR--HVFWLDVSHNCLEALPEADLPQ 504          

HSP 4 Score: 85.5001 bits (210), Expect = 6.899e-14
Identity = 65/225 (28.89%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPK 976
            +RSV A  FV    L+KL +    +I  +  G F     L+   ++ N+++ + E  F     L  L L++N +  +   AF     L  + L HN L  + ++ FEGL  L VL L  N+I  I+  AF+ LR +  + L+ N L +L  + F  +  +  L L    +  I  + F GL  L+ L LK+N ++ ++E     +  L+  ELD   N +   P 
Sbjct:  230 LRSVKADVFVKLPRLQKLYLE-RNLIAAVAPGAFLGMKALRWLDLSHNRVSSLLEDTFPGLLGLHVLRLSHNALASLRPRAFKDLHFLEELQLGHNRLRQLPDRAFEGLGQLEVLTLNDNQIREIEAGAFAGLRSLAVMNLSGNCLRTLPPQLFLGLGRLHSLHLERGCLGRIRPRTFTGLSGLRRLFLKHNGIVAVDEQGLGGLAELQ--ELDLTANQLTHLPG 451          
BLAST of SMED30015272 vs. TrEMBL
Match: U3JPT1 (Insulin like growth factor binding protein acid labile subunit OS=Ficedula albicollis OX=59894 GN=IGFALS PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.204e-26
Identity = 77/219 (35.16%), Postives = 125/219 (57.08%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +P   F D  NL +LI+ G   +  L   +F     LK+  ++ N L  I   +F     LQ+L L +N I  I   AF   K+LR+++LSHN L+ +YE TF GL++L+VL L+ N I+ ++P  F  L+ +  ++L HN++ SL  RSF  +  +  L LN+NQ++DI   AF GL N+  + L  N + +L +S+F  + +L ++ L+   +C+ R
Sbjct:  184 LPDKVFHDLPNLRELILAG-NKLPYLQHQLFYGLTELKELDLSGNALKGIKINIFVKLQKLQKLYLNHNQITTIASRAFVGMKSLRWLDLSHNRLVSLYEDTFLGLLSLHVLRLSTNSIAGLRPRTFKDLQFLEELQLGHNRIRSLAERSFEGLGQLEVLSLNNNQLQDIRAGAFLGLHNVAVMHLSANCIKVLPDSVFKGVAKLHSLHLEH--SCVGR 399          

HSP 2 Score: 88.5817 bits (218), Expect = 7.061e-15
Identity = 70/255 (27.45%), Postives = 121/255 (47.45%), Query Frame = 2
Query:  269 NITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR---FPKIQLSENVVSRLRKFRS 1024
            N  A+ ++  N   +PA+ F +   L+ L +     +  +++  F     L    +  N+L  +    F     L  LSL NN    + E  F    NL ++NL  N L+ + +K F  L NL  LILA N++ +++   F  L ++  ++L+ N L  + I  F  +  + +L LN NQI  I+ +AF G+ +L++L L +N+L+ L E  F  +  L  + L  +    +R   F  +Q  E +     + RS
Sbjct:   74 NAKALWLDGNNFTLLPAAAFRNLSALDFLDLQS-SQLGSVEQHAFHGLRSLYHLHLERNRLKHLAPHTFLHTQNLVSLSLNNNHFSKVEEGLFAGLSNLWYLNLGWNSLVVLPDKVFHDLPNLRELILAGNKLPYLQHQLFYGLTELKELDLSGNALKGIKINIFVKLQKLQKLYLNHNQITTIASRAFVGMKSLRWLDLSHNRLVSLYEDTFLGLLSLHVLRLSTNSIAGLRPRTFKDLQFLEELQLGHNRIRS 327          

HSP 3 Score: 87.8113 bits (216), Expect = 1.375e-14
Identity = 63/214 (29.44%), Postives = 111/214 (51.87%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            ++ +    F+  +NL  L +N      +++EG+F    +L    +  N L ++ +K+F+    L+EL LA N +  +    F+    L+ ++LS N L GI    F  L  L  L L HN+I+ I   AF  ++ +  ++L+HN+L+SL   +F  + S+  L L+ N I  +  + FK L  L+ L L +N++  L E  F  + +LE + L+
Sbjct:  133 LKHLAPHTFLHTQNLVSLSLNN-NHFSKVEEGLFAGLSNLWYLNLGWNSLVVLPDKVFHDLPNLRELILAGNKLPYLQHQLFYGLTELKELDLSGNALKGIKINIFVKLQKLQKLYLNHNQITTIASRAFVGMKSLRWLDLSHNRLVSLYEDTFLGLLSLHVLRLSTNSIAGLRPRTFKDLQFLEELQLGHNRIRSLAERSFEGLGQLEVLSLN 345          

HSP 4 Score: 79.337 bits (194), Expect = 7.972e-12
Identity = 62/250 (24.80%), Postives = 117/250 (46.80%), Query Frame = 2
Query:  272 ITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIR------------------------DISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            +  + +N   I ++ +  FV  ++L  L ++   ++  L E  F   + L   ++++N +  +  + F     L+EL L +N I+ + E +F     L  ++L++N L  I    F GL N+ V+ L+ N I  +    F  + K+HS+ L H+ +  +   +F  + S+ RL L  N I                          +S + F GL NL+YL L +N+L+ + +  FS ++RL  ++L  +
Sbjct:  243 LQKLYLNHNQITTIASRAFVGMKSLRWLDLSHNRLVS-LYEDTFLGLLSLHVLRLSTNSIAGLRPRTFKDLQFLEELQLGHNRIRSLAERSFEGLGQLEVLSLNNNQLQDIRAGAFLGLHNVAVMHLSANCIKVLPDSVFKGVAKLHSLHLEHSCVGRIRASTFSGLSSLRRLFLQHNSISVIEEQSFSELHELLELDLKHNRLSHLSPQLFTGLSNLEYLFLSSNQLLEISQDTFSPLQRLFWLDLSHN 491          

HSP 5 Score: 74.7146 bits (182), Expect = 2.088e-10
Identity = 64/205 (31.22%), Postives = 102/205 (49.76%), Query Frame = 2
Query:  326 FVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            F D + LE+L + G   I  L E  F     L+   + +N+L  I    F     +  + L+ N IKV+ +  F     L  ++L H+ +  I   TF GL +L  L L HN IS I+  +FS L ++  ++L HN+L  L  + F  + ++  L L+ NQ+ +IS   F  L  L +L L +N+L  L+ S+ S +  L  + L
Sbjct:  309 FKDLQFLEELQL-GHNRIRSLAERSFEGLGQLEVLSLNNNQLQDIRAGAFLGLHNVAVMHLSANCIKVLPDSVFKGVAKLHSLHLEHSCVGRIRASTFSGLSSLRRLFLQHNSISVIEEQSFSELHELLELDLKHNRLSHLSPQLFTGLSNLEYLFLSSNQLLEISQDTFSPLQRLFWLDLSHNQLETLDNSIISPLANLRYLSL 512          

HSP 6 Score: 69.707 bits (169), Expect = 8.995e-9
Identity = 57/194 (29.38%), Postives = 95/194 (48.97%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL 883
            IRS+    F     LE L +N   + D +  G F    ++    +++N + ++ + +F   + L  L L ++ +  I    F    +LR + L HN +  I E++F  L  L  L L HNR+S + P  F+ L  +  + L+ NQLL +   +F  +  +  L L+ NQ+  +       L NL+YLSL+NN L
Sbjct:  325 IRSLAERSFEGLGQLEVLSLNNNQLQD-IRAGAFLGLHNVAVMHLSANCIKVLPDSVFKGVAKLHSLHLEHSCVGRIRASTFSGLSSLRRLFLQHNSISVIEEQSFSELHELLELDLKHNRLSHLSPQLFTGLSNLEYLFLSSNQLLEISQDTFSPLQRLFWLDLSHNQLETLDNSIISPLANLRYLSLRNNSL 517          
BLAST of SMED30015272 vs. TrEMBL
Match: A0A3B3B4J4 (Insulin-like growth factor binding protein, acid labile subunit OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.349e-26
Identity = 70/221 (31.67%), Postives = 126/221 (57.01%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFP 973
            +P + F D   L +LI+ G   +  L   +F+N + LK+  +T N L +I   +F   + LQ+L LA N I  +   AF   K+LR+++L++N L  ++E TF GL +L+VL L++N ++ I+P  F  L+ +  ++L+HN++ +L  R F  +  +  L L +NQ+++  M +F GL ++  ++L  +    L + MF  + +L ++ LD    C+ R P
Sbjct:  179 LPETVFQDLHGLRELILAG-NRLAYLQPQLFQNLVELKELDLTGNHLKVIKANVFVKLTKLQKLYLARNQIVTVVPRAFVGMKSLRWLDLTNNKLASLHEDTFLGLHSLHVLRLSNNSVAGIRPRTFRDLQYLEELQLSHNKIRALGDRIFDGLGHLEVLELQNNQVQEAQMGSFAGLSHVAVINLSGSCFSGLPDQMFKGLSKLHSLHLDR--GCLTRIP 396          

HSP 2 Score: 95.9005 bits (237), Expect = 3.299e-17
Identity = 74/248 (29.84%), Postives = 117/248 (47.18%), Query Frame = 2
Query:  308 SVPASYF-----VDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR---------FPKIQLSENVVSRL 1009
            S+PA+ F     +DF NL+       G++  LD   F+    L    +  N+L  +   +F +   L  LSL NN I  I E  F    ++  +NL  N L  + E  F+ L  L  LILA NR+++++P  F +L ++  ++L  N L  +    F  +  + +L L  NQI  +  +AF G+ +L++L L NNKL  L E  F  +  L  + L  +    IR           ++QLS N +  L
Sbjct:   82 SLPAASFRGLTDLDFLNLQS------GLLMTLDPQAFKGLRSLAHIHLERNRLRALPGTIFQNTPNLASLSLHNNQISRIDERLFAGLSHMWLLNLGWNSLTVLPETVFQDLHGLRELILAGNRLAYLQPQLFQNLVELKELDLTGNHLKVIKANVFVKLTKLQKLYLARNQIVTVVPRAFVGMKSLRWLDLTNNKLASLHEDTFLGLHSLHVLRLSNNSVAGIRPRTFRDLQYLEELQLSHNKIRAL 323          

HSP 3 Score: 72.4034 bits (176), Expect = 1.068e-9
Identity = 47/160 (29.38%), Postives = 90/160 (56.25%), Query Frame = 2
Query:  401 FRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNK 880
            FR+  +L++ +++ NK+  + +++F+    L+ L L NN ++     +F    ++  INLS +   G+ ++ F+GL  L+ L L    ++ I   AF+ L  +  + L HN +  ++ RSF ++  ++ L L+ N++  +S   F GL NL+YL L NN+
Sbjct:  304 FRDLQYLEELQLSHNKIRALGDRIFDGLGHLEVLELQNNQVQEAQMGSFAGLSHVAVINLSGSCFSGLPDQMFKGLSKLHSLHLDRGCLTRIPAQAFAGLSGLRRLFLQHNNISVVEYRSFADLVGLLGLDLSFNKLEVLSPHTFSGLKNLEYLLLVNNE 463          

HSP 4 Score: 69.3218 bits (168), Expect = 1.152e-8
Identity = 54/204 (26.47%), Postives = 101/204 (49.51%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFS 910
            +++ + A+ FV    L+KL +    I+  +    F     L+   +T+NKL  + E  F    +L  L L+NN++  I    F   + L  + LSHN +  + ++ F+GL +L VL L +N++   +  +F+ L  +  I L+ +    L  + F  +  +  L L+   +  I  +AF GL  L+ L L++N + ++E   F+
Sbjct:  223 HLKVIKANVFVKLTKLQKLYLARNQIVTVVPRA-FVGMKSLRWLDLTNNKLASLHEDTFLGLHSLHVLRLSNNSVAGIRPRTFRDLQYLEELQLSHNKIRALGDRIFDGLGHLEVLELQNNQVQEAQMGSFAGLSHVAVINLSGSCFSGLPDQMFKGLSKLHSLHLDRGCLTRIPAQAFAGLSGLRRLFLQHNNISVVEYRSFA 425          
BLAST of SMED30015272 vs. TrEMBL
Match: A0A3Q7VCR0 (insulin-like growth factor-binding protein complex acid labile subunit OS=Ursus arctos horribilis OX=116960 GN=IGFALS PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 9.482e-26
Identity = 73/219 (33.33%), Postives = 118/219 (53.88%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +P + F    NL +L++ G   +  L   +F     L++  ++ N L  I   +F     LQ+L L +N I  +   AF   K LR+++LSHN + G+ E TF GL+ L+VL L+HN I  ++P  F  L  +  ++L HN++  L  ++F  +  +  L LNDNQIR+I   AF GL  +  ++L  N L  L E +F  + RL ++ L+   +C+ R
Sbjct:  236 LPDAAFQGLANLRELVLAG-NKLAYLQPPLFCGLAELRELDLSRNALRSIKANVFVKLPKLQKLYLDHNLITAVAPGAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRLSHNAIVGLRPRTFKDLHFLEELQLGHNRIRQLPEKAFEGLGQLEVLTLNDNQIREIEAGAFLGLLGVAVMNLSGNCLRTLPEQVFRGLGRLHSLHLER--SCLGR 451          

HSP 2 Score: 96.6709 bits (239), Expect = 2.108e-17
Identity = 64/239 (26.78%), Postives = 115/239 (48.12%), Query Frame = 2
Query:  257 CSTSNIT-----------AIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            CS+ N+T           A+ ++  N+ S+PA  F +  +L  L + G G+   L+         L+   +  N+L  +  + F     L  L L NN +  + E  F    +L  +NL  N L  + +  F+GL NL  L+LA N++++++P  F  L ++  ++L+ N L S+    F  +  + +L L+ N I  ++  AF G+  L++L L +N++  L E  F  +  L  + L
Sbjct:  111 CSSRNLTRLPDGIPDGARALWLDGNNLSSIPADAFRNLSSLAFLNLQGSGLAS-LEPQALHGLQQLRHLHLERNQLRGLAARTFLHTPGLASLGLGNNLLGRVDEGLFQGLASLWDLNLGWNSLAVLPDAAFQGLANLRELVLAGNKLAYLQPPLFCGLAELRELDLSRNALRSIKANVFVKLPKLQKLYLDHNLITAVAPGAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRL 348          

HSP 3 Score: 73.9442 bits (180), Expect = 3.961e-10
Identity = 59/214 (27.57%), Postives = 102/214 (47.66%), Query Frame = 2
Query:  257 CSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEE 898
            C  + +  + ++   +RS+ A+ FV    L+KL ++   +I  +  G F     L+   ++ N++  + E  F     L  L L++N I  +    F     L  + L HN +  + EK FEGL  L VL L  N+I  I+  AF  L  +  + L+ N L +L  + F  +  +  L L  + +  I   AF GL  L+ L L+++ ++ +EE
Sbjct:  266 CGLAELRELDLSRNALRSIKANVFVKLPKLQKLYLDH-NLITAVAPGAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRLSHNAIVGLRPRTFKDLHFLEELQLGHNRIRQLPEKAFEGLGQLEVLTLNDNQIREIEAGAFLGLLGVAVMNLSGNCLRTLPEQVFRGLGRLHSLHLERSCLGRIRPHAFAGLSGLRRLFLRDSGIVAVEE 478          

HSP 4 Score: 72.7886 bits (177), Expect = 9.766e-10
Identity = 51/197 (25.89%), Postives = 98/197 (49.75%), Query Frame = 2
Query:  401 FRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSE 991
            F++   L++ ++  N++  + EK F     L+ L+L +N I+ I   AF     +  +NLS N L  + E+ F GL  L+ L L  + +  I+P AF+ L  +  + L  + +++++ +    +  ++ L L  N++  +    F+GL  L+YL L  N+L  L       ++R+    LD   N +   P+  L++
Sbjct:  361 FKDLHFLEELQLGHNRIRQLPEKAFEGLGQLEVLTLNDNQIREIEAGAFLGLLGVAVMNLSGNCLRTLPEQVFRGLGRLHSLHLERSCLGRIRPHAFAGLSGLRRLFLRDSGIVAVEEQGLGGLSELLELDLTANRLTHLPGPVFQGLGKLEYLLLSGNRLAALAADTLRPLRRV--FWLDVSHNRLEALPEADLAQ 555          
BLAST of SMED30015272 vs. Ensembl Cavefish
Match: lrig3 (leucine rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:103037077])

HSP 1 Score: 106.686 bits (265), Expect = 7.541e-24
Identity = 73/230 (31.74%), Postives = 126/230 (54.78%), Query Frame = 2
Query:  266 SNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            SN+  + ++   +R +    F     L  L +   GI  RL +G F    +++  ++  N LT +++       TLQ+L LA+N I  I   A+  C+ L  ++L+ N L  + E +F GL  L  L + HNR+SFI   AF  L  +++++L +N+ +S  I      F  ++++ +L L  N+IR ++ K+F GLD L+ L L NN +M ++ + FS+MK+LE + L+
Sbjct:  200 SNLQHLDLSRNRVRRIEGLTFHGLHRLRSLKMQRNGIT-RLMDGAFWGLSNMEILQLEYNNLTEVSKGWLYGLLTLQQLHLAHNAISRIKPDAWEFCQKLAELDLNSNQLARLEEGSFMGLSVLEQLSIGHNRVSFIADGAFRGLSLLNTLDLKYNE-ISWTIEDMNGPFSALNNLRKLFLQGNRIRSVTKKSFTGLDLLEQLDLSNNAIMSIQGNAFSQMKKLEELLLN 427          

HSP 2 Score: 57.7658 bits (138), Expect = 2.329e-8
Identity = 58/221 (26.24%), Postives = 107/221 (48.42%), Query Frame = 2
Query:  386 LDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCST-LQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRK-IHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---------INCIIRFPKIQLSENVVSRLRK 1015
            L EG+F +  HL + K+ +N+   I +  F S S  +  L LANN I  I          L  ++L +N L  +    F  L  L  L L +NRIS ++    ++L   +  + LN N+L S+  ++ F + ++  L L+ N++R I    F GL  L+ L ++ N +  L +  F  +  +E ++L+ +         +  ++   ++ L+ N +SR++ 
Sbjct:   73 LPEGLFTSLQHLSEIKLNNNEFETIPD--FGSHSGNITTLILANNKISKISSERLRPLVALETLDLGNNNLQEVRTGAFPPLP-LKNLYLNNNRISVLEHGCLNNLSSTLLVLRLNRNRLNSIPAKT-FQLSNLQHLDLSRNRVRRIEGLTFHGLHRLRSLKMQRNGITRLMDGAFWGLSNMEILQLEYNNLTEVSKGWLYGLLTLQQLHLAHNAISRIKP 289          

HSP 3 Score: 53.5286 bits (127), Expect = 4.173e-7
Identity = 40/125 (32.00%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFE---LAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLL 742
            + RL+EG F     L++  +  N+++ I +  F   S L  L L  N I    E     F    NLR + L  N +  + +K+F GL  L  L L++N I  I+  AFS ++K+  + LN + LL
Sbjct:  308 LARLEEGSFMGLSVLEQLSIGHNRVSFIADGAFRGLSLLNTLDLKYNEISWTIEDMNGPFSALNNLRKLFLQGNRIRSVTKKSFTGLDLLEQLDLSNNAIMSIQGNAFSQMKKLEELLLNTSSLL 432          

HSP 4 Score: 52.7582 bits (125), Expect = 7.556e-7
Identity = 53/222 (23.87%), Postives = 90/222 (40.54%), Query Frame = 2
Query:  383 RLDEGIFRNRIH--LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNI------------------------HSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRF 970
            RL +G    R+   + +  ++ NKL  + E LF S   L E+ L NN  + I +   H+                          N+  LILA+N+IS I       L  + +++L +N L  +   +F  +                         +++ L LN N++  I  K F+ L NLQ+L L  N++  +E   F  + RL ++++    N I R 
Sbjct:   46 RLTKGTAPGRLPAWVTQLDLSHNKLRALPEGLFTSLQHLSEIKLNNNEFETIPDFGSHSG-------------------------NITTLILANNKISKISSERLRPLVALETLDLGNNNLQEVRTGAFPPLPLKNLYLNNNRISVLEHGCLNNLSSTLLVLRLNRNRLNSIPAKTFQ-LSNLQHLDLSRNRVRRIEGLTFHGLHRLRSLKMQR--NGITRL 239          
BLAST of SMED30015272 vs. Ensembl Cavefish
Match: igfals (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:103036545])

HSP 1 Score: 103.99 bits (258), Expect = 3.530e-23
Identity = 64/219 (29.22%), Postives = 120/219 (54.79%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            +P + F D   L +L+++G   +  L   +F+    LK+  ++ N+L +I   +F     LQ+L LA N I  +   AF   K+LR+++LS N L  ++++TF GL +L+VL L++N I+ ++P  F  L+ +  +++ HNQ+ +L  R F  +  +  L L  N+++D     F GL +L  + L  +    L + +F  + +L ++ LD+   C+ +
Sbjct:  177 LPETGFHDLHGLRELVLSG-NRLAYLQPQLFQGLTELKELDLSGNQLRVIKANVFLKLPKLQKLYLAQNQITTVAPRAFVGMKSLRWLDLSRNRLTILHDETFLGLHSLHVLRLSNNSINSLRPGTFRDLQYLEELDMCHNQIRALGERVFEGLGHLEVLSLEYNKLQDARSGTFMGLSHLAVIKLTGSCFRSLPDQVFKGLSKLHSMHLDK--GCLTK 392          

HSP 2 Score: 97.0561 bits (240), Expect = 5.988e-21
Identity = 67/239 (28.03%), Postives = 117/239 (48.95%), Query Frame = 2
Query:  257 CSTSNITAIMIN-PGNIRSV----------PASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            CS+ N+T    + P + RS+          PA  F +  NL+ L +   G +  LD  +F+   +L    +  N L I+   +F +   L  L+L NN +  I E  F    ++  +NL  N L  + E  F  L  L  L+L+ NR+++++P  F  L ++  ++L+ NQL  +    F  +  + +L L  NQI  ++ +AF G+ +L++L L  N+L +L +  F  +  L  + L
Sbjct:   52 CSSRNLTQAPPDLPASTRSLWLDGNLFATLPADSFKNLTNLDFLNLQS-GQLTSLDSQVFKRLHNLAHLHLERNSLRILPAAIFQNTPNLATLNLHNNQLSRIEERLFAGLSHMWLLNLGWNSLSVLPETGFHDLHGLRELVLSGNRLAYLQPQLFQGLTELKELDLSGNQLRVIKANVFLKLPKLQKLYLAQNQITTVAPRAFVGMKSLRWLDLSRNRLTILHDETFLGLHSLHVLRL 289          

HSP 3 Score: 90.1225 bits (222), Expect = 9.592e-19
Identity = 78/287 (27.18%), Postives = 131/287 (45.64%), Query Frame = 2
Query:  104 CPNHCQCDGVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYKSDW--DNLFLNCST------SNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            C   C C          S  SV+C     +T     +    +S W   NLF           +N+  + +  G + S+ +  F    NL  L +     +  L   IF+N  +L    + +N+L+ I E+LF   S +  L+L  N++ V+ E  FH    LR + LS N L  +  + F+GL  L  L L+ N++  IK   F  L K+  + L  NQ+ ++  R+F  + S+  L L+ N++  +  + F GL +L  L L NN +  L    F +++ LE +++
Sbjct:   33 CSKRCTC----LLDDYTSELSVYCSSR-NLTQAPPDLPASTRSLWLDGNLFATLPADSFKNLTNLDFLNLQSGQLTSLDSQVFKRLHNLAHLHLER-NSLRILPAAIFQNTPNLATLNLHNNQLSRIEERLFAGLSHMWLLNLGWNSLSVLPETGFHDLHGLRELVLSGNRLAYLQPQLFQGLTELKELDLSGNQLRVIKANVFLKLPKLQKLYLAQNQITTVAPRAFVGMKSLRWLDLSRNRLTILHDETFLGLHSLHVLRLSNNSINSLRPGTFRDLQYLEELDM 313          

HSP 4 Score: 77.7962 bits (190), Expect = 8.336e-15
Identity = 67/251 (26.69%), Postives = 112/251 (44.62%), Query Frame = 2
Query:  296 GN-IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFA------------------------FSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFP 973
            GN +R + A+ F+    L+KL +     I  +    F     L+   ++ N+LTI+ ++ F    +L  L L+NN+I  +    F   + L  +++ HN +  + E+ FEGL +L VL L +N++   +                           F  L K+HS+ L+   L  +  + F  + S+ RL L  N I  +  ++F  L  LQ L ++ N L  L    F  +K LE + L +  N I  FP
Sbjct:  219 GNQLRVIKANVFLKLPKLQKLYL-AQNQITTVAPRAFVGMKSLRWLDLSRNRLTILHDETFLGLHSLHVLRLSNNSINSLRPGTFRDLQYLEELDMCHNQIRALGERVFEGLGHLEVLSLEYNKLQDARSGTFMGLSHLAVIKLTGSCFRSLPDQVFKGLSKLHSMHLDKGCLTKVSTQGFIGLASLRRLFLQHNNISAVDRQSFVELQGLQQLDMRFNNLASLTSHTFYGLKALEYLLLSK--NLIRHFP 466          

HSP 5 Score: 70.8626 bits (172), Expect = 1.283e-12
Identity = 58/217 (26.73%), Postives = 97/217 (44.70%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            +I S+    F D + LE+L +     I  L E +F    HL+   +  NKL       F   S L  + L  +  + + +  F     L  ++L    L  +  + F GL +L  L L HN IS +   +F  L+ +  +++  N L SL   +F+ + ++  LLL+ N IR    +    L  L +L L  NKL +L  +    + RL  + L ++
Sbjct:  293 SINSLRPGTFRDLQYLEELDMCH-NQIRALGERVFEGLGHLEVLSLEYNKLQDARSGTFMGLSHLAVIKLTGSCFRSLPDQVFKGLSKLHSMHLDKGCLTKVSTQGFIGLASLRRLFLQHNNISAVDRQSFVELQGLQQLDMRFNNLASLTSHTFYGLKALEYLLLSKNLIRHFPSEVLLPLQQLSWLDLSGNKLEVLINATLYMLPRLRYLNLKDN 508          
BLAST of SMED30015272 vs. Ensembl Cavefish
Match: lrig1 (leucine rich repeats and immunoglobulin like domains 1 [Source:NCBI gene;Acc:103023104])

HSP 1 Score: 93.2041 bits (230), Expect = 1.601e-19
Identity = 62/195 (31.79%), Postives = 101/195 (51.79%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            I +L +G F     ++   +  N L  +         +L  L L+NN+I       +  C+ LR ++L HN L  + E +F  LVNL  L L+HN IS I   AF  L  +  +EL+HN  +S  I     +F  + S+ +L L  N+I+ ++ +AF GL+ L++L+L  N +  +    FS+MK L ++E+  D
Sbjct:  242 ISKLTDGAFWGLARMRTLHLDYNSLKEVNSGSLYGLESLLYLHLSNNSISSFNPEGWGFCERLRELHLVHNNLSKLTEGSFAKLVNLQTLRLSHNTISHIAEGAFRGLSSLRLLELDHND-ISGTIEDTNGAFAGLDSLRKLTLFGNRIKSVAKRAFLGLEGLEHLNLGENSIRSILPEAFSKMKNLRSLEILSD 435          

HSP 2 Score: 68.5514 bits (166), Expect = 1.012e-11
Identity = 46/155 (29.68%), Postives = 79/155 (50.97%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL 883
            L + +++ N+L +I    F   S+L+ L L  N I  + + AF     +R ++L +N L  +   +  GL +L  L L++N IS   P  +    ++  + L HN L  L   SF  + ++  L L+ N I  I+  AF+GL +L+ L L +N +
Sbjct:  208 LTQLELSRNRLRLIEGLTFQGLSSLEVLKLQRNNISKLTDGAFWGLARMRTLHLDYNSLKEVNSGSLYGLESLLYLHLSNNSISSFNPEGWGFCERLRELHLVHNNLSKLTEGSFAKLVNLQTLRLSHNTISHIAEGAFRGLSSLRLLELDHNDI 362          

HSP 3 Score: 59.3066 bits (142), Expect = 7.272e-9
Identity = 47/175 (26.86%), Postives = 85/175 (48.57%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHT-CKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            LK   +++N++  + E  F     ++EL L++N I  +   AF     +L+ + LS N L  +  K  E L  L  L L+ NR+  I+   F  L  +  ++L  N +  L   +F+ +  M  L L+ N +++++  +  GL++L YL L NN +       +   +RL  + L
Sbjct:  136 LKVLDLSNNEIIDLREHCFPPGLRIRELILSSNKIVHLESGAFRNLASSLQILRLSRNRLTQLPVKGLE-LPKLTQLELSRNRLRLIEGLTFQGLSSLEVLKLQRNNISKLTDGAFWGLARMRTLHLDYNSLKEVNSGSLYGLESLLYLHLSNNSISSFNPEGWGFCERLRELHL 309          
BLAST of SMED30015272 vs. Ensembl Cavefish
Match: lrrtm4l1 (leucine-rich repeat transmembrane neuronal protein 4-like [Source:NCBI gene;Acc:103034268])

HSP 1 Score: 88.9669 bits (219), Expect = 2.004e-18
Identity = 93/349 (26.65%), Postives = 157/349 (44.99%), Query Frame = 2
Query:  104 CPNHCQCDG-VVKCSVVQSHQSVFCPVNWEITSIIVSI-------TMPYKSDWDNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDI-NCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKTPSTTISAKFHLNSSRTSEELKKY 1123
            CP +C+C+G +V C    S   +  P N  +T   +S+        +PY+    N  L         + ++   I  V +  F   R L++LI++    I +L    F    +L+   ++ NKL  +    F+    LQ L L +N +  I   AF  C++L F++L +N L  +    F GL  L  L L HN+ S I  F F  L  +  + L  N++ +++    +  +++ +L L+ N+I+ +    F+ L NLQ L+L++NKL  +     +    L T+ L  ++ +C    P I     +V+ LR FR         K  S   S+  HL   +  E  K Y
Sbjct:   31 CPYNCRCEGKIVHCD---SASFMDVPENISVTCQGLSLRNNDLHTMLPYQFAHLNQLL--------WLYLDHNQISFVDSRAFQGIRRLKELILST-NRISQLHNATFHGVPNLRSLDLSYNKLQELQPGQFHGLRKLQNLHLRSNGLTTIPIRAFIECRSLEFLDLGYNRLRILTRTAFLGLSRLMELHLEHNQFSRINLFLFPRLANLRGLYLQWNRIRAVNQGLPWIWYTLQKLDLSGNEIQSLDPVVFQCLPNLQVLNLESNKLANVSHETVASWISLTTISLAGNVWDC---GPGIC---PLVAWLRNFRGT-------KDTSIICSSPKHLQGEKVMEATKNY 354          
BLAST of SMED30015272 vs. Ensembl Cavefish
Match: LRRTM4 (leucine rich repeat transmembrane neuronal 4 [Source:NCBI gene;Acc:103022409])

HSP 1 Score: 86.6557 bits (213), Expect = 1.146e-17
Identity = 73/286 (25.52%), Postives = 132/286 (46.15%), Query Frame = 2
Query:  104 CPNHCQCDGVVKCSVVQSHQSVFCPVNWEITSIIVSITMPY---KSDWDNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDI 952
            CP  C+CDG     +V    + F  V   ++     +++ Y    S     F   S S +  + ++   I  V +  F   R L++LI++    I +L+   F    +L+   ++ NKL ++    F     L  L + +N++K++    F  C+NL F++L +N L  +    F GL+ L  L L HN+ S I    F  L  + ++ L  N++ S+     +   S+ +L L+ N +  +    ++ L NLQ L+L +NKL  + +   +    L T+ L  +I
Sbjct:   32 CPRSCRCDG----KIVYCESNAFRDVPKNVSMGCQGLSLRYNSLASLRGGQF--ASLSQLVWLYLDHNYISVVDSQAFQGVRRLKELILSS-NKITQLENSTFHTIPNLRNLDLSYNKLQLLQPNQFQGLRKLLSLHMRSNSLKIVPMRVFQDCRNLEFLDLGYNRLRSLTRNAFAGLLKLTELHLEHNQFSKINLSHFPRLNNLRALYLQWNRIKSVSQGITWTWTSLQKLDLSGNDLHVLDAVIYQCLPNLQTLNLDSNKLSNVSQETVAAWISLTTISLAGNI 310          
BLAST of SMED30015272 vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 103.605 bits (257), Expect = 8.759e-24
Identity = 75/228 (32.89%), Postives = 123/228 (53.95%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSENVVSRLRKFRSCYKGE 1039
            I RL +G F     L+   +  N LT +T+      S+LQ+L++++N +  I   A+  C+ L  ++LSHN L  I E TF GL  L  L+LAHN +S I   AF  LR + +++L  N++ S  I     +F  + ++ +L+L++N+I+ I+ KAF GL+ L  L L NN LM +++  FS +K L  + L+      +C +++    L E      R FR   + +
Sbjct:  124 IGRLMDGAFWRLEKLEILHLDFNALTNVTKGWLYGLSSLQQLNMSHNNVSRIDLDAWEFCQKLDELDLSHNHLSRIEEGTFVGLGMLRSLLLAHNHLSNIADGAFKELRSLLTLDLAGNEI-SWTIEDMHGAFTGLENLNKLVLSENKIKSIAKKAFIGLERLHSLDLSNNALMSIQDGSFSSLKALTEMRLNSSSLLCDCTLKWLSPWLEE------RGFRDTVEAD 344          
BLAST of SMED30015272 vs. Ensembl Sea Lamprey
Match: LRRTM4 (leucine rich repeat transmembrane neuronal 4 [Source:HGNC Symbol;Acc:HGNC:19411])

HSP 1 Score: 99.3673 bits (246), Expect = 1.781e-22
Identity = 100/377 (26.53%), Postives = 161/377 (42.71%), Query Frame = 2
Query:   23 RKMLFHLVFIKSIFHFIEFIEMTTRNICPNHCQCDGVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYKSDWD-NLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLL-LNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDI-----------------------NCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKTPSTTISAK 1078
            R M+F   FI S          T    C   C+CD  VK    +S      P N  I++  + +++ Y S  + N     S   +T + ++   + +V A  F   R L++LI++    I  L  G FR   +L+   ++ N+L I+   LF     LQ L L +NTIK +    F  C+NL F++L +N L  +    F GL  L  L + HN+ S +    F  L  +  + L  N++  +  +    I S +++L L+ N+++ +   AF+ + NLQ L L +NK   L   + S +K L  + L  ++                       N I   PK    ENV+  +  +  C  GE    T   T  A 
Sbjct:   18 RLMIFTAAFILSF--------PTVEGACSKSCKCD--VKIVYCESLGLKGLPRN--ISAGTLGLSLRYNSLQELNYNQFASFRQLTWLYLDHNYVHTVDAHAFQGIRRLKELILSS-NRISNLANGTFRPISNLRNLDLSYNQLQILDPDLFRGLRKLQSLHLRSNTIKTMPVRIFQDCRNLEFLDLGYNRLRSLARNAFAGLTRLTELHMEHNQFSKVNFAHFPRLMSLRHLYLQGNKISEM-TQGMVWIWSTLQILDLSGNELQSLRANAFEYVPNLQTLRLDSNKFTTLTHEVLSSLKSLNLISLSGNLWECDRKLCALGSWLTTFGIRREKNMICAGPKHLEGENVMEAIDNYNIC--GERPRVTAEPTAPAP 378          
BLAST of SMED30015272 vs. Ensembl Sea Lamprey
Match: flrt3 (fibronectin leucine rich transmembrane 3 [Source:ZFIN;Acc:ZDB-GENE-030131-1988])

HSP 1 Score: 92.4337 bits (228), Expect = 2.997e-20
Identity = 69/209 (33.01%), Postives = 116/209 (55.50%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGI-IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLL--GIYEKTFEGLVNLYVLILAHNRI-SFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNN------KLMLLEE 898
            +R +        R LEKL ++   +    +++G FR    +K    +SN+L  +   L  S   L+EL L +N I  I E  F    NL+ +NL  N L   GI++ +F  LV L  L LA+N + S  + F  ++L+K+H   L HN + ++   SF ++H+++ L L++N I+ + ++AF GL+NL+ L+L+NN      KL+LL++
Sbjct:  112 LRRISTEALSQIRLLEKLHLDDNALATSEIEQGAFRELSSIKGLFFSSNQLLSVPYDLPKS---LEELQLESNRITTILENTFEGMVNLKHLNLDWNALTSEGIHDSSFADLVELEELSLANNLLTSPPRIFPGTNLQKLH---LQHNNITTIPSNSFLSLHNLVYLDLSENHIQSLPVEAFSGLNNLKQLTLQNNPWLCDRKLLLLKD 314          
BLAST of SMED30015272 vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 88.9669 bits (219), Expect = 3.945e-19
Identity = 60/192 (31.25%), Postives = 103/192 (53.65%), Query Frame = 2
Query:  377 IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSL--DIR-SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            I  L +G F     ++K ++  N+LT ++        +L+ L ++ N I  +   A+  C+NL  ++LSHN L  + E  F  L  L  L LAHN IS I   AF  L  +  ++L  NQ+     D++ +F  + ++ +L L+ NQI+ I+ KAF GL+ L  L L  N ++ ++ + F+ +K L  ++L+
Sbjct:   79 ISSLMDGAFWGLHRIQKIQLQHNRLTEVSTGWLYGLQSLRHLHVSRNAITAMDSEAWKFCENLWELDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDLGGNQISWTVEDMQGAFTGLSALSKLSLHGNQIKSIAKKAFVGLERLGQLDLMGNAIVSIQANAFNTLKLLHQMKLN 270          

HSP 2 Score: 73.1738 bits (178), Expect = 4.891e-14
Identity = 52/170 (30.59%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  434 MTSNKLTIITEKLFNS-CSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            + +N++ ++    F++  +TL+ L L+NN I V+    F    +L+ ++LS N L  +    F  L +L  L L  NRIS +   AF  L +I  I+L HN+L  +     + + S+  L ++ N I  +  +A+K  +NL  L L +N L  L E+ F E+  L+++ L
Sbjct:    2 LNNNRIKVLRPASFDTFGATLKILKLSNNRITVLTTKLFQ-LPSLQHLDLSRNRLQRVEGLAFSELASLEYLRLQRNRISSLMDGAFWGLHRIQKIQLQHNRLTEVSTGWLYGLQSLRHLHVSRNAITAMDSEAWKFCENLWELDLSHNGLTRLNEAAFVELGALQSLSL 170          

HSP 3 Score: 72.0182 bits (175), Expect = 9.145e-14
Identity = 46/174 (26.44%), Postives = 91/174 (52.30%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            LK  K+++N++T++T KLF    +LQ L L+ N ++ +  LAF    +L ++ L  N +  + +  F GL  +  + L HNR++ +       L+ +  + ++ N + ++D  ++    ++  L L+ N +  ++  AF  L  LQ LSL +N +  + E  F  +  L  ++L
Sbjct:   22 LKILKLSNNRITVLTTKLFQ-LPSLQHLDLSRNRLQRVEGLAFSELASLEYLRLQRNRISSLMDGAFWGLHRIQKIQLQHNRLTEVSTGWLYGLQSLRHLHVSRNAITAMDSEAWKFCENLWELDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDL 194          

HSP 4 Score: 58.9214 bits (141), Expect = 1.558e-9
Identity = 44/156 (28.21%), Postives = 81/156 (51.92%), Query Frame = 2
Query:  506 LANNTIKVIFELAFHT-CKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRF 970
            L NN IKV+   +F T    L+ + LS+N +  +  K F+ L +L  L L+ NR+  ++  AFS L  +  + L  N++ SL   +F+ +H + ++ L  N++ ++S     GL +L++L +  N +  ++   +   + L   ELD   N + R 
Sbjct:    2 LNNNRIKVLRPASFDTFGATLKILKLSNNRITVLTTKLFQ-LPSLQHLDLSRNRLQRVEGLAFSELASLEYLRLQRNRISSLMDGAFWGLHRIQKIQLQHNRLTEVSTGWLYGLQSLRHLHVSRNAITAMDSEAWKFCENL--WELDLSHNGLTRL 154          
BLAST of SMED30015272 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010345.1 (pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1 gene:ENSPMAG00000009370.1 transcript:ENSPMAT00000010345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 3.699e-18
Identity = 55/173 (31.79%), Postives = 91/173 (52.60%), Query Frame = 2
Query:  431 KMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            K+ +N++T I    F + + L+ + L +N I      AF   K+L+ INL  N +  +  K F+G+ +L  LIL  N I       F  L ++  +++  N + SL   +F +  S++ L L  N+I+ IS KAF GL NL YL+L NNK+  +       ++ LE + L+ +
Sbjct:   65 KLANNEITNIGANAFQNLNHLKNIHLESNHISGFDSRAFAGAKSLQMINLYGNNIRSLQSKAFQGVPSLKYLILGKNSILSFTSSTFQGLSELSDLDMPMNNITSLPALAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDNNKITTIAPGTLQSLQNLEMLVLNNN 237          

HSP 2 Score: 76.6406 bits (187), Expect = 1.461e-15
Identity = 60/242 (24.79%), Postives = 113/242 (46.69%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLE---------TVELDEDINCIIRFPKIQLSENVV 1000
            ++SVP+    D   + KL  N    I  +    F+N  HLK   + SN ++    + F    +LQ ++L  N I+ +   AF    +L+++ L  N +L     TF+GL  L  L +  N I+ +   AF     +  ++L +N++  +  ++F  + ++  L L++N+I  I+    + L NL+ L L NN +  +  S F  +  L          +V   +  N  I+  ++ +S+N +
Sbjct:   50 MKSVPSKIPSDASTI-KLANNE---ITNIGANAFQNLNHLKNIHLESNHISGFDSRAFAGAKSLQMINLYGNNIRSLQSKAFQGVPSLKYLILGKNSILSFTSSTFQGLSELSDLDMPMNNITSLPALAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDNNKITTIAPGTLQSLQNLEMLVLNNNNIKRVTSSTFKGLTNLRELYFSNNMVSVLTKDAFNSNIKLTQLTISDNKI 287          

HSP 3 Score: 76.2554 bits (186), Expect = 1.907e-15
Identity = 75/295 (25.42%), Postives = 130/295 (44.07%), Query Frame = 2
Query:  104 CPNHCQC------DGV-VKC---------SVVQSHQSVFCPVNWEITSIIVSITMPYKSDWDNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            CP+ C+C      DG+ V C         S + S  S     N EIT+I             N F N +  ++  I +   +I    +  F   ++L+ + + G  I   L    F+    LK   +  N +   T   F   S L +L +  N I  +  LAF    +L  ++L++N +  I  K F GL NL  L L +N+I+ I P    SL+ +  + LN+N +  +   +F  + ++  L  ++N +  ++  AF     L  L++ +NK+ ++E   FS +  L+ + L
Sbjct:   26 CPSGCKCAKQSQQDGLDVDCGDQRMKSVPSKIPSDASTIKLANNEITNI-----------GANAFQNLN--HLKNIHLESNHISGFDSRAFAGAKSLQMINLYGNNI-RSLQSKAFQGVPSLKYLILGKNSILSFTSSTFQGLSELSDLDMPMNNITSLPALAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDNNKITTIAPGTLQSLQNLEMLVLNNNNIKRVTSSTFKGLTNLRELYFSNNMVSVLTKDAFNSNIKLTQLTISDNKIKVIEAGTFSTLSGLQMIYL 306          

HSP 4 Score: 48.1358 bits (113), Expect = 2.474e-6
Identity = 41/147 (27.89%), Postives = 68/147 (46.26%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGI--IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHN 733
            NI S+PA   + F++   L+I       I ++    F    +L    + +NK+T I      S   L+ L L NN IK +    F    NLR +  S+N++  + +  F   + L  L ++ N+I  I+   FS+L  +  I L+ N
Sbjct:  166 NITSLPA---LAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDNNKITTIAPGTLQSLQNLEMLVLNNNNIKRVTSSTFKGLTNLRELYFSNNMVSVLTKDAFNSNIKLTQLTISDNKIKVIEAGTFSTLSGLQMIYLHGN 309          
BLAST of SMED30015272 vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 83.5741 bits (205), Expect = 7.148e-17
Identity = 62/193 (32.12%), Postives = 99/193 (51.30%), Query Frame = 2
Query:  392 EGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKN---LRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQL------LSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
             G F  +  L++  +  N  T I    F     LQ L L +N I  I    F   ++   LR +NL  N L  I + TF+ L+ L VL LA+NRI  I   +FS LR +  ++L++N +      ++   R   N+ S   L L+ N+I  I+  AF GL+N++YL+L  N +  ++E+ F  M +L+ + L+
Sbjct:  288 RGAFWGQNKLQQLYLDRNNFTAIQTSSFFGLRDLQNLYLQSNQISTIITTKFADWRSFPVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLAS---LRLDGNRITAIAATAFLGLENIKYLNLSANIITSIQENSFQGMDKLQKLWLN 477          

HSP 2 Score: 62.003 bits (149), Expect = 3.874e-10
Identity = 48/173 (27.75%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  431 KMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHS---MIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            K+  N+LT +     +   +L+ L L+ N    I   AF+   +L  + LS N +  I    F G   L  L L  N  + I+  +F  LR + ++ L  NQ+ ++    F +  S   + +L L  N++  I    FK L  L+ L+L NN++  + +  FS+++ LE ++L
Sbjct:  230 KLGKNRLTSVPSDALSQLQSLKRLDLSRNFFTSILASAFNRLSSLEVLKLSKNRISTI-RGAFWGQNKLQQLYLDRNNFTAIQTSSFFGLRDLQNLYLQSNQISTIITTKFADWRSFPVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDL 401          

HSP 3 Score: 61.2326 bits (147), Expect = 6.618e-10
Identity = 56/185 (30.27%), Postives = 90/185 (48.65%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGI--IDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEK---TFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIR-DISMKAF 835
            N  ++  S F   R+L+ L +    I  I       +R+   L+K  +  N+L+ I +  F     L+ L+LANN I  I + +F   ++L  ++LS+N +    E+    F GL NL  L L  NRI+ I   AF  L  I  + L+ N + S+   SF  +  + +L LN +Q+  D  +K F
Sbjct:  306 NFTAIQTSSFFGLRDLQNLYLQSNQISTIITTKFADWRSFPVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLDGNRITAIAATAFLGLENIKYLNLSANIITSIQENSFQGMDKLQKLWLNTSQLMCDCKIKWF 490          
BLAST of SMED30015272 vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 70.8626 bits (172), Expect = 1.042e-13
Identity = 60/208 (28.85%), Postives = 103/208 (49.52%), Query Frame = 2
Query:  326 FVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLG--IYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIE---LNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETV 934
            F D++ L+ L ++   I D + +G F N  +LK+  +  NK+  ++  +F    +L++L L  N +K +    F   K+LR + L  N  +G  I E  F GL NL  L ++   +  I    F SL  +  ++   +N+N L ++ + +   +  +  L L+ N I  +S  AF     LQ L L NN + L+ E  FS++K L  +
Sbjct:   14 FQDYQYLKWLDLSNNDISD-IQDGTFENLRYLKQLNLGENKIRTVSASMFKGLVSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNNSLTTVPLHALRKVKFLKELDLSANLISYVSSTAFANNSKLQKLLLHNNTIRLIHEDAFSQLKGLRAL 220          

HSP 2 Score: 52.7582 bits (125), Expect = 1.026e-7
Identity = 40/142 (28.17%), Postives = 71/142 (50.00%), Query Frame = 2
Query:  521 IKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQ--IRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVEL 940
            +K++   +F   + L++++LS+N +  I + TFE L  L  L L  N+I  +    F  L  +  ++L  N L +L    F  + S+  L L+DN+     I   AF GLDNL+ L +    +  + +  F  +  LE +++
Sbjct:    6 LKLLKNTSFQDYQYLKWLDLSNNDISDIQDGTFENLRYLKQLNLGENKIRTVSASMFKGLVSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDV 147          

HSP 3 Score: 49.6766 bits (117), Expect = 1.216e-6
Identity = 38/149 (25.50%), Postives = 75/149 (50.34%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLII-NGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELS---LANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHN 733
            +++++P   F   ++L +L + +   +  R++EG F    +L+K  +++  +  IT+  F S  +L+ L    + NN++  +   A    K L+ ++LS NL+  +    F     L  L+L +N I  I   AFS L+ + ++ L  N
Sbjct:   77 DLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNNSLTTVPLHALRKVKFLKELDLSANLISYVSSTAFANNSKLQKLLLHNNTIRLIHEDAFSQLKGLRALFLRGN 225          
BLAST of SMED30015272 vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 68.1662 bits (165), Expect = 2.913e-12
Identity = 61/206 (29.61%), Postives = 102/206 (49.51%), Query Frame = 2
Query:  296 GNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHS----IELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEES 901
              ++++P S     RNL  L +N    I  L    F N + L+   +++N+L++I    F S   L+ L+L +N ++V++   F   ++LR+++L HN +  I +  F     L  L ++ NR+S    F   +LR + S    + L  N L  + I+  FNI     L L DN +    + AF GL +L+ L L  NKL  + E+
Sbjct:   61 ATLQTIPTSLP---RNLGSLFLN-TNHIRALQAKAFANYLSLRVLDLSNNELSVIANGTFKSLGKLKTLTLNSNRLEVVYAETFRGLRDLRYLSLRHNSIRTIGDGAFRFSAFLICLDISFNRLS---EFKTETLRGLSSTLTELRLRSNILRRVAIKRRFNI---TLLDLGDNLLEVFEVDAFDGL-SLRKLRLDGNKLDEIPEA 255          
BLAST of SMED30015272 vs. Ensembl Nematostella
Match: EDO31669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXA1])

HSP 1 Score: 64.3142 bits (155), Expect = 7.076e-11
Identity = 40/140 (28.57%), Postives = 73/140 (52.14%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFK 838
            +KK  +  N +  I    F + + L+ L L+ N ++ +    F T   LR ++L  N L G+    F GL +L  L L  N+I  I+P+ F+SL+ + S+ L+ NQL  +   +   + ++  + +  N++R ++  AFK
Sbjct:  121 MKKLNLRRNGIKEIEFGAFRNLTALESLILSKNKLRRLTYAMFDTLSYLRLLSLVDNRLTGLTRSMFSGLKSLRELYLQRNQIQDIEPWTFTSLKSLASLYLDSNQLTVISRDTLLGLTNVKDIHVYFNKLRYVARDAFK 260          

HSP 2 Score: 61.2326 bits (147), Expect = 7.096e-10
Identity = 46/175 (26.29%), Postives = 82/175 (46.86%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            ++   ++ N+ + I    F     +++L+L  N IK I   AF     L  + LS N L  +    F+ L  L +L L  NR++ +    FS L+ +  + L  NQ+  ++  +F ++ S+  L L+ NQ+  IS     GL N++ + +  NKL  +    F    +L  +  D
Sbjct:   97 IRTLDLSGNRFSKIRFNTFGYLPGMKKLNLRRNGIKEIEFGAFRNLTALESLILSKNKLRRLTYAMFDTLSYLRLLSLVDNRLTGLTRSMFSGLKSLRELYLQRNQIQDIEPWTFTSLKSLASLYLDSNQLTVISRDTLLGLTNVKDIHVYFNKLRYVARDAFKPNPQLTRIVWD 271          

HSP 3 Score: 54.6842 bits (130), Expect = 6.531e-8
Identity = 43/129 (33.33%), Postives = 70/129 (54.26%), Query Frame = 2
Query:  560 NLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLL-LNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            N+R ++LS N    I   TF  L  +  L L  N I  I+  AF +L  + S+ L+ N+L  L   + F+  S +RLL L DN++  ++   F GL +L+ L L+ N++  +E   F+ +K L ++ LD
Sbjct:   96 NIRTLDLSGNRFSKIRFNTFGYLPGMKKLNLRRNGIKEIEFGAFRNLTALESLILSKNKLRRLTY-AMFDTLSYLRLLSLVDNRLTGLTRSMFSGLKSLRELYLQRNQIQDIEPWTFTSLKSLASLYLD 223          

HSP 4 Score: 52.373 bits (124), Expect = 3.484e-7
Identity = 41/153 (26.80%), Postives = 70/153 (45.75%), Query Frame = 2
Query:  434 MTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLL 892
            +  N+L+++    F   + ++ L L+ N    I    F     ++ +NL  N +  I    F  L  L  LIL+ N++  +    F +L  +  + L  N+L  L    F  + S+  L L  NQI+DI    F  L +L  L L +N+L ++
Sbjct:   78 LNDNRLSLLRYDFFLGLNNIRTLDLSGNRFSKIRFNTFGYLPGMKKLNLRRNGIKEIEFGAFRNLTALESLILSKNKLRRLTYAMFDTLSYLRLLSLVDNRLTGLTRSMFSGLKSLRELYLQRNQIQDIEPWTFTSLKSLASLYLDSNQLTVI 230          
BLAST of SMED30015272 vs. Ensembl Nematostella
Match: EDO49136 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGZ6])

HSP 1 Score: 60.077 bits (144), Expect = 8.280e-10
Identity = 75/303 (24.75%), Postives = 114/303 (37.62%), Query Frame = 2
Query:  416 HLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFR-SCYKGENDLKTPSTTISAKFHL---NSSRTSEELKKYSWEKNIDELSSSLIKIQNPISNKCFNCTNSLSCVYTHIWISFLAGIMTL-GCLVLIVGFFVYV 1309
            H     +  N L  +T     +   L EL+L  N I  I    F     L  ++LS N L  I E  F GL NL  L L  N I  +    F     +  + +N N +  L    F N   +  L ++DN +  I    FKG   L+ LSL NN               L+TVE D+  N +   P ++L   + ++L + R S +K    +    +   AK+ +   N SR    L +  +  + D+ +           N  + C       +    +     I  L GC     G +V V
Sbjct:   52 HTTHLDLLGNLLITVTRGYLRNLRQLLELNLGMNQIDYIASGTFTDMAKLELLDLSGNQLTFISEGMFTGLRNLTTLFLFMNEILDLPASLFWGTPNLKILSINRNNITKLHQHLFRNSLHLEYLFMDDNNLTTIKPNTFKGARALEILSLTNNVA-------------LKTVE-DDTFN-VANLPNLRLMYILNTQLVRIRMSQFKDHQKVGVVISPTVAKYPIMAANDSRLQGGLGRNGFTCDGDQCTPCHFGEFQTRENDTYYCKKCPPGGFYQNAVGHFGKIAGLTGCRPCARGTYVKV 339          

HSP 2 Score: 54.6842 bits (130), Expect = 4.345e-8
Identity = 47/180 (26.11%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  308 SVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLN---DNQIRDISMKAFK 838
            +V   Y  + R L +L + G   ID +  G F +   L+   ++ N+LT I+E +F     L  L L  N I  +    F    NL+ ++++ N +  +++  F   ++L  L +  N ++ IKP  F   R +  + L +N  L       FN+ ++  L L    + Q+  I M  FK
Sbjct:   65 TVTRGYLRNLRQLLELNL-GMNQIDYIASGTFTDMAKLELLDLSGNQLTFISEGMFTGLRNLTTLFLFMNEILDLPASLFWGTPNLKILSINRNNITKLHQHLFRNSLHLEYLFMDDNNLTTIKPNTFKGARALEILSLTNNVALKTVEDDTFNVANLPNLRLMYILNTQLVRIRMSQFK 243          
BLAST of SMED30015272 vs. Ensembl Medaka
Match: igfals (insulin like growth factor binding protein acid labile subunit [Source:NCBI gene;Acc:101172904])

HSP 1 Score: 118.242 bits (295), Expect = 4.841e-28
Identity = 70/221 (31.67%), Postives = 125/221 (56.56%), Query Frame = 2
Query:  311 VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFP 973
            +P + F D  +L +LI+ G   +  L   +F+N + LK+  +T N + +I   +F   + LQ+L LA N I  I   AF   K+LR+++L++N L  ++E TF GL +L+VL L++N ++ I+P  F  L+ +  ++L+HN++  L  R F  +  +  L L  NQ+++  M +F GL ++  ++L  +    L + MF  + +L ++ LD    C+ R P
Sbjct:  179 LPETVFHDLHSLRELILAG-NRLAYLQPQLFQNLVELKELDLTGNHVKVIKANVFVKLTKLQKLYLARNQIVTIVPRAFVGMKSLRWLDLTNNKLTSLHEDTFLGLHSLHVLRLSNNSVTGIRPRTFRDLQYLEELQLSHNKIRVLGERIFDGLGHLEVLELQHNQVQEAQMGSFTGLSHVAVINLSGSCFSSLPDQMFKGLSKLHSLHLDR--GCLTRIP 396          

HSP 2 Score: 100.523 bits (249), Expect = 3.484e-22
Identity = 66/216 (30.56%), Postives = 114/216 (52.78%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED 949
            +R++P + F +  NL  L ++    I R+DE +F    H+    +  N LT++ E +F+   +L+EL LA N +  +    F     L+ ++L+ N +  I    F  L  L  L LA N+I  I P AF  ++ +  ++L +N+L SL   +F  +HS+  L L++N +  I  + F+ L  L+ L L +NK+ +L E +F  +  LE +EL  +
Sbjct:  128 LRALPGTIFQNTPNLASLSLHN-NQISRIDERLFAGLSHMWLLNLGWNSLTVLPETVFHDLHSLRELILAGNRLAYLQPQLFQNLVELKELDLTGNHVKVIKANVFVKLTKLQKLYLARNQIVTIVPRAFVGMKSLRWLDLTNNKLTSLHEDTFLGLHSLHVLRLSNNSVTGIRPRTFRDLQYLEELQLSHNKIRVLGERIFDGLGHLEVLELQHN 342          

HSP 3 Score: 93.5893 bits (231), Expect = 7.004e-20
Identity = 75/251 (29.88%), Postives = 117/251 (46.61%), Query Frame = 2
Query:  257 CSTSNITAIMINPGNIRS--------------VPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIR 967
            CS  N+T I   PG++ S              +PA+ F    NL+ L +   G +  LD   F+    L    +  N+L  +   +F +   L  LSL NN I  I E  F    ++  +NL  N L  + E  F  L +L  LILA NR+++++P  F +L ++  ++L  N +  +    F  +  + +L L  NQI  I  +AF G+ +L++L L NNKL  L E  F  +  L  + L  +    IR
Sbjct:   54 CSARNLTHI---PGDMPSSTHSLWLDMNLFTSLPAASFRGLINLDFLNLQS-GQLITLDPQAFKGLRSLAHVHLERNRLRALPGTIFQNTPNLASLSLHNNQISRIDERLFAGLSHMWLLNLGWNSLTVLPETVFHDLHSLRELILAGNRLAYLQPQLFQNLVELKELDLTGNHVKVIKANVFVKLTKLQKLYLARNQIVTIVPRAFVGMKSLRWLDLTNNKLTSLHEDTFLGLHSLHVLRLSNNSVTGIR 300          

HSP 4 Score: 74.7146 bits (182), Expect = 7.174e-14
Identity = 73/262 (27.86%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  299 NIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRI------------------------SFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLR 1012
            +++ + A+ FV    L+KL +    I+  +    F     L+   +T+NKLT + E  F    +L  L L+NN++  I    F   + L  + LSHN +  + E+ F+GL +L VL L HN++                        S +    F  L K+HS+ L+   L  +  ++F  +  + RL L  N I  +  ++F  L  L  L L  NKL +L    FS +K LE + L  + +C   FP    +E ++ +LR
Sbjct:  223 HVKVIKANVFVKLTKLQKLYLARNQIVTIVPRA-FVGMKSLRWLDLTNNKLTSLHEDTFLGLHSLHVLRLSNNSVTGIRPRTFRDLQYLEELQLSHNKIRVLGERIFDGLGHLEVLELQHNQVQEAQMGSFTGLSHVAVINLSGSCFSSLPDQMFKGLSKLHSLHLDRGCLTRIPAQAFVGLSGLRRLFLQHNNISVVEYRSFADLVGLLGLDLSFNKLEVLSPHTFSGLKNLEYLLLVNN-DCRQFFPNG--TEQLLPKLR 480          
BLAST of SMED30015272 vs. Ensembl Medaka
Match: lrig3 (leucine rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:101155735])

HSP 1 Score: 110.538 bits (275), Expect = 3.371e-25
Identity = 73/239 (30.54%), Postives = 131/239 (54.81%), Query Frame = 2
Query:  302 IRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIR----SFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED---INCIIRFPKIQLSENV 997
            IR V    F+  ++L  L +   G++ RL +G F    +++  ++ +N LT++T++      TLQ+L L +N I  I   A+  C+ L  ++LS N L  + E +F GL  L  L + +N ISFI   AF  L  + +++L +N++ S  I      F  +H++ RL L+ N+IR ++ K+F GLD LQ+L L  N +M ++   F+ +K L+ + L+      +C +++  + ++E  
Sbjct:  184 IRHVEGLTFLGLQSLRFLKMQRNGVV-RLMDGAFWGLENVEVLQLDNNNLTVVTKRWLYGLLTLQQLHLGHNAIGAIEPEAWDFCQKLSQLDLSSNHLTRLEESSFVGLSLLDELHIGNNSISFIADGAFRGLPSLKTLDLKNNEI-SWTIEDMNGPFSALHNLKRLFLHGNRIRSVTAKSFSGLDALQHLDLSRNAIMAIQVDAFAPLKNLQELRLNTSSLLCDCHLKWLPVWVTEQT 420          

HSP 2 Score: 83.1889 bits (204), Expect = 2.334e-16
Identity = 91/341 (26.69%), Postives = 151/341 (44.28%), Query Frame = 2
Query:   32 LFHLVFIKSIFHFIEFIEMTTRNICPNHCQCDG-VVKCSVVQS-HQSVFCPVNWEITSIIVSITMPYKSDWDNLFL-NCSTSNITAIMINP-----------GNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRN-RIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLIL------------------------AHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESM---FSEMKRLE 928
            LF LV +      +E    ++   CP  CQC G +V CS ++   ++ F  +N      +  +  P+ S    L L N   + I+   + P            NI  + A  F     L  + +N    I  ++ G F N    L+  ++  N+L+ IT K+F    +LQ L L+ N I+ +  L F   ++LRF+ +  N ++ + +  F GL N+ VL L                         HN I  I+P A+   +K+  ++L+ N L  L+  SF  +  +  L + +N I  I+  AF+GL +L+ L LKNN++    E M   FS +  L+
Sbjct:   16 LFLLVLV------LERGSGSSSRTCPPPCQCFGELVDCSRLEKVTKTTFTKLNHNDLKEMPDLG-PFASRITTLILANNKIARISQEQLGPFLSLETLDLSYNNIVEMKAGSFPALP-LRNMFLNN-NRISSMETGCFANLSSTLQVLRLNRNRLSAITPKIFQ-LPSLQHLDLSRNRIRHVEGLTFLGLQSLRFLKMQRNGVVRLMDGAFWGLENVEVLQLDNNNLTVVTKRWLYGLLTLQQLHLGHNAIGAIEPEAWDFCQKLSQLDLSSNHLTRLEESSFVGLSLLDELHIGNNSISFIADGAFRGLPSLKTLDLKNNEISWTIEDMNGPFSALHNLK 346          
BLAST of SMED30015272 vs. Ensembl Medaka
Match: lrig1 (leucine rich repeats and immunoglobulin like domains 1 [Source:NCBI gene;Acc:101171324])

HSP 1 Score: 96.6709 bits (239), Expect = 1.173e-20
Identity = 66/227 (29.07%), Postives = 118/227 (51.98%), Query Frame = 2
Query:  272 ITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQL---LSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            +T + +N   IR +    F    +LE L +     I +L +G F +   +K   +  N LT +        ++L +L L+NN+I  I       C+ LR +NLS+N L  + E +   L +L+ L L HN IS I   AF  L+ +  +EL+HN +   +     +F  +  + +L L  N+I+ ++ +AF GL++L++L+L  N +  ++   FS+M+ L+ + +D
Sbjct:  159 LTQLELNRNRIRQIEGLTFQGLSSLEVLKLQR-NSISKLTDGAFWDLAKMKVLHLEYNNLTEVNSGSLYGLTSLTQLFLSNNSIARINPDGLKFCQRLRELNLSYNNLTRLDEGSLAMLGDLHTLRLGHNSISQINEGAFRGLKAVRILELDHNDISGTIEDTNGAFSGLDRLNKLTLFGNKIKSVAKEAFSGLESLEHLNLGENPIRSIQPDAFSKMRNLKNLIMD 384          

HSP 2 Score: 49.2914 bits (116), Expect = 8.544e-6
Identity = 38/135 (28.15%), Postives = 56/135 (41.48%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKT---------------------------FEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLL 742
            L++  ++ N LT + E        L  L L +N+I  I E AF   K +R + L HN + G  E T                           F GL +L  L L  N I  I+P AFS +R + ++ ++ N  L
Sbjct:  255 LRELNLSYNNLTRLDEGSLAMLGDLHTLRLGHNSISQINEGAFRGLKAVRILELDHNDISGTIEDTNGAFSGLDRLNKLTLFGNKIKSVAKEAFSGLESLEHLNLGENPIRSIQPDAFSKMRNLKNLIMDSNSFL 389          
BLAST of SMED30015272 vs. Ensembl Medaka
Match: lrig1 (leucine rich repeats and immunoglobulin like domains 1 [Source:NCBI gene;Acc:101171324])

HSP 1 Score: 95.9005 bits (237), Expect = 1.846e-20
Identity = 66/227 (29.07%), Postives = 118/227 (51.98%), Query Frame = 2
Query:  272 ITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQL---LSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            +T + +N   IR +    F    +LE L +     I +L +G F +   +K   +  N LT +        ++L +L L+NN+I  I       C+ LR +NLS+N L  + E +   L +L+ L L HN IS I   AF  L+ +  +EL+HN +   +     +F  +  + +L L  N+I+ ++ +AF GL++L++L+L  N +  ++   FS+M+ L+ + +D
Sbjct:  208 LTQLELNRNRIRQIEGLTFQGLSSLEVLKLQR-NSISKLTDGAFWDLAKMKVLHLEYNNLTEVNSGSLYGLTSLTQLFLSNNSIARINPDGLKFCQRLRELNLSYNNLTRLDEGSLAMLGDLHTLRLGHNSISQINEGAFRGLKAVRILELDHNDISGTIEDTNGAFSGLDRLNKLTLFGNKIKSVAKEAFSGLESLEHLNLGENPIRSIQPDAFSKMRNLKNLIMD 433          

HSP 2 Score: 51.9878 bits (123), Expect = 1.263e-6
Identity = 38/109 (34.86%), Postives = 59/109 (54.13%), Query Frame = 2
Query:  572 INLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFA-FSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLE 895
            +NL HN L  I  + F  L NL  L L HN ++ I     F+S  +I S+ L+HN + S+D R    + S+  L L++N+I ++    F     ++ L L NNK+ +LE
Sbjct:   68 LNLGHNKLTSINPEAFASLPNLRELHLDHNELTSIPDLGHFAS--RIVSLYLHHNNIRSIDGRRIRELVSVETLDLSNNEITELRGHCFPAGLQIRDLYLSNNKISVLE 174          

HSP 3 Score: 50.0618 bits (118), Expect = 5.892e-6
Identity = 44/195 (22.56%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  500 LSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYE------------------KTFEG-----LVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSF------------------------FNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELD 943
            L+L +N +  I   AF +  NLR ++L HN L  I +                  ++ +G     LV++  L L++N I+ ++   F +  +I  + L++N++  L++ +                         F +  + +L LN N+IR I    F+GL +L+ L L+ N +  L +  F ++ +++ + L+
Sbjct:   68 LNLGHNKLTSINPEAFASLPNLRELHLDHNELTSIPDLGHFASRIVSLYLHHNNIRSIDGRRIRELVSVETLDLSNNEITELRGHCFPAGLQIRDLYLSNNKISVLELGALDRLGSSLQVLRLSRNRISQIPIRAFQLPRLTQLELNRNRIRQIEGLTFQGLSSLEVLKLQRNSISKLTDGAFWDLAKMKVLHLE 262          

HSP 4 Score: 49.2914 bits (116), Expect = 9.955e-6
Identity = 38/135 (28.15%), Postives = 56/135 (41.48%), Query Frame = 2
Query:  419 LKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKT---------------------------FEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLL 742
            L++  ++ N LT + E        L  L L +N+I  I E AF   K +R + L HN + G  E T                           F GL +L  L L  N I  I+P AFS +R + ++ ++ N  L
Sbjct:  304 LRELNLSYNNLTRLDEGSLAMLGDLHTLRLGHNSISQINEGAFRGLKAVRILELDHNDISGTIEDTNGAFSGLDRLNKLTLFGNKIKSVAKEAFSGLESLEHLNLGENPIRSIQPDAFSKMRNLKNLIMDSNSFL 438          
BLAST of SMED30015272 vs. Ensembl Medaka
Match: ENSORLT00000007114.2 (pep primary_assembly:ASM223467v1:4:8789867:8791579:1 gene:ENSORLG00000005657.2 transcript:ENSORLT00000007114.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 2.304e-20
Identity = 81/275 (29.45%), Postives = 136/275 (49.45%), Query Frame = 2
Query:  104 CPNHCQCDGVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYKSDWDNL----FLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEM 916
            CP+ CQC   V      +H S F P     ++ ++ I    KS +D+L    F N +T+  + +MI   ++R V    F    NL +++I+   + D L E +F++   L    +T NKL ++  + F+  + L +L L+ N IK +  +AFH   NL+ ++LS N +  +   TF+GL  L +L L  N +  ++   F  L  +  + L  N+LL L    F    ++ +L L++NQ+  +S   F  L  L  +SL  N+L  L   +F  M
Sbjct:   23 CPDGCQC---VANQAHCTHLSDF-PKTLNASTSLLEI---LKSTFDSLKPEDFTNFTTA-FSKLMIKATSLREVHPGTFDSTPNLVQMVISSTELQD-LPETLFQHLQKLDVLILTENKLIVVRPQWFSQLADLTQLDLSRNFIKSVPVIAFHPLTNLQKLSLSVNNITSLSHDTFKGLSQLQILRLNKNMLRELETGIFDDLVDLKELSLQDNKLLHLHRDLFSKTLTLQKLFLSNNQLTSLSQGIFLNLPLLSQISLHKNQLRSLGPGVFGPM 288          
BLAST of SMED30015272 vs. Planmine SMEST
Match: SMESG000045574.1 (SMESG000045574.1)

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 457/461 (99.13%), Postives = 459/461 (99.57%), Query Frame = 2
Query:   86 MTTRNICPNHCQCDGVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYKSDWDNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKTPSTTISAKFHLNSSRTSEELKKYSWEKNIDELSSSLIKIQNPISNKCFNCTNSLSCVYTHIWISFLAGIMTLGCLVLIVGFFVYVLITRRIIQNLRLYKINQDALSMVTTHTRESNNFPPCKSDYKSINGNLDCEVCV 1468
            MTTRNICPNHCQCDGVVKCSVVQSHQS+FCPVNWEITSIIVSITMPYKSDW+NLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANN IKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYK ENDLKTPSTTISAKFHLNSSRTSEELKKYSWEKNIDELSSSLIKIQNPISNKCFNCTNSLSCVYTHIWISFLAGIMTLGCLVLIVGFFVYVLITRRIIQNLRLYKINQDALSMVTTHTRESNNFPPCKSDYKSINGNLDCEVCV
Sbjct:    1 MTTRNICPNHCQCDGVVKCSVVQSHQSIFCPVNWEITSIIVSITMPYKSDWNNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNMIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKEENDLKTPSTTISAKFHLNSSRTSEELKKYSWEKNIDELSSSLIKIQNPISNKCFNCTNSLSCVYTHIWISFLAGIMTLGCLVLIVGFFVYVLITRRIIQNLRLYKINQDALSMVTTHTRESNNFPPCKSDYKSINGNLDCEVCV 461          
BLAST of SMED30015272 vs. Planmine SMEST
Match: SMESG000052792.1 (SMESG000052792.1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.124e-18
Identity = 71/269 (26.39%), Postives = 126/269 (46.84%), Query Frame = 2
Query:  104 CPNHCQCD--------GVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYKSDWDNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLM 886
            C   C+C          V  C+V +    V C V W I  + V   + + +D   L   C   +   I      I  +P  + +  R LE L++  P  I  ++    +N + LK   ++  ++  ++  +F+ C   + + L++N I VI +  F +C  +  ++L +N L  I    F    +L  L L+ NRI+ I+ F+F +L+K+  + LN N L+ +     F + S+  L L+ N I  I   AF  L +L+Y++L+ N L+
Sbjct:   32 CQKKCRCKHKEKSSKIEVAHCTVDEKDTFVSCNVEWPILLMTVK-KLRFNAD---LLAACQRISGLLITTESSLIVLMPQMFKLVSR-LETLVVQAP--IQTIENQFLKNFVSLKILHISETRIEHLSRGMFSDCPITERIRLSSNRISVIADKTFDSCNRVVNLDLGNNRLTVIRRLIFNEGHSLQNLDLSRNRITRIEDFSFKNLKKMKVLNLNANLLMRIKPEILFGLESLQYLFLSKNSIETIEEDAFVNLKSLKYINLEKNPLL 293          
BLAST of SMED30015272 vs. Planmine SMEST
Match: SMESG000017864.1 (SMESG000017864.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.449e-8
Identity = 34/125 (27.20%), Postives = 71/125 (56.80%), Query Frame = 2
Query:  563 LRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGL-DNLQYLSLKNNKLMLLEESMFSEMKRLETV 934
            L ++N+S N +L +Y   F+GL NL  LIL+ N I  +  +AF  L+++  +++  N + +++  +F N+ S+  + L   ++ +I+   F G+ +NL  +++ NN +  + +  F  +  L T+
Sbjct: 1421 LGYLNISDNSILELYNGLFDGLFNLRYLILSKNYIRILPSYAFQFLKQLQILDITDNPITTIESFAFHNLISITHIELPSMKLYEINDYTFLGMSENLISINMSNNDIRSISQDSFVGVNNLSTL 1545          

HSP 2 Score: 57.3806 bits (137), Expect = 2.153e-8
Identity = 42/142 (29.58%), Postives = 78/142 (54.93%), Query Frame = 2
Query:  458 ITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNI-HSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNK 880
            ++  +F+    L  L++++N+I  ++   F    NLR++ LS N +  +    F+ L  L +L +  N I+ I+ FAF +L  I  IEL   +L  ++  +F  +  ++I + +++N IR IS  +F G++NL  L +  NK
Sbjct: 1410 LSSGIFSQFIYLGYLNISDNSILELYNGLFDGLFNLRYLILSKNYIRILPSYAFQFLKQLQILDITDNPITTIESFAFHNLISITHIELPSMKLYEINDYTFLGMSENLISINMSNNDIRSISQDSFVGVNNLSTLVINVNK 1551          
BLAST of SMED30015272 vs. Planmine SMEST
Match: SMESG000068721.1 (SMESG000068721.1)

HSP 1 Score: 57.3806 bits (137), Expect = 2.429e-8
Identity = 44/130 (33.85%), Postives = 75/130 (57.69%), Query Frame = 2
Query:  572 INLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLETVELDED-INC 958
            +NL  N +  I +  F  L NL VL L++NRI+ I+P AF +L  +  + LN N +  L    F  +  + +L L DNQ++ I+   F  L  L+YL L+ NK+  + E++ S++K L+ + + ++ +NC
Sbjct:   71 LNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWISEAI-SKLKHLKELRIHKNKLNC 199          

HSP 2 Score: 55.4546 bits (132), Expect = 9.615e-8
Identity = 45/128 (35.16%), Postives = 66/128 (51.56%), Query Frame = 2
Query:  500 LSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKL 883
            L+L  N I VI +  F    NL+ + LS+N +  I    F+ LVNL  L L  N I ++    FS L K+  ++L  NQL  ++   F  +  +  LLL  N+I  IS +A   L +L+ L +  NKL
Sbjct:   71 LNLLGNRINVIRKSDFLKLNNLKVLQLSNNRITSIEPGAFDNLVNLIKLRLNRNLIQYLPDDLFSKLTKLQKLDLRDNQLQCINDNIFNKLGMLKYLLLEGNKIFWIS-EAISKLKHLKELRIHKNKL 197          

HSP 3 Score: 53.1434 bits (126), Expect = 4.513e-7
Identity = 46/202 (22.77%), Postives = 86/202 (42.57%), Query Frame = 2
Query:   71 IEFIEMTTRNICPNHCQC--DGVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYKSDWDNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFNSCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRIS 670
            +E +  + + +C   C C  DG+VKC            V   +++I   +                 +N+  + +   NI  +   Y   ++ L+K+I+   G++D ++ G F     L    +  N L  I +  F    +L  L L  N I+ + +    + K L  ++LS N L  + ++TF+  +NL  L L HN ++
Sbjct:  255 LENMCPSDKKVCSKKCNCSHDGIVKC------------VGKRLSNIPQDLP----------------TNVVELDLKDNNITILQQGYLSKYKFLKKIILTRNGMVD-IEPGAFLGLTQLTSIYLNENNLKTIRKNAFGGLVSLMFLYLQYNDIECLPKDTLESSKRLHLLHLSENKLTSLKKETFKPFLNLRYLYLVHNPLN 427          
BLAST of SMED30015272 vs. Planmine SMEST
Match: SMESG000010158.1 (SMESG000010158.1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.557e-7
Identity = 65/262 (24.81%), Postives = 119/262 (45.42%), Query Frame = 2
Query:   98 NICPNHCQCDGVVKCSVVQSHQSVFCPVNWEITSIIVSITMPYKSDW----DNLFLNCSTSNITAIMINPGNIRSVPASYFVDFRNLEKLIINGPGIID---------RLDEGIFRNRIHLKKFKMTSNK-LTIITEKLFNSCSTLQELSLANNTIKVI---FELAFHTCKNLRFINLSHNLLLGIYEKTFEGLVNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHSMIRLLLNDNQIRDISMKA 832
            N+CP +C C       V++S  S+ C + W   S+ ++       DW    D  F  C + +  +I    G  +S+  +         KL I  P I D          +D+  FRN   +K   +TSN+ L+ ++    +    +  L ++ N +  +   F++  +    LR + L++N +  I   TF+ L  L +L LAHN+I  ++ F F  L  + S+ L++N L  L+      + S+ R+ L +N+I   ++ +
Sbjct:   19 NLCPINCNCFNNEGDCVIESKSSL-CLLKWGRLSVEIN-------DWNLIDDLTFSMCRSLHFLSIT---GRFQSIDGT---------KLKIPSPNITDFHIKNTKLQAIDDYSFRNFPFVKNLIITSNENLSKLSMNFLHGLEQMYLLDMSFNGLTDVSKSFQVFLY---ELRILKLNYNKISTIKMDTFKYLRQLKILELAHNQIVIVENFGFRGLSNVISLRLDNNLLFELNHLELLEMLSLERIDLRNNRIETFTLPS 257          
The following BLAST results are available for this feature:
BLAST of SMED30015272 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC701.125e-2330.53leucine rich repeat containing 70 [Source:HGNC Sym... [more]
IGFALS1.647e-2231.51insulin like growth factor binding protein acid la... [more]
LRIG31.740e-2230.45leucine rich repeats and immunoglobulin like domai... [more]
LRIG31.862e-2230.20leucine rich repeats and immunoglobulin like domai... [more]
LRIG31.947e-2230.20leucine rich repeats and immunoglobulin like domai... [more]
back to top
BLAST of SMED30015272 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lron-156.769e-1526.72ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
egg-69.612e-1326.64Leucine-rich repeat-containing protein egg-6 [Sou... [more]
tol-12.214e-1225.81TOLl (Drosophila) family [Source:UniProtKB/TrEMBL... [more]
sma-107.545e-1227.14Leucine-rich repeats and immunoglobulin-like domai... [more]
sma-107.545e-1227.14Leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of SMED30015272 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atk6.623e-2032.21gene:FBgn0036995 transcript:FBtr0331569[more]
atk6.623e-2032.21gene:FBgn0036995 transcript:FBtr0331570[more]
atk6.623e-2032.21gene:FBgn0036995 transcript:FBtr0078223[more]
Toll-61.301e-1727.94gene:FBgn0036494 transcript:FBtr0075614[more]
Toll-61.301e-1727.94gene:FBgn0036494 transcript:FBtr0306307[more]
back to top
BLAST of SMED30015272 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igfals2.624e-2330.81insulin-like growth factor binding protein, acid l... [more]
igfals2.624e-2330.81insulin-like growth factor binding protein, acid l... [more]
lrig31.358e-2227.38leucine-rich repeats and immunoglobulin-like domai... [more]
si:dkey-182i3.112.061e-2227.59si:dkey-182i3.11 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
lrig15.141e-2131.44leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of SMED30015272 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IGFALS1.080e-2030.43insulin like growth factor binding protein acid la... [more]
LRIG31.998e-2027.51leucine-rich repeats and immunoglobulin like domai... [more]
LRIG29.687e-1830.23leucine-rich repeats and immunoglobulin like domai... [more]
LRIG21.059e-1730.23leucine-rich repeats and immunoglobulin like domai... [more]
LRIG21.294e-1730.23leucine-rich repeats and immunoglobulin like domai... [more]
back to top
BLAST of SMED30015272 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Igfals1.554e-2732.42insulin-like growth factor binding protein, acid l... [more]
Lrig39.695e-2225.45leucine-rich repeats and immunoglobulin-like domai... [more]
Chadl5.948e-2027.98chondroadherin-like [Source:MGI Symbol;Acc:MGI:303... [more]
Lrig22.431e-1930.37leucine-rich repeats and immunoglobulin-like domai... [more]
Lrig22.688e-1930.37leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of SMED30015272 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35859|ALS_RAT1.039e-2733.18Insulin-like growth factor-binding protein complex... [more]
sp|P70389|ALS_MOUSE1.087e-2632.42Insulin-like growth factor-binding protein complex... [more]
sp|Q7Z2Q7|LRR70_HUMAN5.401e-2330.53Leucine-rich repeat-containing protein 70 OS=Homo ... [more]
sp|O02833|ALS_PAPHA3.355e-2231.51Insulin-like growth factor-binding protein complex... [more]
sp|Q6UXM1|LRIG3_HUMAN8.941e-2230.20Leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of SMED30015272 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Y9KGX67.529e-2833.64insulin-like growth factor-binding protein complex... [more]
M3YVX41.138e-2633.33Insulin like growth factor binding protein acid la... [more]
U3JPT14.204e-2635.16Insulin like growth factor binding protein acid la... [more]
A0A3B3B4J46.349e-2631.67Insulin-like growth factor binding protein, acid l... [more]
A0A3Q7VCR09.482e-2633.33insulin-like growth factor-binding protein complex... [more]
back to top
BLAST of SMED30015272 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrig37.541e-2431.74leucine rich repeats and immunoglobulin like domai... [more]
igfals3.530e-2329.22insulin like growth factor binding protein acid la... [more]
lrig11.601e-1931.79leucine rich repeats and immunoglobulin like domai... [more]
lrrtm4l12.004e-1826.65leucine-rich repeat transmembrane neuronal protein... [more]
LRRTM41.146e-1725.52leucine rich repeat transmembrane neuronal 4 [Sour... [more]
back to top
BLAST of SMED30015272 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrig38.759e-2432.89leucine-rich repeats and immunoglobulin-like domai... [more]
LRRTM41.781e-2226.53leucine rich repeat transmembrane neuronal 4 [Sour... [more]
flrt32.997e-2033.01fibronectin leucine rich transmembrane 3 [Source:Z... [more]
lrig33.945e-1931.25leucine-rich repeats and immunoglobulin-like domai... [more]
ENSPMAT00000010345.13.699e-1831.79pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1... [more]
back to top
BLAST of SMED30015272 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015272 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481797.148e-1732.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354071.042e-1328.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471092.913e-1229.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316697.076e-1128.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491368.280e-1024.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30015272 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igfals4.841e-2831.67insulin like growth factor binding protein acid la... [more]
lrig33.371e-2530.54leucine rich repeats and immunoglobulin like domai... [more]
lrig11.173e-2029.07leucine rich repeats and immunoglobulin like domai... [more]
lrig11.846e-2029.07leucine rich repeats and immunoglobulin like domai... [more]
ENSORLT00000007114.22.304e-2029.45pep primary_assembly:ASM223467v1:4:8789867:8791579... [more]
back to top
BLAST of SMED30015272 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045574.10.000e+099.13SMESG000045574.1[more]
SMESG000052792.13.124e-1826.39SMESG000052792.1[more]
SMESG000017864.11.449e-827.20SMESG000017864.1[more]
SMESG000068721.12.429e-833.85SMESG000068721.1[more]
SMESG000010158.11.557e-724.81SMESG000010158.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015272 ID=SMED30015272|Name=SMED30015272|organism=Schmidtea mediterranea sexual|type=transcript|length=1510bp
GAAATTTTAATAGAATGAAAGGAGAAAAATGTTATTTCATTTGGTTTTCA
TAAAATCCATTTTTCATTTTATTGAATTCATTGAAATGACAACCCGAAAT
ATTTGTCCTAATCATTGCCAGTGTGACGGAGTAGTTAAGTGTTCCGTTGT
CCAGTCTCATCAATCGGTCTTTTGTCCTGTGAATTGGGAAATCACATCAA
TCATTGTAAGTATCACGATGCCCTATAAGTCGGATTGGGATAATTTATTT
CTAAACTGCTCGACATCGAATATCACGGCTATTATGATAAATCCTGGAAA
TATTCGGTCGGTTCCTGCTTCATATTTTGTAGACTTTCGAAATTTAGAAA
AACTTATCATCAACGGACCCGGGATAATAGATCGGTTAGATGAAGGAATA
TTCCGAAATAGAATTCACTTGAAAAAATTCAAAATGACAAGTAATAAATT
AACAATCATTACGGAAAAGTTATTCAATTCTTGCTCGACTCTTCAAGAAC
TCTCCCTCGCCAATAATACGATCAAAGTTATTTTTGAATTAGCTTTTCAT
ACATGTAAAAATCTTCGATTCATAAACCTTTCGCACAATCTCTTATTAGG
GATCTATGAAAAGACTTTCGAAGGTTTAGTCAATTTATATGTGTTGATAT
TAGCTCATAATCGTATCTCATTCATCAAACCTTTCGCTTTCAGTAGTTTA
CGGAAAATCCACTCTATCGAATTGAATCACAATCAACTGTTGAGTCTCGA
CATTCGCTCTTTTTTCAATATTCATAGCATGATCAGGTTGCTTTTAAATG
ACAATCAAATCCGTGACATCAGTATGAAGGCCTTCAAGGGTTTGGATAAT
CTACAATATTTGAGCTTAAAAAACAACAAATTGATGTTACTCGAAGAGTC
AATGTTTTCAGAAATGAAAAGACTGGAAACCGTTGAACTCGACGAAGACA
TCAATTGCATTATTCGGTTTCCGAAAATTCAACTATCAGAAAATGTCGTT
TCACGTTTACGGAAATTTCGATCATGTTACAAAGGGGAGAATGATCTCAA
AACACCGTCAACAACGATTTCAGCTAAATTTCATTTGAATTCATCAAGGA
CGTCAGAGGAATTGAAAAAATATTCTTGGGAAAAAAACATTGATGAGCTC
AGTTCTTCATTAATAAAAATTCAAAATCCTATTTCGAATAAATGTTTCAA
TTGTACCAATTCTTTATCGTGCGTTTACACGCATATTTGGATAAGTTTTC
TTGCGGGAATTATGACTCTGGGCTGTTTGGTTTTAATTGTTGGGTTTTTT
GTTTACGTTTTAATAACGAGACGAATTATTCAGAATTTGCGCCTATATAA
AATAAATCAAGACGCCCTTTCAATGGTGACGACCCATACAAGAGAATCGA
ACAATTTCCCACCGTGTAAAAGTGACTATAAGTCTATTAATGGGAATCTA
GATTGTGAAGTTTGTGTTTAGTTCGTTGTTATACAAGTTTACCAGTCATG
TTATTGTACG
back to top

protein sequence of SMED30015272-orf-1

>SMED30015272-orf-1 ID=SMED30015272-orf-1|Name=SMED30015272-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=481bp
MLFHLVFIKSIFHFIEFIEMTTRNICPNHCQCDGVVKCSVVQSHQSVFCP
VNWEITSIIVSITMPYKSDWDNLFLNCSTSNITAIMINPGNIRSVPASYF
VDFRNLEKLIINGPGIIDRLDEGIFRNRIHLKKFKMTSNKLTIITEKLFN
SCSTLQELSLANNTIKVIFELAFHTCKNLRFINLSHNLLLGIYEKTFEGL
VNLYVLILAHNRISFIKPFAFSSLRKIHSIELNHNQLLSLDIRSFFNIHS
MIRLLLNDNQIRDISMKAFKGLDNLQYLSLKNNKLMLLEESMFSEMKRLE
TVELDEDINCIIRFPKIQLSENVVSRLRKFRSCYKGENDLKTPSTTISAK
FHLNSSRTSEELKKYSWEKNIDELSSSLIKIQNPISNKCFNCTNSLSCVY
THIWISFLAGIMTLGCLVLIVGFFVYVLITRRIIQNLRLYKINQDALSMV
TTHTRESNNFPPCKSDYKSINGNLDCEVCV*
back to top
Aliases
The feature 'SMED30015272' has the following synonyms
Synonym
Smed_12518
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR031283AMIGO
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005520insulin-like growth factor binding
GO:0008022protein C-terminus binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0042567insulin-like growth factor ternary complex
GO:0043231intracellular membrane-bounded organelle
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007165signal transduction
GO:0007568aging
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 224..247
e-value: 88.0
score: 5.5
coord: 272..295
e-value: 2.9
score: 16.9
coord: 176..199
e-value: 180.0
score: 3.1
coord: 248..271
e-value: 65.0
score: 6.6
coord: 200..223
e-value: 0.23
score: 20.5
coord: 103..127
e-value: 310.0
score: 1.0
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 168..416
e-value: 2.5E-27
score: 97.3
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 253..305
e-value: 1.7E-10
score: 40.5
coord: 154..213
e-value: 7.1E-12
score: 44.9
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 178..199
score: 6.172
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 226..247
score: 4.893
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 274..295
score: 6.503
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 250..271
score: 5.232
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 202..223
score: 7.188
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 154..175
score: 7.427
IPR031283Amphoterin-induced proteinPANTHERPTHR24368AMPHOTERIN-INDUCED PROTEINcoord: 178..285
coord: 73..222
coord: 221..389
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.508
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 70..306
NoneNo IPR availableTMHMMTMhelixcoord: 407..429