adhesion G protein-coupled receptor L2-like

Overview
Nameadhesion G protein-coupled receptor L2-like
Smed IDSMED30015266
Length (bp)3625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of adhesion G protein-coupled receptor L2-like (SMED30015266) t-SNE clustered cells

Violin plots show distribution of expression levels for adhesion G protein-coupled receptor L2-like (SMED30015266) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of adhesion G protein-coupled receptor L2-like (SMED30015266) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for adhesion G protein-coupled receptor L2-like (SMED30015266) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015266

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015266SMESG000058907.1 SmedASXL_017090SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30015266SMESG000058907.1 dd_Smed_v4_12277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015266SMESG000058907.1 dd_Smed_v4_16446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30015266SMESG000058907.1 dd_Smed_v4_16446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30015266SMESG000058907.1 dd_Smed_v6_12277_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30015266SMESG000058907.1 dd_Smed_v6_16446_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30015266SMESG000058907.1 OX_Smed_1.0.12537ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30015266SMESG000058907.1 dd_Smed_v4_16446_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Human
Match: CELSR1 (cadherin EGF LAG seven-pass G-type receptor 1 [Source:HGNC Symbol;Acc:HGNC:1850])

HSP 1 Score: 119.013 bits (297), Expect = 3.973e-26
Identity = 66/219 (30.14%), Postives = 126/219 (57.53%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAK-----EHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            SIHKH ++A+   Q+ ++ GI++ E+  +C + ++LLHY ++S F W + E+ ++Y ++T       +   G M  +YV+GW +PAI+     G++ + Y + + CW++ +D  +W F GP  AVI+++ +  + +AK     +HH   Y K     K I++  +  +  ++L+S +W    + V    +   YL+ +F+ LQG F ++F+ +LN EV+
Sbjct: 2502 SIHKHLAVALFLSQLVFVIGINQTENPFLCTVVAILLHYIYMSTFAWTLVESLHVYRMLTEVR----NIDTGPMRFYYVVGWGIPAIVTGLAVGLDPQGYGNPDFCWLSLQDTLIWSFAGPIGAVIIINTVTSVLSAKVSCQRKHH--YYGK-----KGIVSLLRTAFLLLLLISATWLLGLLAVNRDALSFHYLFAIFSGLQGPFVLLFHCVLNQEVR 2709          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Human
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:HGNC Symbol;Acc:HGNC:20974])

HSP 1 Score: 116.701 bits (291), Expect = 1.739e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  911 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1135          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Human
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:HGNC Symbol;Acc:HGNC:20974])

HSP 1 Score: 116.316 bits (290), Expect = 1.837e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  979 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1203          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Human
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:HGNC Symbol;Acc:HGNC:20974])

HSP 1 Score: 116.316 bits (290), Expect = 1.844e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  911 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1135          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Human
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:HGNC Symbol;Acc:HGNC:20974])

HSP 1 Score: 116.316 bits (290), Expect = 1.847e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  979 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1203          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Celegans
Match: lat-2 (Latrophilin-like protein LAT-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECX0])

HSP 1 Score: 101.293 bits (251), Expect = 3.324e-21
Identity = 83/357 (23.25%), Postives = 170/357 (47.62%), Query Frame = 1
Query: 2089 INSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWIN-DCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRT-SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWIN--HKDVWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKY--LYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            INS +I  ++    + +     + +   F +     +SN  C  V  D  E        S+W    C +     +S  C C  L  F +  D+  ++ +        L + S  GC++S +  ++S+ +  + R   ++ +SIH++  + ++  ++ ++ G+D+  +   C + ++LLHYFFLS F W++ E + LY+++      +       ++ +Y+  +  PA++VA  +GI  E+Y + + CWI+     +W F    I VI+ + ++ +  A +   S  +++      II   K   T + LL ++W F F+  +  G    +  ++ + N  QG F  V + +LN++V+
Sbjct:  800 INSQVIGASIQNATQSVTLPVDHPVTFTFQHLTTKGVSNPRC--VYWDLME--------SKWSTLGCTLIATSSNSSQCSCTHLTSFAILMDISGQVGRLSGGLASALDVVSTIGCAISIVCLALSVCVFTFFRNLQNVRNSIHRNLCLCLLIAELVFVIGMDRTGNRTGCGVVAILLHYFFLSSFCWMLLEGYQLYMMLIQVFEPN----RTRIFLYYLFCYGTPAVVVAISAGIKWEDYGTDSYCWIDTSTPTIWAFVA-PIIVIIAANIIFLLIALKVVLSVQSRDRTKWGRIIGWLKGSATLLCLLGITWIFGFLTAVKGGTGTAFAWIFTILNCTQGIFIFVLHVVLNEKVR 1141          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Celegans
Match: lat-2 (Latrophilin-like protein LAT-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECX0])

HSP 1 Score: 95.5153 bits (236), Expect = 3.414e-20
Identity = 56/219 (25.57%), Postives = 116/219 (52.97%), Query Frame = 1
Query: 2497 ITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWIN--HKDVWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIM--QGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            + +SIH++  + ++  ++ ++ G+D+  +   C + ++LLHYFFLS F W++ E + LY+++      +       ++ +Y+  +  PA++VA  +GI  E+Y + + CWI+     +W F    I VI+ + ++ +  A +   S  +++      II   K   T + LL ++W F F+  +    G    +++ + N  QG F  V + +LN++V+
Sbjct:   49 VRNSIHRNLCLCLLIAELVFVIGMDRTGNRTGCGVVAILLHYFFLSSFCWMLLEGYQLYMMLIQVFEPN----RTRIFLYYLFCYGTPAVVVAISAGIKWEDYGTDSYCWIDTSTPTIWAFVA-PIIVIIAANIIFLLIALKVVLSVQSRDRTKWGRIIGWLKGSATLLCLLGITWIFGFLTAVKGGTGTAFAWIFTILNCTQGIFIFVLHVVLNEKVR 262          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Celegans
Match: lat-1 (Latrophilin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDW2])

HSP 1 Score: 87.8113 bits (216), Expect = 3.166e-17
Identity = 52/220 (23.64%), Postives = 111/220 (50.45%), Query Frame = 1
Query: 2509 IHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXX---XXXXXXXXXXXFTAKEHHESSYTKNEKD---NKAIINQTKAIWTQIILLSLSWSFAFICVI-MQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            IH++  +++   +++++ GI + E  + C I ++ L Y FLS  TW++ E ++++ ++T    S     D   + + ++G+I PAI+       N + + + + CW++ ++  +W F GPA        + ++  + T  +H    Y     D    ++I N  K       LL ++W F    V   + I++ Y++ + NSLQG F  +F+ +  ++++
Sbjct:  586 IHENLCLSLAIAEITFLAGITRTEDSLQCGIIAVALMYMFLSALTWMLLEGYHIHRMLTEVFPS-----DPRRFTYLLVGYIPPAIITLVAYLYNSDGFGTPDHCWLSTQNNFIWFFAGPACFIFCANSLVLVKTLCTVYQHTSGGYLPCRHDVDSGRSIRNWVKGSLALASLLGVTWIFGLFWVEDSRSIVMAYVFTISNSLQGLFIFLFHVVFAEKMR 800          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Celegans
Match: lat-1 (Latrophilin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDW2])

HSP 1 Score: 87.8113 bits (216), Expect = 3.443e-17
Identity = 52/220 (23.64%), Postives = 111/220 (50.45%), Query Frame = 1
Query: 2509 IHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXX---XXXXXXXXXXXFTAKEHHESSYTKNEKD---NKAIINQTKAIWTQIILLSLSWSFAFICVI-MQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            IH++  +++   +++++ GI + E  + C I ++ L Y FLS  TW++ E ++++ ++T    S     D   + + ++G+I PAI+       N + + + + CW++ ++  +W F GPA        + ++  + T  +H    Y     D    ++I N  K       LL ++W F    V   + I++ Y++ + NSLQG F  +F+ +  ++++
Sbjct:  584 IHENLCLSLAIAEITFLAGITRTEDSLQCGIIAVALMYMFLSALTWMLLEGYHIHRMLTEVFPS-----DPRRFTYLLVGYIPPAIITLVAYLYNSDGFGTPDHCWLSTQNNFIWFFAGPACFIFCANSLVLVKTLCTVYQHTSGGYLPCRHDVDSGRSIRNWVKGSLALASLLGVTWIFGLFWVEDSRSIVMAYVFTISNSLQGLFIFLFHVVFAEKMR 798          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 66.6254 bits (161), Expect = 1.607e-10
Identity = 51/190 (26.84%), Postives = 89/190 (46.84%), Query Frame = 1
Query: 2314 VICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITS-SIHKHFSMAIIAGQMSYMFGIDK----YEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGP 2862
            V C C  +  + V  D+ +   +   +P+ L+ + SY    VS  L    LL L  LR     S +IH++  + +   ++ +  G+       E E  CK+ ++ LHYF+L+ F W   +  +LY ++T       D   G M  ++ +G+  PAI+V    G+    Y ++  CW++  +  VW   GP
Sbjct: 2783 VNCSCTHISSYAVIVDVIDP--EDIPEPSLLVQITSYSAFLVSLPLLLGVLLALALLRGQQTNSNTIHQNIVLCVFCAELLFFVGMQSRRQLLESEFPCKLTAICLHYFWLAAFAWTTVDCVHLYRMLT----EMRDINHGPMGFYFAMGYGAPAIVVGLSVGVRAHEYGNSLFCWLSVYEPVVWWLVGP 2966          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 66.6254 bits (161), Expect = 1.607e-10
Identity = 51/190 (26.84%), Postives = 89/190 (46.84%), Query Frame = 1
Query: 2314 VICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITS-SIHKHFSMAIIAGQMSYMFGIDK----YEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGP 2862
            V C C  +  + V  D+ +   +   +P+ L+ + SY    VS  L    LL L  LR     S +IH++  + +   ++ +  G+       E E  CK+ ++ LHYF+L+ F W   +  +LY ++T       D   G M  ++ +G+  PAI+V    G+    Y ++  CW++  +  VW   GP
Sbjct: 2783 VNCSCTHISSYAVIVDVIDP--EDIPEPSLLVQITSYSAFLVSLPLLLGVLLALALLRGQQTNSNTIHQNIVLCVFCAELLFFVGMQSRRQLLESEFPCKLTAICLHYFWLAAFAWTTVDCVHLYRMLT----EMRDINHGPMGFYFAMGYGAPAIVVGLSVGVRAHEYGNSLFCWLSVYEPVVWWLVGP 2966          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 66.6254 bits (161), Expect = 1.607e-10
Identity = 51/190 (26.84%), Postives = 89/190 (46.84%), Query Frame = 1
Query: 2314 VICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITS-SIHKHFSMAIIAGQMSYMFGIDK----YEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGP 2862
            V C C  +  + V  D+ +   +   +P+ L+ + SY    VS  L    LL L  LR     S +IH++  + +   ++ +  G+       E E  CK+ ++ LHYF+L+ F W   +  +LY ++T       D   G M  ++ +G+  PAI+V    G+    Y ++  CW++  +  VW   GP
Sbjct: 2783 VNCSCTHISSYAVIVDVIDP--EDIPEPSLLVQITSYSAFLVSLPLLLGVLLALALLRGQQTNSNTIHQNIVLCVFCAELLFFVGMQSRRQLLESEFPCKLTAICLHYFWLAAFAWTTVDCVHLYRMLT----EMRDINHGPMGFYFAMGYGAPAIVVGLSVGVRAHEYGNSLFCWLSVYEPVVWWLVGP 2966          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 66.6254 bits (161), Expect = 1.607e-10
Identity = 51/190 (26.84%), Postives = 89/190 (46.84%), Query Frame = 1
Query: 2314 VICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITS-SIHKHFSMAIIAGQMSYMFGIDK----YEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGP 2862
            V C C  +  + V  D+ +   +   +P+ L+ + SY    VS  L    LL L  LR     S +IH++  + +   ++ +  G+       E E  CK+ ++ LHYF+L+ F W   +  +LY ++T       D   G M  ++ +G+  PAI+V    G+    Y ++  CW++  +  VW   GP
Sbjct: 2783 VNCSCTHISSYAVIVDVIDP--EDIPEPSLLVQITSYSAFLVSLPLLLGVLLALALLRGQQTNSNTIHQNIVLCVFCAELLFFVGMQSRRQLLESEFPCKLTAICLHYFWLAAFAWTTVDCVHLYRMLT----EMRDINHGPMGFYFAMGYGAPAIVVGLSVGVRAHEYGNSLFCWLSVYEPVVWWLVGP 2966          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 66.6254 bits (161), Expect = 1.607e-10
Identity = 51/190 (26.84%), Postives = 89/190 (46.84%), Query Frame = 1
Query: 2314 VICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITS-SIHKHFSMAIIAGQMSYMFGIDK----YEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGP 2862
            V C C  +  + V  D+ +   +   +P+ L+ + SY    VS  L    LL L  LR     S +IH++  + +   ++ +  G+       E E  CK+ ++ LHYF+L+ F W   +  +LY ++T       D   G M  ++ +G+  PAI+V    G+    Y ++  CW++  +  VW   GP
Sbjct: 2783 VNCSCTHISSYAVIVDVIDP--EDIPEPSLLVQITSYSAFLVSLPLLLGVLLALALLRGQQTNSNTIHQNIVLCVFCAELLFFVGMQSRRQLLESEFPCKLTAICLHYFWLAAFAWTTVDCVHLYRMLT----EMRDINHGPMGFYFAMGYGAPAIVVGLSVGVRAHEYGNSLFCWLSVYEPVVWWLVGP 2966          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Zebrafish
Match: celsr3 (cadherin, EGF LAG seven-pass G-type receptor 3 [Source:ZFIN;Acc:ZDB-GENE-070122-3])

HSP 1 Score: 130.568 bits (327), Expect = 5.898e-30
Identity = 110/415 (26.51%), Postives = 199/415 (47.95%), Query Frame = 1
Query: 1921 TKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWINDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDL--LALPSYFGXXXXXXXXXXXXXXXXXXRT-SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIY 3150
            T +    R  L + + P  IVII +IYR  G     ++  +    R G     +  +NS ++ I+V  +   ++    + + L F   + SN S   C+     +   +I +      + DC++       V C C++LG F V  D      ++++   DL  LA+ +Y   SVS     +++L+L  LR   S T SIH + + A +   ++Y+ GI++ E + +C + ++LLHYFF+S F WL  EA ++Y + T A     +   G M  +Y +GW +PAI+     G++ E Y + + CWI+  D  +W F GP    +V+ +   +F        + T+ E     +I+  ++ +  ++L +  W F  + V    +   YL+ +   +QG   ++ + +LN EVQ  +
Sbjct: 1106 TLEATAARRSLSLQEAPVSIVII-LIYRSLGA----ALPPKYHTDRRGVRLPRHPVLNSPVVSISVYNNQTFVEGFLESPVLLEFRLLETSNRSKPLCV----QWNHSSIVSGGGCWTVRDCSVLYRNTSHVRCQCHRLGTFGVLMDSS----QREQLEGDLETLAIVTYSSLSVSMAALLLTVLVLSCLRGLKSNTRSIHSNMAAATLLSHLTYLLGINQTEQQFLCTVVAILLHYFFMSAFAWLFVEALHIYRMQTEAR----NINYGAMRFYYAIGWGVPAIITGLAVGLDPEGYGNPDFCWISMYDKLMWSFAGP--VSVVILMNGGMFLMVLRMTCNPTQKEIKKLPVISTIRSAFFLLLLSTCVWLFGLMAVNNSVLAFHYLFIILCCIQGLAVLLVFTVLNSEVQEAW 1501          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Zebrafish
Match: celsr3 (cadherin, EGF LAG seven-pass G-type receptor 3 [Source:ZFIN;Acc:ZDB-GENE-070122-3])

HSP 1 Score: 122.865 bits (307), Expect = 2.646e-29
Identity = 96/359 (26.74%), Postives = 177/359 (49.30%), Query Frame = 1
Query: 2089 INSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWINDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDL--LALPSYFGXXXXXXXXXXXXXXXXXXR-TSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIY 3150
            +NS ++ I+V  +   ++    + + L F   + SN S   C+     +   +I +      + DC++       V C C++LG F V  D      ++++   DL  LA+ +Y   SVS     +++L+L  LR   S T SIH + + A +   ++Y+ GI++ E + +C + ++LLHYFF+S F WL  EA ++Y + T A     +   G M  +Y +GW +PAI+     G++ E Y + + CWI+  D  +W F GP    +V+ +   +F        + T+ E     +I+  ++ +  ++L +  W F  + V    +   YL+ +   +QG   ++ + +LN EVQ  +
Sbjct:    8 LNSPVVSISVYNNQTFVEGFLESPVLLEFRLLETSNRSKPLCV----QWNHSSIVSGGGCWTVRDCSVLYRNTSHVRCQCHRLGTFGVLMDSS----QREQLEGDLETLAIVTYSSLSVSMAALLLTVLVLSCLRGLKSNTRSIHSNMAAATLLSHLTYLLGINQTEQQFLCTVVAILLHYFFMSAFAWLFVEALHIYRMQTEAR----NINYGAMRFYYAIGWGVPAIITGLAVGLDPEGYGNPDFCWISMYDKLMWSFAGP--VSVVILMNGGMFLMVLRMTCNPTQKEIKKLPVISTIRSAFFLLLLSTCVWLFGLMAVNNSVLAFHYLFIILCCIQGLAVLLVFTVLNSEVQEAW 352          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Zebrafish
Match: ADGRL3 (adhesion G protein-coupled receptor L3 [Source:HGNC Symbol;Acc:HGNC:20974])

HSP 1 Score: 112.079 bits (279), Expect = 2.537e-24
Identity = 65/222 (29.28%), Postives = 118/222 (53.15%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   +  ++ GI++ +  I C +F+ LLH+FFLS FTW+  E   LYI++     S       H  R  FY+ G+ +PA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     +  HH +    +      I +        + LL L+W+F  + V    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  838 TIHKNLCISLFIAETLFLTGINRADQPIACAVFAALLHFFFLSAFTWMFLEGVQLYILLVEVFESE------HSRRRYFYLAGYGIPALIVAVSAAVDYRSYGTDRVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYVNESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1053          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Zebrafish
Match: celsr1b (cadherin EGF LAG seven-pass G-type receptor 1b [Source:ZFIN;Acc:ZDB-GENE-050823-4])

HSP 1 Score: 105.145 bits (261), Expect = 3.857e-22
Identity = 101/473 (21.35%), Postives = 209/473 (44.19%), Query Frame = 1
Query: 1762 REMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLKELTYEQINSNEIATIALTKDFQIE-----RDQLQVSQNPKHIVIITVIYRKAG--LNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWIN-DCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALP--SYFGXXXXXXXXXXXXXXXXXXRT-SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            +EME  +  PN+++  K+              D L      QINS  ++ +++     ++     + +    Q      ++ +IYR  G  L  ++   +  +++    V      IN+ I+ + V  DG  +       + L+F   +    +   C+     +   +I       W +  C +       + C C+ +  F +  D+       K++  D+L L   +Y   S S +   I+ L+L  LR   S   SIHK+   +I   +  ++ GI++ +   +C + ++LLHY ++  F W+  E  ++Y ++T   + +     GHM  +Y +GW +PAI+     G++ + Y + + CW++  D  +W   GP   V++++I++++  AK    S   +   +    I+  +  +  ++L+S +W    + V    +   YL+ + + LQG     F+ +LN +V+
Sbjct: 2252 KEMECSVLFPNLLMSKKS-------------KDALSTDPPSQINST-VSVMSMDGSDVVDLIPSIKKRSHAEQPDPPAAVMVMIYRSLGHLLPESYDPDRRSLRLPNRPV------INTPIVSVVVHKDGEPLLSPLQRPILLNFRLLETQERTKPVCV-----YWNHSIMVAGGGAWSSKGCELVFRNSTHISCQCSHMSSFAILMDI------SKREHGDVLPLKVVTYTTVSASLVALLITFLLLAILRKLRSNLHSIHKNLVASIFLSEFIFLTGINQTDSPFVCTVVAILLHYSYMCAFAWMFVEGLHIYRMLTEMRNIN----QGHMRFYYAIGWGIPAIITGLAVGLDPQGYGNPDFCWLSVYDTLIWSITGPISIVVLINIVLIVLAAK---ASCGRRQRTEKSGAISALRVAFLLLLLISATWLLGLMAVNSDVLSFHYLFAILSCLQGICIFFFHCILNKDVR 2686          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Zebrafish
Match: adgrd1 (adhesion G protein-coupled receptor D1 [Source:ZFIN;Acc:ZDB-GENE-041212-24])

HSP 1 Score: 100.523 bits (249), Expect = 4.157e-22
Identity = 94/358 (26.26%), Postives = 169/358 (47.21%), Query Frame = 1
Query: 2272 WIND-CAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITSS----IHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAK--EHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASEQGEDGLHDIPYICYNDAFPNNDQLIEATKTNDNNDARNGKNE 3318
            W N+ C   +  +   ICLCN L  F +   +     K  +     L+  SY GCS+S    +I+L+    L + S   +    IH + + AI+  Q+  +         + CKI ++LLH+FFL  F+W++ E  +LY ++     S G     H + +Y +GW  P ++       +  +Y   + CW++ K+  +W F  PA+ VI+V+I +L+   +      +   K   D  ++   TKA+   + +L +SW F  + V    ++ +Y++ +FNSLQG F  +F+ LLN EV+  +   K++ +    +      ++  P+   +D    N   +  TK N  + + N  N 
Sbjct:    7 WSNEGCVRADGNLSYSICLCNHLTNFAILMQVVPM--KISEAHRMALSTISYIGCSISIFCLAITLVTFAVLSSVSTIRNQRYHIHANLAFAILVAQILLLISFRFTHGTLPCKIMAVLLHFFFLCAFSWMLVEGLHLYSMVIKVFGSEGSK---HFY-YYAIGWGCPLVICVVSMTSSLHSYGEDDNCWLSLKNGAIWAFVAPALFVILVNIGILVAVTRIISRISAENYKVHGDANSVKLTTKAVAVLLPILGISWVFGVLAVNDHSLLFQYMFAVFNSLQGFFIFLFHCLLNSEVRAAF---KHKTKVWTLTSSSIRNINVKPF--NSDIMNGNKGGMSPTKMNTWDKSTNSANR 353          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 134.42 bits (337), Expect = 7.816e-31
Identity = 108/429 (25.17%), Postives = 201/429 (46.85%), Query Frame = 1
Query: 1954 QVSQNPKHIVIITVIYRKAG--LNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEW-INDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDL--LALPSYFGXXXXXXXXXXXXXXXXXXRT-SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS----NRKNEERKLEASEQGED 3204
            +++Q P   +II +IY+  G  L A ++  +  +++    V      +NS I+ ++V  +   I       + L F   +  N S   C+ V                W + DC +       V C C + G + V  D  +    +++   DL  LA+ SY   S+S      +  +L +L+   S T  IH + ++A+   ++ ++ GI++ E E +C + ++LLHYFFLS F WL  E  ++Y + T   + +     G M  ++ +GW +PAI+     G++ E + + + CWI+  D  VW F GP   VIV++ ++ +  AK     S  + E    +++   ++ +  ++ +S++W F  + V    +   YLY +   LQG   +V + +LN+EVQ  +      +K    ++    QG +
Sbjct: 2203 RIAQEPAPTIIILIIYQTLGELLPARYNTEKRSLRLPKNPV------MNSPIVSVSVLRNQSLILGALDTPVVLEFRLLETVNRSKPVCVQV-------KTPPNPLGSWTVKDCELVYRNTTHVRCHCPQFGTYGVLMDGSH----REQLEGDLETLAIVSYTSLSISLAALVATFSILTFLKGLKSNTRGIHSNIAVALFLSELVFVLGINRTESEFLCTVIAILLHYFFLSTFAWLFVEGLHIYRMQTEVRNVNF----GPMRFYFAIGWGVPAIITGLAVGLDPEGFGNPDFCWISSHDKLVWSFAGPIAIVIVLNGVMFLLVAK--MLCSPGQKETKKNSVLMTIRSSFILLLFISITWLFGLLAVNNSVLAFHYLYVILCCLQGLAVLVLFCMLNEEVQEAWKVVCLGKKGPGEEISRQAQGPN 2608          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 131.724 bits (330), Expect = 4.957e-30
Identity = 108/433 (24.94%), Postives = 203/433 (46.88%), Query Frame = 1
Query: 1954 QVSQNPKHIVIITVIYRKAG--LNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEW-INDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDL--LALPSYFGXXXXXXXXXXXXXXXXXXR-TSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS----NRKNEERKLEASEQGEDGLHD 3216
            +++Q P   +II +IY+  G  L A ++  +  +++    V      +NS I+ ++V  +   I       + L F   +  N S   C+ V                W + DC +       V C C + G + V  D  +    +++   DL  LA+ SY   S+S      +  +L +L+   S T  IH + ++A+   ++ ++ GI++ E E +C + ++LLHYFFLS F WL  E  ++Y + T   + +     G M  ++ +GW +PAI+     G++ E + + + CWI+  D  VW F GP   VIV++ ++ +  AK     S  + E    +++   ++ +  ++ +S++W F  + V    +   YLY +   LQG   +V + +LN+EVQ  +      +K    ++    QG +  ++
Sbjct: 2223 RIAQEPAPTIIILIIYQTLGELLPARYNTEKRSLRLPKNPV------MNSPIVSVSVLRNQSLILGALDTPVVLEFRLLETVNRSKPVCVQVD-----------PLGSWTVKDCELVYRNTTHVRCHCPQFGTYGVLMDGSH----REQLEGDLETLAIVSYTSLSISLAALVATFSILTFLKGLKSNTRGIHSNIAVALFLSELVFVLGINRTESEFLCTVIAILLHYFFLSTFAWLFVEGLHIYRMQTEVRNVNF----GPMRFYFAIGWGVPAIITGLAVGLDPEGFGNPDFCWISSHDKLVWSFAGPIAIVIVLNGVMFLLVAK--MLCSPGQKETKKNSVLMTIRSSFILLLFISITWLFGLLAVNNSVLAFHYLYVILCCLQGLAVLVLFCMLNEEVQEAWKVVCLGKKGPGEEISRQAQGPNAYNN 2628          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 131.724 bits (330), Expect = 5.041e-30
Identity = 107/429 (24.94%), Postives = 203/429 (47.32%), Query Frame = 1
Query: 1954 QVSQNPKHIVIITVIYRKAG--LNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEW-INDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDL--LALPSYFGXXXXXXXXXXXXXXXXXXRT-SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS----NRKNEERKLEASEQGED 3204
            +++Q P   +II +IY+  G  L A ++  +  +++    V      +NS I+ ++V  +   I       + L F   +  N S   C+  +     ++        W + DC +       V C C + G + V  D  +    +++   DL  LA+ SY   S+S      +  +L +L+   S T  IH + ++A+   ++ ++ GI++ E E +C + ++LLHYFFLS F WL  E  ++Y + T   + +     G M  ++ +GW +PAI+     G++ E + + + CWI+  D  VW F GP   VIV++ ++ +  AK     S  + E    +++   ++ +  ++ +S++W F  + V    +   YLY +   LQG   +V + +LN+EVQ  +      +K    ++    QG +
Sbjct: 2217 RIAQEPAPTIIILIIYQTLGELLPARYNTEKRSLRLPKNPV------MNSPIVSVSVLRNQSLILGALDTPVVLEFRLLETVNRSKPVCVQWN-----QSEQVDPLGSWTVKDCELVYRNTTHVRCHCPQFGTYGVLMDGSH----REQLEGDLETLAIVSYTSLSISLAALVATFSILTFLKGLKSNTRGIHSNIAVALFLSELVFVLGINRTESEFLCTVIAILLHYFFLSTFAWLFVEGLHIYRMQTEVRNVNF----GPMRFYFAIGWGVPAIITGLAVGLDPEGFGNPDFCWISSHDKLVWSFAGPIAIVIVLNGVMFLLVAK--MLCSPGQKETKKNSVLMTIRSSFILLLFISITWLFGLLAVNNSVLAFHYLYVILCCLQGLAVLVLFCMLNEEVQEAWKVVCLGKKGPGEEISRQAQGPN 2624          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 131.339 bits (329), Expect = 5.764e-30
Identity = 107/429 (24.94%), Postives = 203/429 (47.32%), Query Frame = 1
Query: 1954 QVSQNPKHIVIITVIYRKAG--LNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEW-INDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDL--LALPSYFGXXXXXXXXXXXXXXXXXXRT-SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS----NRKNEERKLEASEQGED 3204
            +++Q P   +II +IY+  G  L A ++  +  +++    V      +NS I+ ++V  +   I       + L F   +  N S   C+  +     ++        W + DC +       V C C + G + V  D  +    +++   DL  LA+ SY   S+S      +  +L +L+   S T  IH + ++A+   ++ ++ GI++ E E +C + ++LLHYFFLS F WL  E  ++Y + T   + +     G M  ++ +GW +PAI+     G++ E + + + CWI+  D  VW F GP   VIV++ ++ +  AK     S  + E    +++   ++ +  ++ +S++W F  + V    +   YLY +   LQG   +V + +LN+EVQ  +      +K    ++    QG +
Sbjct: 2208 RIAQEPAPTIIILIIYQTLGELLPARYNTEKRSLRLPKNPV------MNSPIVSVSVLRNQSLILGALDTPVVLEFRLLETVNRSKPVCVQWN-----QSEQVDPLGSWTVKDCELVYRNTTHVRCHCPQFGTYGVLMDGSH----REQLEGDLETLAIVSYTSLSISLAALVATFSILTFLKGLKSNTRGIHSNIAVALFLSELVFVLGINRTESEFLCTVIAILLHYFFLSTFAWLFVEGLHIYRMQTEVRNVNF----GPMRFYFAIGWGVPAIITGLAVGLDPEGFGNPDFCWISSHDKLVWSFAGPIAIVIVLNGVMFLLVAK--MLCSPGQKETKKNSVLMTIRSSFILLLFISITWLFGLLAVNNSVLAFHYLYVILCCLQGLAVLVLFCMLNEEVQEAWKVVCLGKKGPGEEISRQAQGPN 2615          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Xenopus
Match: brinp1 (bone morphogenetic protein/retinoic acid inducible neural-specific 1 [Source:Xenbase;Acc:XB-GENE-1011965])

HSP 1 Score: 130.568 bits (327), Expect = 1.089e-29
Identity = 107/433 (24.71%), Postives = 205/433 (47.34%), Query Frame = 1
Query: 1954 QVSQNPKHIVIITVIYRKAG--LNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEW-INDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDL--LALPSYFGXXXXXXXXXXXXXXXXXXR-TSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS----NRKNEERKLEASEQGEDGLHD 3216
            +++Q P   +II +IY+  G  L A ++  +  +++    V      +NS I+ ++V  +   I       + L F   +  N S   C+  +     ++        W + DC +       V C C + G + V  D  +    +++   DL  LA+ SY   S+S      +  +L +L+   S T  IH + ++A+   ++ ++ GI++ E E +C + ++LLHYFFLS F WL  E  ++Y + T   + +     G M  ++ +GW +PAI+     G++ E + + + CWI+  D  VW F GP   VIV++ ++ +  AK     S  + E    +++   ++ +  ++ +S++W F  + V    +   YLY +   LQG   +V + +LN+EVQ  +      +K    ++    QG +  ++
Sbjct: 2088 RIAQEPAPTIIILIIYQTLGELLPARYNTEKRSLRLPKNPV------MNSPIVSVSVLRNQSLILGALDTPVVLEFRLLETVNRSKPVCVQWN-----QSEQVDPLGSWTVKDCELVYRNTTHVRCHCPQFGTYGVLMDGSH----REQLEGDLETLAIVSYTSLSISLAALVATFSILTFLKGLKSNTRGIHSNIAVALFLSELVFVLGINRTESEFLCTVIAILLHYFFLSTFAWLFVEGLHIYRMQTEVRNVNF----GPMRFYFAIGWGVPAIITGLAVGLDPEGFGNPDFCWISSHDKLVWSFAGPIAIVIVLNGVMFLLVAK--MLCSPGQKETKKNSVLMTIRSSFILLLFISITWLFGLLAVNNSVLAFHYLYVILCCLQGLAVLVLFCMLNEEVQEAWKVVCLGKKGPGEEISRQAQGPNAYNN 2499          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Mouse
Match: Adgrl3 (adhesion G protein-coupled receptor L3 [Source:MGI Symbol;Acc:MGI:2441950])

HSP 1 Score: 116.701 bits (291), Expect = 1.153e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  979 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1203          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Mouse
Match: Adgrl3 (adhesion G protein-coupled receptor L3 [Source:MGI Symbol;Acc:MGI:2441950])

HSP 1 Score: 116.701 bits (291), Expect = 1.153e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  979 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1203          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Mouse
Match: Adgrl3 (adhesion G protein-coupled receptor L3 [Source:MGI Symbol;Acc:MGI:2441950])

HSP 1 Score: 116.316 bits (290), Expect = 1.195e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  979 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1203          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Mouse
Match: Adgrl3 (adhesion G protein-coupled receptor L3 [Source:MGI Symbol;Acc:MGI:2441950])

HSP 1 Score: 116.701 bits (291), Expect = 1.216e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  979 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1203          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Mouse
Match: Adgrl3 (adhesion G protein-coupled receptor L3 [Source:MGI Symbol;Acc:MGI:2441950])

HSP 1 Score: 116.316 bits (290), Expect = 1.277e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  911 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1135          
BLAST of adhesion G protein-coupled receptor L2-like vs. UniProt/SwissProt
Match: sp|Q9NYQ6|CELR1_HUMAN (Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.908e-25
Identity = 66/219 (30.14%), Postives = 126/219 (57.53%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAK-----EHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            SIHKH ++A+   Q+ ++ GI++ E+  +C + ++LLHY ++S F W + E+ ++Y ++T       +   G M  +YV+GW +PAI+     G++ + Y + + CW++ +D  +W F GP  AVI+++ +  + +AK     +HH   Y K     K I++  +  +  ++L+S +W    + V    +   YL+ +F+ LQG F ++F+ +LN EV+
Sbjct: 2502 SIHKHLAVALFLSQLVFVIGINQTENPFLCTVVAILLHYIYMSTFAWTLVESLHVYRMLTEVR----NIDTGPMRFYYVVGWGIPAIVTGLAVGLDPQGYGNPDFCWLSLQDTLIWSFAGPIGAVIIINTVTSVLSAKVSCQRKHH--YYGK-----KGIVSLLRTAFLLLLLISATWLLGLLAVNRDALSFHYLFAIFSGLQGPFVLLFHCVLNQEVR 2709          
BLAST of adhesion G protein-coupled receptor L2-like vs. UniProt/SwissProt
Match: sp|Q80TS3|AGRL3_MOUSE (Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 7.985e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  979 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1203          
BLAST of adhesion G protein-coupled receptor L2-like vs. UniProt/SwissProt
Match: sp|Q9Z173|AGRL3_RAT (Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 8.437e-25
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  978 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1202          
BLAST of adhesion G protein-coupled receptor L2-like vs. UniProt/SwissProt
Match: sp|O97827|AGRL3_BOVIN (Adhesion G protein-coupled receptor L3 OS=Bos taurus OX=9913 GN=ADGRL3 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.000e-24
Identity = 68/231 (29.44%), Postives = 124/231 (53.68%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNE---------KDNKAIINQ-TKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E         +DN+  I          + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  979 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1203          
BLAST of adhesion G protein-coupled receptor L2-like vs. UniProt/SwissProt
Match: sp|Q9HAR2|AGRL3_HUMAN (Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 2.294e-24
Identity = 69/225 (30.67%), Postives = 126/225 (56.00%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWR--FYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTA-KEHHESSYTKNEK---DN-KAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   ++ ++ GI++ +  I C +F+ LLH+FFL+ FTW+  E   LYI++     S       H  R  FY++G+ MPA++VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     K  H ++  K E    DN K+ +    A+   + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  898 TIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESE------HSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNIKSWVIGAIAL---LCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYG 1113          
BLAST of adhesion G protein-coupled receptor L2-like vs. TrEMBL
Match: A0A267GSB6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026270g1 PE=3 SV=1)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 374/1043 (35.86%), Postives = 553/1043 (53.02%), Query Frame = 1
Query:  286 QNECHSTYYNDPQCIDQPGGYYCNCGPGFKWNSNQCIAAGIDSKMAFQS-VNSSFTVLDRQN--LPKE--FTISFWVRPL---TAGVIFSLVHDHMMN---------------ENSSQVMIS-IDHSTHKSFTIIFRYLTKEWITDMIIVQNKWTHIIWSQQV-IDHQSVKWKGYINDVKYE------KVEFFSSDVLKG-------EMILGQLS-RLFKSLSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYGTRGNLQLKWPSGIKVSSC---------TDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTRMVDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQDLATKCFLNDLHLIEGLSIFANLTDKFNINNAIDLSLCIDILDVFTELKENQESKCPSFMIERFQKREEIHQNQYTTIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFY----------QVTTVNVNNLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLK-------ELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWI-NDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGD-STDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASE--QGEDG 3207
            + ECH+ +Y  P+C+D+P GYYC CGPGF WNS  C++  +DS M F +  N+S+ V++ +   LPK+  FTI+ +V+       G +FSL  D   N               E  S++ I   + +   SF+     L             +W H+ W+  +   ++S  WK YI   +        K     S++ +G       E+ LGQ S          +   G ++HFN+WN +L  ++  +L  D  + FCGN V+WSD RYGTRGN+ LKWPS I+  S            V +L  +CD +CS+R+GAQCK  I +NIEW R+KA+ +   PCP  ++++  +D       S P   R C   S + G W  PN   C+S     +L +   L  +   C+   L  +  L+   N+T      N +DL + +  LD F    +   S      + R Q R +I Q        +L++ NNL+  KN+AAWN TR  G E R LL  L+  +          +VT   +  L  K   +  +M  F N  N+++K+ AF    F G A PD  D K       +L    +  +    ++L  +      +  +   P   + I  +Y        H       K   GA+S     +NS I  + +  + +++ +  +  ++    Y +  NIS+  C+ ++  F +R +       W   DC +E+   + V C CN  G+  + TDM+N    + K    LLA PSY GC VSS+LC  + ++L Y RTSS T+ IH+HFS+AI+ GQ+ ++FGIDK + + +C   + L+HYFFL+ F+WLMNEAFNLYIVITYAAH+H D S +G MWR+Y++GWI+P   V    GIN  +YY+ +MCW   ++VWL+ GPAI ++ ++++VL FTAKEHHESSYTK+EK NKAI   +KA+WTQ+ILLS+SWSFAF+ +IM  IIVK LY +FN LQG FF+VFY+LLNDEVQ+ Y   +N++ +L A    Q  DG
Sbjct:   36 KTECHADFYCRPECLDRPDGYYCECGPGFMWNSYTCVSLAVDSSMVFSNRANASYAVINNRTKILPKQYNFTIALFVKLFHLNETGTLFSLRKDSHGNYVRIWYSGSDRRFHIETYSELQIGRTNEAPQFSFSFKIDNLRPR----------EWYHLAWTNLMHPRNRSTDWKVYITPPQGGTLPPKIKRSVGGSNIAEGATLPNRTELYLGQNSPNASNHFDMRFALLGEISHFNMWNETLTREDVAALATDDKHRFCGNQVEWSDLRYGTRGNVTLKWPSNIQFGSSGVYNEHTRNAMVASLQESCDFNCSERMGAQCKASIDSNIEWPRTKADQSTSVPCPTAEKIENATDG------SHPIAYRSCLRNSKQQGSWSQPNYDRCVSKEHLDILNESNSLSAMDISCY--PLLGLSLLTRMENITKLTAYKNPMDLHVMVTALDNFAAAWKKSCS------VPRMQ-RTDI-QELKQLFNKILKLTNNLMSDKNMAAWNLTRHPGQESRHLLSNLHNIFSLYVSEIYTSKVTQHPMERLSAKQLDL-SDMNSFFNGENLVVKVTAFHPEKFDGDALPDKADEKLMKPSVVQLGAVGVQPHTFRNMSLLAELYEGATKQDMLAAPTMYISILAMYPYGDRLLPHVHLIAAWKRTLGAMSHREDNVNSAIYHVLLFRNNQELLRGLNVPIRTRLRYTNNVNISDVKCVRLT--FHDR-VPERDDYHWTQQDCWVEDYNAEFVRCACNTTGLQAITTDMYNNNLNRTKDVMKLLAYPSYIGCGVSSILCLTTCVLLFYFRTSSNTAKIHQHFSLAIVCGQLVFVFGIDKLKPDALCHSMAALIHYFFLASFSWLMNEAFNLYIVITYAAHAHQDGSEEGGMWRYYLIGWIVPIAFVGTFVGINGNSYYAIDMCWTARENVWLYAGPAIGIVAITVMVLTFTAKEHHESSYTKDEKANKAITIHSKALWTQVILLSVSWSFAFVSIIMHDIIVKLLYAMFNCLQGIFFVVFYFLLNDEVQHKYV--QNQKMRLLALHGLQDSDG 1046          
BLAST of adhesion G protein-coupled receptor L2-like vs. TrEMBL
Match: A0A267E1P2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026270g2 PE=3 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 2.178e-180
Identity = 373/1043 (35.76%), Postives = 553/1043 (53.02%), Query Frame = 1
Query:  286 QNECHSTYYNDPQCIDQPGGYYCNCGPGFKWNSNQCIAAGIDSKMAFQS-VNSSFTVLDRQN--LPKE--FTISFWVRPL---TAGVIFSLVHDHMMN---------------ENSSQVMIS-IDHSTHKSFTIIFRYLTKEWITDMIIVQNKWTHIIWSQQV-IDHQSVKWKGYINDVKYE------KVEFFSSDVLKG-------EMILGQLS-RLFKSLSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYGTRGNLQLKWPSGIKVSSC---------TDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTRMVDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQDLATKCFLNDLHLIEGLSIFANLTDKFNINNAIDLSLCIDILDVFTELKENQESKCPSFMIERFQKREEIHQNQYTTIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFY----------QVTTVNVNNLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLK-------ELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWI-NDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGD-STDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASE--QGEDG 3207
            + ECH+ +Y  P+C+D+P GYYC CGPGF WNS  C++  +DS M F +  N+S+ V++ +   LPK+  FTI+ +V+       G +FSL  D   N               E  S++ I   + +   SF+     L             +W H+ W+  +   ++S  WK YI   +        K     S++ +G       E+ LGQ S          +   G ++HFN+WN +L  ++  +L  D  + FCGN V+WSD RYGTRGN+ LKWPS I+  S            V +L  +CD +CS+R+GAQCK  I +NIEW R+KA+ +   PCP  ++++  +D       S P   R C   S + G W  PN   C+S     +L +   L  +   C+   L  +  L+   N+T      N +DL + +  LD F    +   S      + R Q R +I Q        +L++ NNL+  KN+AAWN TR  G E R LL  L+  +          +VT   +  L  K   +  +M  F N  N+++K+ AF    F G A PD  D K       +L    +  +    ++L  +      +  +   P   + I  +Y        H       K   GA+S     +NS I  + +  + +++ +  +  ++    Y +  NIS+  C+ ++  F +R +       W   DC +E+   + V C CN  G+  + TDM+N    + K    LLA PSY GC VSS+LC  + ++L Y RTSS T+ IH++FS+AI+ GQ+ ++FGIDK + + +C   + L+HYFFL+ F+WLMNEAFNLYIVITYAAH+H D S +G MWR+Y++GWI+P   V    GIN  +YY+ +MCW   ++VWL+ GPAI ++ ++++VL FTAKEHHESSYTK+EK NKAI   +KA+WTQ+ILLS+SWSFAF+ +IM  IIVK LY +FN LQG FF+VFY+LLNDEVQ+ Y   +N++ +L A    Q  DG
Sbjct:   36 KTECHADFYCRPECLDRPDGYYCECGPGFMWNSYTCVSLAVDSSMVFSNRANASYAVINNRTKILPKQYNFTIALFVKLFHLNETGTLFSLRKDSHGNYVRIWYSGSDRRFHIEAYSELQIGRTNEAPQFSFSFKIDNLRPR----------EWYHLAWTNLMHPRNRSTDWKVYITPPQGGTLPPKIKRSVGGSNIAEGATLPNRTELYLGQNSPNASNHFDMRFALLGEISHFNMWNETLTREDVAALATDDKHRFCGNQVEWSDLRYGTRGNVTLKWPSNIQFGSSGVYNEHTRNAMVASLQESCDFNCSERMGAQCKASIDSNIEWPRTKADQSTSVPCPTAEKIENATDG------SHPIAYRSCLRNSKQQGSWSQPNYDRCVSKEHLDILNESNSLSAMDISCY--PLLGLSLLTRMENITKLTAYKNPMDLHVMVTALDNFAAAWKKSCS------VPRMQ-RTDI-QELKQLFNKILKLTNNLMSDKNMAAWNLTRHPGQESRHLLSNLHNIFSLYVSEIYTSKVTQHPMERLSAKQLDL-SDMNSFFNGENLVVKVTAFHPEKFDGDALPDKADEKLMKPSVVQLGAVGVQPHTFRNMSLLAELYEGATKQDMLAAPTMYISILAMYPYGDRLLPHVHLIADWKRTLGAMSHREDNVNSAIYHVLLFRNNQELLRGLNVPIRTRLRYTNNVNISDVKCVRLT--FHDR-VPERDDYHWTQQDCWVEDYNAEFVRCACNTTGLQAITTDMYNNNLNRTKDVMKLLAYPSYIGCGVSSILCLTTCVLLFYFRTSSNTAKIHQNFSLAIVCGQLVFVFGIDKLKPDALCHSMAALIHYFFLASFSWLMNEAFNLYIVITYAAHAHQDGSEEGGMWRYYLIGWIVPIAFVGTFVGINGNSYYAIDMCWTARENVWLYAGPAIGIVAITVMVLTFTAKEHHESSYTKDEKANKAITIHSKALWTQVILLSVSWSFAFVSIIMHDIIVKLLYAMFNCLQGIFFVVFYFLLNDEVQHKYV--QNQKMRLLALHGLQDSDG 1046          
BLAST of adhesion G protein-coupled receptor L2-like vs. TrEMBL
Match: A0A1I8IDD0 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 531.946 bits (1369), Expect = 1.364e-166
Identity = 355/1043 (34.04%), Postives = 528/1043 (50.62%), Query Frame = 1
Query:  286 QNECHSTYYNDPQCIDQPGGYYCNCGPGFKWNSNQCIAAGIDSKMAFQS-VNSSFTVLDRQN--LPKE--FTISFWVRPL---TAGVIFSLVHDHMMN---------------ENSSQVMIS-IDHSTHKSFTIIFRYLTKEWITDMIIVQNKWTHIIWSQQV-IDHQSVKWKGYINDVKYE------KVEFFSSDVLKG-------EMILGQLS-RLFKSLSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYGTRGNLQLKWPSGIKVSSC---------TDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTRMVDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQDLATKCFLNDLHLIEGLSIFANLTDKFNINNAIDLSLCIDILDVFTELKENQESKCPSFMIERFQKREEIHQNQYTTIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFY----------QVTTVNVNNLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLK-------ELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERN-IHATSRSEWINDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGD-STDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASE--QGEDG 3207
            + ECH+ +Y  P+C+D+P GYYC CGPGF WNS  C++  +DS M F +  N+S+ V++ +   LPK+  FTI+ +V+       G +FSL  D   N               E  S++ I   + +   SF+     L             +W H+ W+  +   ++S  WK YI   +        K     S++ +G       E+ LGQ S          +   G ++HFN+WN +L  ++  +L  D  + FCGN V+WSD RYGTRGN+ LKWPS I+  S            V +L  +CD +CS+R+GAQCK  I +NIEW R+KA+ +   PCP  ++++                                 N TA   S + +L L                      L+   N+T      N +DL + +  LD F    +   S      + R Q R +I + +    K +L++ NNL+  KN+AAWN TR  G E R LL  L+  +          +VT   +  L  K   +  +M  F N  N+++K+ AF    F G A PD  D K       +L    +  +    ++L  +      +  +   P   + I  +Y        H       K   GA+S     +NS I  + +  + +++ +  +  ++    Y +  NIS+  C+ ++  F +R+  H T +     DC +E+   + V C CN  G+  + TDM+N    + K    LLA PSY G                   TSS T+ IH++FS+AI+ GQ+ ++FGIDK + + +C   + L+HYFFL+ F+WLMNEAFNLYIVITYAAH+H D S +G MWR+Y++GWI+P   V    GIN  +YY+ +MCW   ++VWL+ GPAI ++ ++++VL FTAKEHHESSYTK+EK NKAI   +KA+WTQ+ILLS+SWSFAF+ +IM  IIVK LY +FN LQG FF+VFY+LLNDEVQ+ Y   +N++ +L A    Q  DG
Sbjct:   36 KTECHADFYCRPECLDRPDGYYCECGPGFMWNSYTCVSLAVDSSMVFSNRANASYAVINNRTKILPKQYNFTIALFVKLFHLNETGTLFSLRKDSHGNYVRIWYSGSDRRFHIEAYSELQIGRTNEAPQFSFSFKIDNLRPR----------EWYHLAWTNLMHPRNRSTDWKVYITPPQGGTLPPKIKRSVGGSNIAEGATLPNRTELYLGQNSPNASNHFDMRFALLGEISHFNMWNETLTREDVAALATDDKHRFCGNQVEWSDLRYGTRGNVTLKWPSNIQFGSSGVYNEHTRNAMVASLQESCDFNCSERMGAQCKASIDSNIEWPRTKADQSTSVPCPTAEKIE---------------------------------NATAMDISCYPLLGLSL--------------------LTRMENITKLTAYKNPMDLHVMVTALDNFAAAWKKSCS------VPRMQ-RTDIQELKQLFNK-ILKLTNNLMSDKNMAAWNLTRHPGQESRHLLSNLHNIFSLYVSEIYTSKVTQHPMERLSAKQLDL-SDMNSFFNGENLVVKVTAFHPEKFDGDALPDKADEKLMKPSVVQLGAVGVQPHTFRNMSLLAELYEGATKQDMLAAPTMYISILAMYPYGDRLLPHVHLIADWKRTLGAMSHREDNVNSAIYHVLLFRNNQELLRGLNVPIRTRLRYTNNVNISDVKCVRLT--FHDRDDYHWTQQ-----DCWVEDYNAEFVRCACNTTGLQAITTDMYNNNLNRTKDVMKLLAYPSYIG-------------------TSSNTAKIHQNFSLAIVCGQLVFVFGIDKLKPDALCHSMAALIHYFFLASFSWLMNEAFNLYIVITYAAHAHQDGSEEGGMWRYYLIGWIVPIAFVGTFVGINGNSYYAIDMCWTARENVWLYAGPAIGIVAITVMVLTFTAKEHHESSYTKDEKANKAITIHSKALWTQVILLSVSWSFAFVSIIMHDIIVKLLYAMFNCLQGIFFVVFYFLLNDEVQHKYV--QNQKMRLLALHGLQDSDG 978          
BLAST of adhesion G protein-coupled receptor L2-like vs. TrEMBL
Match: A0A1S3KGL3 (adhesion G protein-coupled receptor L2-like OS=Lingula unguis OX=7574 GN=LOC106181684 PE=3 SV=1)

HSP 1 Score: 521.161 bits (1341), Expect = 2.176e-163
Identity = 348/994 (35.01%), Postives = 522/994 (52.52%), Query Frame = 1
Query:  262 LQIVQPLSQNECHSTYYNDPQCIDQPGGYYCNCGPGFKWNSNQCIAAGIDSKMAF-------QSVNSSFTVLDRQNLPK--EFTISFWVR---PLTAGVIFSLVHDHMMNENSSQVMISIDHSTHKSFTIIFRYLTKEWITDMIIVQNKWTHIIWSQQVIDHQSVKWKG-------YINDVKYEKVEFFSSDVLKGEMILGQLSRLFKSLSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYGTRGNLQLKWPSGIKVSSC-TDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTRMVDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQDLATKCFLND--LHLIEGLSIFANLTDKFNINNAIDLSLCIDILDVFTELK--ENQESKCPSFMIERFQKREEIHQNQYTTI---KLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFYQVTTVNVNNLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLKELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDG-RKIDQVK-SNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWIN---DCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGD-STDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQN 3144
            ++ ++ L   +C   YY  P C D P GY C CGPGF WN+  CI+  ++S+           ++ + +  L  +  P     TI+ WVR     T G + S    +     S+ + I+         T+ F    +   T +++    W H+ ++   ID     ++        Y++ V   K      D++ G+  LGQ   +      D  F G L+H N+W   L +DE R +Y DC +  CG  VQW++FR+GT GN+ L+WPS I   +C TDV     TCD  CS  IGAQC  +I  NI W R+ A   +  PCP       V D+     ++     RYC  T+   G W +P +  CLS     L LK +  + L    F  D   HL   L    N T   +  N ID++  ID L++  + +    ++    S M+  F +  E++ +   TI   KL+  I N+L+  KN A W   +P G EG  L+  + KF  +    +   +        E  +     NI +K++ F    F G AFPD  D    T+    S++I T+ALTK+   E ++      P    I +V +     N A  +    + +++         +NS +  + V  +  R +     S+ +KL+  Y D  NISN +C+ +      R+   T +  W +   DC +         C C +LG + V TDMFN  W + + P  L+  PSY GC++S++LC  S +MLIYLRTSS +++IHK+F  +I   Q+ +M G+ +  ++ +C +F++L HYFFL+ F+W+MNEAFNLYI ITYAAHSHG  S  G +WR+Y+LGW++P  LV A+ G + ++YY+ +MCWI    VW F GP IA+  VSILVLIFTAKE+HESSYTKNEK NK ++N TKA+WTQ++LL++ W+FAF+ + M+G I+KYLY L N LQG+FF+VFY+LLN+E+ +
Sbjct:    7 IESMETLHGADCIGRYYTWPTCQDNPDGYGCLCGPGFYWNTRLCISTSVNSRFELNGDHNDRHTLKNGYAKLVGKTFPDLIHLTITMWVRVPNSTTDGTLLS----YSTRNYSNLIQITAGR------TVKFSLHGETRDTGLMLQHGFWVHLAFTWSAIDGSWFVYENGAKISLPYMDTVGKRKPILRGGDMILGQSYLGQNGHV----QYDSPFIGDLSHVNIWKQVLSEDEIRKVYSDCTFTHCGTAVQWTEFRFGTHGNIHLRWPSEIVDQTCFTDVWA-AETCDDHCSYVIGAQCNEEIVENIRWSRTPAGHNVSVPCP-----GRVDDSG----NATAFAYRYCNITNDNKGVWGEPQIDECLSQ--KQLSLKTEIAELLGLPSFDEDRMFHLGNAL---LNHTTYTSYTNPIDIAAEIDSLNLLIKAQGINLRDVVWKSDMLHSFARTLELYPSFEKTIEFTKLICGIVNDLVATKNDAGWRGVQPPGAEGEVLIASVEKFTSLVAKTLIYHVKHKHIGSEEATVSALYDNIAVKVRVFLRDRFMGFAFPDHTD----TFALEMSDDIGTLALTKEAITELNE----TIPNLFAIASVRFS----NMARLLPNHNITIKSK-----RDNVNSVVYSLNVYFENDRNLSSTNLSSPVKLYLPYTDDFNISNPDCVML------RHREGTRQWRWSSGRGDCYVIRNDSSYATCGCYRLGTYAVTTDMFNVDWDRGEHPPHLMTTPSYVGCAMSTVLCLGSAVMLIYLRTSSPSAAIHKNFGFSISLCQLIFMVGVTQTSNKTVCHVFAVLFHYFFLTTFSWMMNEAFNLYIKITYAAHSHGPVSESGSIWRYYILGWVVPGALVGALVGSHGDSYYAADMCWIRWDLVWFFIGPVIAIQAVSILVLIFTAKEYHESSYTKNEKANKILVNHTKAVWTQVVLLTVVWTFAFLSLKMRGPILKYLYALLNFLQGSFFLVFYFLLNEEMPD 948          
BLAST of adhesion G protein-coupled receptor L2-like vs. TrEMBL
Match: A0A210QKY1 (Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06036 PE=3 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 6.618e-153
Identity = 351/1094 (32.08%), Postives = 541/1094 (49.45%), Query Frame = 1
Query:  295 CHSTYYNDPQCIDQPGGYYCNCGPGFKWNSNQCIAAGIDSKMAFQSVNSS-FTVLDRQNLPK--EFTISFWVR------PLTAGVIFSLVHDHMMNENSSQVMISIDHSTHKSFTIIFRYLTKEWITDMIIVQNKWTHIIWSQQVIDHQSVKWKGYIN--DVKYEKVEFFSSDVLKG-EMILGQLSRLFKSLSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYGTRGNLQLKWPSGI--------KVSSCTDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTRMVDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQDLATKCFLNDLHLIEGLSIF-ANLTDKFNINNA----IDLSLCIDILD----------VFTELKENQESKCPSFMIERFQKREEIHQNQYTTIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFYQVTTVNVNNLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLKELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIV---IITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWI---NDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHS-HGDSTD-GHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASEQGEDGLHDIPYICYNDAFPNNDQLIEATKTNDNNDARNGKNERRKRFFSNVIENFNIRTKKSQSKDDIGDRSNTDNSDYELITSV 3447
            CH++YYN P+CID P GY C CG GF WN++ C++  IDS++ F+      +T+L  +  P+   FTI +W+R          G I S  H   ++     + + +DH       + FR   +   T +I+   +W H+ W+    D     WK Y N  +V   +   F   V+ G E +LGQ SR          F G LAH +VW++ +  D+   L   C + +CGN+ QW+DFR GTRG ++++WPSGI        +   C        TC+  CS  IGAQC  DI  NI WER+KA   +   CP         +N   M ++    TR C++T    G W  P +  C+S           E++D   + F  +L L E    + A L     INN     ID++  ID+L           +  E K  +     +  +   + +EEI    +T  ++++R  +NLL  +N   WN T+P G EG  L+  L  F +     +   I        +  IF    NI  K+     S F+G  +P S D K +     + N I  I L    +        +QN   I    I+T  +R   L         Q K +          +N+ II + V           S+ +     ++D  NISN  C+ +         H++  +EW    +DC +      S  C C   G++ + TDM+N+ W K ++   L+   SY GC++S++L   +L + +Y +TSS  +S+HK+ +++I   Q+ +M GID+YE++++C++F++L+HYF LS ++WLMNE F+LY  +TY+AH+ H D +D G   R+  LGWI+P + V A  G   E YY+ +MCWI   ++WLF GP + ++ V+I+VLI TAKEH+E+SYTK+EK NK +  Q K +WTQIIL++++WSFAF+ + M   I+KYLY L N LQ  FF VF  LL++EV+N+    K  E+    S  G D   D   I   D+F +   L+E        D + G +  ++      +    +R KKSQ +    +    + SD E+ITS+
Sbjct:   50 CHTSYYNRPKCIDHPDGYGCECGSGFHWNTDMCMSTAIDSRLEFKEKEPKRYTMLLGKGFPEVGAFTIVYWIRLSKNHSVAKNGTILSYKHGTKLD----IIQMGVDHK------LWFRLFDRVKYTKIILPAGEWAHVAWTW---DSNDGSWKLYWNTEEVNRGRRNAFRKPVIAGGEFVLGQASREAFDFDSSVAFMGDLAHLHVWDFVMSHDDIVLLNNSCTFMYCGNVAQWADFRSGTRGAMRMRWPSGILNGILTTLQKEKCKTAEEEAFTCNKHCSLTIGAQCNKDIVENIVWERTKAVNYLNVSCPG-------QENLAAMNETVENATRLCDQTQQNDGIWGKPFIDRCISK-------DLMEIKDKVKRAF-KELDLNESTVFYLAELLLNHTINNVYTNPIDVATVIDLLGLIVDTQDEVAILKEKKWREGGNVYAQTVNVVRTKEEI--KNFT--EVIIRTVDNLLSRRNDVGWNATKPAGVEGDNLVSALEAFARTVAKTIQYNIRIGMIDGSDASIFEAKGNIEFKVDVHASSLFRGYIYPSSLDRKLMK----SPNNIGEIRLPDILK--------TQNASSIPAFKILTASFRFKHLAMYLPNHDLQTKSK-------EDNVNTPIIALYVYAGESAFVNNLSSPIVFKLPFQDTFNISNPECVRIR--------HSSVSAEWRWLRDDCHLIWQDGISARCGCFVPGIYAITTDMYNDNWDKGEKRPILMNAASYIGCALSALLSLGTLAIHLYCKTSSAIASLHKNLALSIFFSQIVFMIGIDRYENQVVCEVFAVLIHYFVLSTYSWLMNETFHLYTTVTYSAHAQHQDLSDSGSFLRYTFLGWILPGVFVGAFVGSQGETYYAKDMCWIAWDNLWLFVGPTLGIVTVAIMVLILTAKEHNENSYTKSEKTNKVLTIQMKGMWTQIILVTVNWSFAFLSLKMHDSIIKYLYALMNVLQAMFFTVF-NLLHEEVRNVL---KANEKLKTLSTPGVDPEVDERSI---DSFAST-PLVE-------KDIKEGLHLEKQ-----CMGRDRLRDKKSQIEASSEEEIEREGSDCEMITSL 1064          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Cavefish
Match: celsr1a (cadherin EGF LAG seven-pass G-type receptor 1a [Source:ZFIN;Acc:ZDB-GENE-030616-78])

HSP 1 Score: 119.013 bits (297), Expect = 2.007e-26
Identity = 97/412 (23.54%), Postives = 188/412 (45.63%), Query Frame = 1
Query: 1933 QIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWIN-DCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALP--SYFGXXXXXXXXXXXXXXXXXXRT-SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKE---HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            +++R + Q    P   V   ++YR  G         ++  +R          IN+ I+   V  +G+ +       + L +   +    S   C+     F   +I       W +  C + +     + C CN +  F V  D+       K++  D+L L   +Y   S S +   I+ ++L  LR   S   SIHK+   A+   ++ ++ GI++ ++  +C + ++LLH+F++  F W+  E  ++Y ++T   + +     GHM  +Y +GW +PAI+     G++ + Y + + CW++  D  +W F GP   V++V++++ I  AK      + SY K+       I   +  +  ++L+S +W    + V    +I  YL+  F+ LQG     F+ +L+ EV+
Sbjct: 2348 EVQRSRRQAEGPPPFPVAAVIVYRSLGQLLPERFDPDRRSLRLPIRPV----INTPIVSTTVHSEGQPLSMPLERPITLDYTLLETEERSKPVCV-----FWNHSIAIGGTGGWSSKGCELVSRNKTHISCQCNHMTSFAVLMDI------SKREHGDVLPLKIVTYTTVSASLLALLITFILLAILRKLRSNLHSIHKNLVAALFFSELVFLIGINQTDNPFVCTVIAILLHFFYMCTFAWMFVEGLHIYRMLTEMRNIN----QGHMRFYYAIGWGIPAIITGLAVGLDPQGYGNPDFCWLSVHDTLIWSFAGPIAVVVLVNVVIFIMAAKASCGRRQRSYEKS-----GAIPALRMAFLLLLLISATWLLGLMAVNSDVMIFHYLFAGFSCLQGILIFFFHCVLSKEVR 2735          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Cavefish
Match: celsr1a (cadherin EGF LAG seven-pass G-type receptor 1a [Source:ZFIN;Acc:ZDB-GENE-030616-78])

HSP 1 Score: 119.013 bits (297), Expect = 2.022e-26
Identity = 97/412 (23.54%), Postives = 188/412 (45.63%), Query Frame = 1
Query: 1933 QIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWIN-DCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALP--SYFGXXXXXXXXXXXXXXXXXXRT-SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKE---HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            +++R + Q    P   V   ++YR  G         ++  +R          IN+ I+   V  +G+ +       + L +   +    S   C+     F   +I       W +  C + +     + C CN +  F V  D+       K++  D+L L   +Y   S S +   I+ ++L  LR   S   SIHK+   A+   ++ ++ GI++ ++  +C + ++LLH+F++  F W+  E  ++Y ++T   + +     GHM  +Y +GW +PAI+     G++ + Y + + CW++  D  +W F GP   V++V++++ I  AK      + SY K+       I   +  +  ++L+S +W    + V    +I  YL+  F+ LQG     F+ +L+ EV+
Sbjct: 2321 EVQRSRRQAEGPPPFPVAAVIVYRSLGQLLPERFDPDRRSLRLPIRPV----INTPIVSTTVHSEGQPLSMPLERPITLDYTLLETEERSKPVCV-----FWNHSIAIGGTGGWSSKGCELVSRNKTHISCQCNHMTSFAVLMDI------SKREHGDVLPLKIVTYTTVSASLLALLITFILLAILRKLRSNLHSIHKNLVAALFFSELVFLIGINQTDNPFVCTVIAILLHFFYMCTFAWMFVEGLHIYRMLTEMRNIN----QGHMRFYYAIGWGIPAIITGLAVGLDPQGYGNPDFCWLSVHDTLIWSFAGPIAVVVLVNVVIFIMAAKASCGRRQRSYEKS-----GAIPALRMAFLLLLLISATWLLGLMAVNSDVMIFHYLFAGFSCLQGILIFFFHCVLSKEVR 2708          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Cavefish
Match: adgrl2a (adhesion G protein-coupled receptor L2 [Source:NCBI gene;Acc:103021986])

HSP 1 Score: 116.316 bits (290), Expect = 1.193e-25
Identity = 64/220 (29.09%), Postives = 121/220 (55.00%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCW--INHKDVWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+F + +   ++ ++ GID  E  I C I + +LHYFFL+ F W+  E   LY+++     S           +Y+ G+++PAI+V   + ++ ++Y +T  CW  +++  +W F GP   +I+++++ L+ T  +   H +S   +    + I + T   +  + L+SL+WSF    +    +++ YL+ +FN+ QG F  +FY LL  +V+  YS
Sbjct:  908 TIHKNFCINLFIAELIFLIGIDMTEPRIGCSIIAGILHYFFLASFAWMCLEGVQLYLMLVEVFESEYSRKK----YYYISGYLVPAIVVGVSAVVDYKSYGTTKACWLRVDNHFIWSFIGPVTFIIMLNLIFLVITMYKMVKHSTSLKPDSSRLENIKSWTLGAFALLCLVSLTWSFGLFFISETSVVLAYLFTIFNTFQGMFIFIFYCLLQKKVRREYS 1123          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Cavefish
Match: adgrl2a (adhesion G protein-coupled receptor L2 [Source:NCBI gene;Acc:103021986])

HSP 1 Score: 115.931 bits (289), Expect = 1.304e-25
Identity = 64/220 (29.09%), Postives = 121/220 (55.00%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCW--INHKDVWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+F + +   ++ ++ GID  E  I C I + +LHYFFL+ F W+  E   LY+++     S           +Y+ G+++PAI+V   + ++ ++Y +T  CW  +++  +W F GP   +I+++++ L+ T  +   H +S   +    + I + T   +  + L+SL+WSF    +    +++ YL+ +FN+ QG F  +FY LL  +V+  YS
Sbjct:  895 TIHKNFCINLFIAELIFLIGIDMTEPRIGCSIIAGILHYFFLASFAWMCLEGVQLYLMLVEVFESEYSRKK----YYYISGYLVPAIVVGVSAVVDYKSYGTTKACWLRVDNHFIWSFIGPVTFIIMLNLIFLVITMYKMVKHSTSLKPDSSRLENIKSWTLGAFALLCLVSLTWSFGLFFISETSVVLAYLFTIFNTFQGMFIFIFYCLLQKKVRREYS 1110          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Cavefish
Match: adgrl2a (adhesion G protein-coupled receptor L2 [Source:NCBI gene;Acc:103021986])

HSP 1 Score: 115.931 bits (289), Expect = 1.330e-25
Identity = 64/220 (29.09%), Postives = 121/220 (55.00%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCW--INHKDVWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+F + +   ++ ++ GID  E  I C I + +LHYFFL+ F W+  E   LY+++     S           +Y+ G+++PAI+V   + ++ ++Y +T  CW  +++  +W F GP   +I+++++ L+ T  +   H +S   +    + I + T   +  + L+SL+WSF    +    +++ YL+ +FN+ QG F  +FY LL  +V+  YS
Sbjct:  908 TIHKNFCINLFIAELIFLIGIDMTEPRIGCSIIAGILHYFFLASFAWMCLEGVQLYLMLVEVFESEYSRKK----YYYISGYLVPAIVVGVSAVVDYKSYGTTKACWLRVDNHFIWSFIGPVTFIIMLNLIFLVITMYKMVKHSTSLKPDSSRLENIKSWTLGAFALLCLVSLTWSFGLFFISETSVVLAYLFTIFNTFQGMFIFIFYCLLQKKVRREYS 1123          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009537.1 (pep scaffold:Pmarinus_7.0:GL477374:1106:43904:-1 gene:ENSPMAG00000008615.1 transcript:ENSPMAT00000009537.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 1.183e-16
Identity = 37/121 (30.58%), Postives = 67/121 (55.37%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGP 2862
            +IHK+  + +   +M ++ GIDK ++ I+C +F+ LLH+FFL+ F W+  E   LY+++     S           FY+ G+ +PA +V   + I+  +Y +  +CW+   +  +W F GP
Sbjct:  418 TIHKNLCINLFLAEMLFLLGIDKTQYTIVCSVFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRRK----YFYLFGYGLPAAVVGISTAIDYTSYGTAKVCWLRTDNHFIWSFLGP 534          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007615.1 (pep scaffold:Pmarinus_7.0:GL492778:1520:5295:-1 gene:ENSPMAG00000006882.1 transcript:ENSPMAT00000007615.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 2.660e-16
Identity = 32/120 (26.67%), Postives = 61/120 (50.83%), Query Frame = 1
Query: 2503 SSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGP 2862
            +S+H +    +   +  ++ G+ +  + ++CK+ +  LHYFFL+ FTW+  E   LY ++     S     D H+   Y +G+ +P ++V   S I   ++ +   CW++    W F GP
Sbjct:   46 NSVHANLCATLFIAEFIFLLGVHQTAYTVLCKVVAYFLHYFFLAAFTWMSLEGVCLYFMVVQVFQSR----DLHVRSLYAVGYGVPLVIVILTSAIAPGSHGTDTYCWLDKSIYWSFAGP 161          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002352.1 (pep scaffold:Pmarinus_7.0:GL476883:4338:91444:1 gene:ENSPMAG00000002137.1 transcript:ENSPMAT00000002352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 8.270e-16
Identity = 80/302 (26.49%), Postives = 150/302 (49.67%), Query Frame = 1
Query: 2317 ICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTS--SITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYST-NMCWINHKDVWL--FYGPXXXXXXXXXXXXXFT-AKEHHESSYTKNEKDNKAIINQTKAIWTQII---LLSLSWSFAFICVI-MQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASE 3192
            +C C K+  FTV   +  +   +K +P   L++    GCS+SS+   + + +   +  S  S  S I  +F ++II+  +  + G  + +++ +C + ++ LH+ FL+ F W++ EA+  Y+ +                RF  +GW +PA++VA   G  K + Y T N CW++ +   L  F GPA AV++V++++ I    K   +      E  ++A      ++W+  +   LL+L+W  A + +   +  + + L+ +F+SLQG      + +L  EVQ+    R     +LE SE
Sbjct:  451 LCQCGKISTFTV---LAQQAQAQKVEPVRTLSVALIVGCSISSLALMLLIFIYTLIWRSIKSDRSVILINFCLSIISSNILILVGQTQTQNKGVCTMIAVFLHFSFLATFCWVLTEAWQSYMAVRGVTMKRIIRK-----RFLCMGWGLPALVVATSVGFTKASGYGTANYCWLSLEGGLLYSFVGPAAAVVLVNMVLGILVFNKLVSKEGIPDKELKHRA----GSSLWSSCVVLPLLALTWMSAVLAITDPRSSLFQILFSVFDSLQGCVIFSVHCILKKEVQSAIKFRITG--RLEPSE 738          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004568.1 (pep scaffold:Pmarinus_7.0:GL476439:3807:37035:1 gene:ENSPMAG00000004154.1 transcript:ENSPMAT00000004568.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 1.711e-13
Identity = 62/229 (27.07%), Postives = 111/229 (48.47%), Query Frame = 1
Query: 2503 SSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGW--IMPAILVAAVSGINKENYYST-NMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKA-IWTQII---LLSLSWSFAFICVI-MQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNR 3159
            S I  +F ++II      + G  +  ++  C   +  LH+FFL+ F W++ EA+  Y+ +T    S          RF  LGW   +PA++VA   G  K   Y T   CW++     ++ F GPA  V++V++ + I    +      +K    +K + +  +A +W+  +   LL+L+W  A + +   +  + + L+ +F+SLQG   +V +  L  EVQ+    R
Sbjct:  278 SVILINFCVSIILSNSLIVAGQAQLNNKAFCTAIAAFLHFFFLASFCWVLTEAWQSYLAVTGQQRSKIVRK-----RFLCLGWDAGLPALIVAISVGFTKTKGYGTIQYCWLSLDGGLLYAFVGPAAGVVLVNMAICILVFNKL----VSKEGIPDKKLKHTARASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLQGIVIMVVHSFLRKEVQDALKCR 497          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002840.1 (pep scaffold:Pmarinus_7.0:GL476598:1950067:1997882:1 gene:ENSPMAG00000002582.1 transcript:ENSPMAT00000002840.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 4.742e-13
Identity = 68/261 (26.05%), Postives = 122/261 (46.74%), Query Frame = 1
Query: 2503 SSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYI-VITYAAHSHGDSTDGHMWRFYVLGW----IMPAILVAAVSGINKENYYST-NMCWINHKD--VWLFYGPXXXXXXXXXXXX-----XFTAKE--------HHESSYTKNE-----KDNKAII------------NQTKAIWTQII---LLSLSWSFAFICVI-MQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNR 3159
            S I  +F  +IIA  +  + G  + ++++ C I + LLH+FFL+ F W++ EA+  Y+ VI    H           RF  LGW     +PA++VA   G  K   Y T + CW++ +   ++ F GPA  V++V++++         +KE        H     T  +     K +K  +            N   ++W+  +   LL+L+W  A + +   +  + + L+ +F+SLQG   ++ + +L  EVQ+    R
Sbjct:   41 SVILINFCFSIIASNILIVVGQTQMQNKVACAIIAGLLHFFFLASFCWVLTEAWQSYMAVIGRLRHKIVRK------RFLCLGWGGFAGLPALVVAISIGFTKAKGYGTASYCWLSLEGGLLYAFVGPAAMVVLVNMVIGILVFNKLVSKEGIPDKRLKHRAGPMTLPQNGLTLKCSKCGVVSASALSTSTASNAMASLWSSCVVLPLLALTWMSAVLAITDRRSPLFQILFAVFDSLQGFVIVIVHCVLRKEVQDALKCR 295          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Nematostella
Match: EDO32467 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV16])

HSP 1 Score: 98.9821 bits (245), Expect = 1.491e-23
Identity = 55/187 (29.41%), Postives = 101/187 (54.01%), Query Frame = 1
Query: 2584 EIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEV 3138
            +++C+I +L+LHY F + FTW+  E F+LY+ I     + G         +Y+ GW  PAI+V   + ++   Y +   CW++     +W F GP +A+I+V+ ++L    K    SS +++E + + I+   K     + LL ++W F  + V  + ++ +Y++ + NSLQG    +F  + N EV
Sbjct:   15 QVLCRIVALMLHYLFSASFTWMCIEGFHLYMKIVTVFGAEGVKLK----YYYIFGWGFPAIMVGVAASVDSSGYGTRAACWLSMDKGFIWAFLGPVVAIILVNCVILSMVVKIVMTSSASQSEPEYRQILAGVKGALVLLPLLGITWVFGLLAVTKETVVFQYVFAISNSLQGFCIFIFQCIGNSEV 197          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Nematostella
Match: EDO45211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTG7])

HSP 1 Score: 102.064 bits (253), Expect = 8.333e-22
Identity = 66/236 (27.97%), Postives = 118/236 (50.00%), Query Frame = 1
Query: 2485 RTSSITSSIHKHFSMAIIAGQMSYMFG---IDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLY--IVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPXXX-----------XXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICV--IMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEV 3138
            R  + T +IHKHF++A I     ++     +D YE   +C    ++LHY FL+ F W++ E FNL+  +V  +        T   M  + +LGW+ PA++VA  +G+ +  Y   + CWI++K +W+F GP  A            I V I    +      E++ ++ EK+ +     T  +   + LL L+W   F      +  ++++Y + + NSLQG +F + + L +++V
Sbjct:  562 RRKTETMTIHKHFAIAQIFALTLFLVAYVAVDIYE---LCYAVVVMLHYSFLAVFLWMLIEGFNLHRGLVQVFL-------TSSRMKAYCLLGWLTPAVVVAITAGVTQGEYIRDDFCWISYKYIWVFAGPVAAIILINFVILVIAIRVMIRRSRYKINHMVENTMSEMEKELRIAFKTTIIL---MPLLGLTWCLGFFAAHDSVGSLVIQYAFAIINSLQGLYFFIAHCLYDEDV 784          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Nematostella
Match: EDO34537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP31])

HSP 1 Score: 95.9005 bits (237), Expect = 1.618e-21
Identity = 58/213 (27.23%), Postives = 107/213 (50.23%), Query Frame = 1
Query: 2509 IHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQ 3141
            IH +  +A+   Q+ ++ GI+   ++I C++ +  LHYF+   FTW++NE  +LY+ +           +  +  +Y+ GW  PA++V   + I   +Y + ++CW++  D  VW F GP   +I ++ L+LI   K    S+ T    D+  I    K     + LL +SW    + V    +  +Y++ + NS QG    + + + N EV+
Sbjct:   80 IHLNLVLALFLAQILFLSGINATGNKIGCQVVAAFLHYFYTVAFTWMLNEGVHLYLKVVKVFRIE----NVRLLHYYIFGWGFPAVIVGISAAIKPNSYGTESICWLSLSDDFVWAFIGPVTFIIAINCLILIVVVKTIVNSASTVKNSDHAHIRAGVKGALVLMPLLGVSWISGLLAVNKDTVFFQYVFAITNSFQGFLIFLLHVVFNTEVR 288          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Nematostella
Match: EDO32453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV04])

HSP 1 Score: 96.6709 bits (239), Expect = 2.750e-20
Identity = 70/237 (29.54%), Postives = 121/237 (51.05%), Query Frame = 1
Query: 2488 TSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLY--IVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNE----KDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEER 3174
            TS++   IH    +++   Q +++ GI    +++ C I ++ LHYF+ + F+W+  E F+LY  IVI Y      +        ++  GW  P I+V   S +N E Y +   CW++ +    W+F GP   V+++  + L    K  H     +N+    K N  + +  K +   + LL L+W F  +CV  Q I+ +Y++ + NSLQGAF  +  Y  N EV++  S R++ +R
Sbjct:  598 TSTLRYKIHMQLCISLAVSQAAFLLGIAAIRYKVACMITAMSLHYFYTAAFSWMFLEGFHLYMKIVIAY------EKKAIKQLYYFCFGWGFPFIIVGISSAVNSEGYGTEAGCWLSLERGFRWVFIGP---VLIILAINLCIMIKVLHIMMVLQNDPLKKKKNSRLSSLAKGLAVLLPLLGLTWLFGVLCVNSQTIVFQYIFAVLNSLQGAFIFLLNYAGNREVRS--SFRQSLQR 823          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 97.0561 bits (240), Expect = 3.815e-20
Identity = 173/749 (23.10%), Postives = 298/749 (39.79%), Query Frame = 1
Query: 1015 GIKVSSCTDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTRMVDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQD---LATKCFLNDLHLIEGLSIFANLTDKFNINNAIDLSL-CIDILDVFTELKENQESKCPSFMIERFQKREEIHQNQYTTIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFYQVTTVNVNNLINKYFYMPREMEIFIN-----NPNIILKLKAFRWSDFKGTAFPDS-DDLKELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGR---------------KIDQVKSNSL--KLHF-FYKDYSNISNTNCLSVSGDFRERNIHATSRSEW-INDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRT--SSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXX--XFTAKEHHESS---YTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNI 3147
            G +   C D  + I T    C   I   C   I  +I W+R   + T    CP        S  + R+ D              K   W+ P++  C+S+++  L  K K L++   L +     DL     L+I   L  +   N+ ID++L  I +L  F    +  ES   S       K  E  Q       ++++ A+ L +A+N   W+  +        L+  +  F      N+ +L    +   R +E  I       PNI+++L      +F G  FP S D  +  +++           +T   ++ R    +  +P H        + +G+     +   Q+  R  AV +   R   D++    S D R               K+  ++   L   +H  FY    N S   C+     F   ++  T    W  N C    +      C CN +  F V +D+  E      Q    L + +Y G +VS  +  I+ +  + LR    S  + IHK+   AI+  ++ ++ GI++      C++ ++LLHYFF + FTW++ E  ++Y  ++       +   G M  +Y LGW  PAI+V   +G++ E Y + + CW+      +W F  P + V+ VS +     FT   H   +   Y       +A +  +  +   + LL +S  FA + V     +  YL+    + QG F  +FY L + +V  I
Sbjct: 1811 GRRCDRCEDHQSEI-TAGKGCVV-INTSCPRSIAEDIWWKRGAFDKTAEQKCPFG-----ASGTARRICD--------------KNKGWQKPDLMDCVSNSFLNLRKKLKRLEEGKLLWSPSIAMDLARQLDLAI--TLATRLYPND-IDIALKAITVL--FDYESQQNESTLVS------AKNHEFAQ-------ILVQSASMLFNAENKNVWSVVQRNSAGTADLMEKMENFSGTLANNLAHLKRARYR--RNVESIIPPYTVITPNILMELHPVTIRNFNGMQFPPSPDSFESYSWQWAE--------VTNKVKLPR---ALFLSPGHKG-----EKPSGIKK-DCIIDSQVLERNAAVGYMIIRNIGDLL--PKSFDARIRYYNVDVNSDVVSVKMPGMEDVQLAEPIHITFYNRQVNRSEYLCV-----FWNYSVPNTRGGGWSTNGCRRIAINWTHTTCACNHMTSFAVLSDLNLEF---PPQVAFALRIGTYIGIAVSVAILLIAFVSFVCLRGLKKSNANDIHKNLVAAIVIAEIIFLAGINRTNDTTACRLVAILLHYFFSTVFTWMLVEGVHMYRRLS----EKRNIDTGRMNFYYFLGWGCPAIVVGISAGLSTEGYGNNHFCWMATDGTLIWTFTIPVMIVVAVSSMERFFFFTLPSHETFTCYFYLLMRSLYRAGMRASAVV---LPLLGVSLVFAILMVNKDMEMFHYLFAALTAFQGLFIFLFYCLFDKKVSFI 2484          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Medaka
Match: adgrl3.1 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101166443])

HSP 1 Score: 113.62 bits (283), Expect = 6.799e-25
Identity = 64/220 (29.09%), Postives = 118/220 (53.64%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   +  ++ GI+K +  I+C +F+ LLH+FFL+ FTW+  E   LYI++     S    T      FY+ G+ +PAI+VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     +  HH +    +      I +        + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  948 TIHKNLCISLFIAESLFLVGINKADQPIVCAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRTK----YFYLAGYGVPAIIVAVSAAVDYRSYGTDRVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCILQKKVRKEYG 1163          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Medaka
Match: adgrl3.1 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101166443])

HSP 1 Score: 113.62 bits (283), Expect = 7.366e-25
Identity = 64/220 (29.09%), Postives = 118/220 (53.64%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   +  ++ GI+K +  I+C +F+ LLH+FFL+ FTW+  E   LYI++     S    T      FY+ G+ +PAI+VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     +  HH +    +      I +        + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  961 TIHKNLCISLFIAESLFLVGINKADQPIVCAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRTK----YFYLAGYGVPAIIVAVSAAVDYRSYGTDRVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCILQKKVRKEYG 1176          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Medaka
Match: adgrl3.1 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101166443])

HSP 1 Score: 113.235 bits (282), Expect = 7.681e-25
Identity = 64/220 (29.09%), Postives = 118/220 (53.64%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   +  ++ GI+K +  I+C +F+ LLH+FFL+ FTW+  E   LYI++     S    T      FY+ G+ +PAI+VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     +  HH +    +      I +        + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  885 TIHKNLCISLFIAESLFLVGINKADQPIVCAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRTK----YFYLAGYGVPAIIVAVSAAVDYRSYGTDRVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCILQKKVRKEYG 1100          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Medaka
Match: adgrl3.1 (adhesion G protein-coupled receptor L3 [Source:NCBI gene;Acc:101166443])

HSP 1 Score: 113.62 bits (283), Expect = 7.913e-25
Identity = 64/220 (29.09%), Postives = 118/220 (53.64%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  +++   +  ++ GI+K +  I+C +F+ LLH+FFL+ FTW+  E   LYI++     S    T      FY+ G+ +PAI+VA  + ++  +Y +  +CW+      +W F GPA  +I+++++ L     +  HH +    +      I +        + LL L+W+F  + +    +I+ YL+ +FNSLQG F  +F+ +L  +V+  Y 
Sbjct:  961 TIHKNLCISLFIAESLFLVGINKADQPIVCAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRTK----YFYLAGYGVPAIIVAVSAAVDYRSYGTDRVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCILQKKVRKEYG 1176          
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Medaka
Match: adgrl2a (adhesion G protein-coupled receptor L2 [Source:NCBI gene;Acc:101174337])

HSP 1 Score: 112.849 bits (281), Expect = 1.365e-24
Identity = 62/220 (28.18%), Postives = 117/220 (53.18%), Query Frame = 1
Query: 2506 SIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCW--INHKDVWLFYGPXXXXXXXXXXXXXFTAKE--HHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYS 3153
            +IHK+  + +   ++ ++ GID  EH I C I + +LH+FFL+ F+W+  E   LY+++     S           +YV G++ PAI+V   + I+  +Y +   CW  +++  +W F GP   +I+++++ L+ T  +   H ++   +    + I +     +  + LL L+WSF    +    I++ YL+ +FN+ QG F  +F+ LL  +V+  YS
Sbjct:  888 TIHKNLCLNLFIAELIFLIGIDMTEHRIGCAIIAGILHFFFLASFSWMCLEGVQLYLMLVEVFESEYSRKK----YYYVSGYLFPAIVVGVSAAIDYRSYGTEKACWLRVDNHFIWSFIGPVTFIIMLNLIFLVITMYKMVKHSTTLKPDSSRLENIKSWVMGAFALLCLLGLTWSFGLFFISEASIVMAYLFTIFNTFQGMFIFIFHCLLQKKVRKEYS 1103          
BLAST of adhesion G protein-coupled receptor L2-like vs. Planmine SMEST
Match: SMESG000058907.1 (SMESG000058907.1)

HSP 1 Score: 2152.48 bits (5576), Expect = 0.000e+0
Identity = 1068/1072 (99.63%), Postives = 1072/1072 (100.00%), Query Frame = 1
Query:  232 MIWILCFGFILQIVQPLSQNECHSTYYNDPQCIDQPGGYYCNCGPGFKWNSNQCIAAGIDSKMAFQSVNSSFTVLDRQNLPKEFTISFWVRPLTAGVIFSLVHDHMMNENSSQVMISIDHSTHKSFTIIFRYLTKEWITDMIIVQNKWTHIIWSQQVIDHQSVKWKGYINDVKYEKVEFFSSDVLKGEMILGQLSRLFKSLSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYGTRGNLQLKWPSGIKVSSCTDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTRMVDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQDLATKCFLNDLHLIEGLSIFANLTDKFNINNAIDLSLCIDILDVFTELKENQESKCPSFMIERFQKREEIHQNQYTTIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFYQVTTVNVNNLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLKELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWINDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGXXXXXXXXXXXXXXXXXXRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASEQGEDGLHDIPYICYNDAFPNNDQLIEATKTNDNNDARNGKNERRKRFFSNVIENFNIRTKKSQSKDDIGDRSNTDNSDYELITSV 3447
            MIWILCFGFILQIVQPLSQNECHSTYYNDPQCIDQPGGYYCNCGPGFKWNSNQCIAAGIDSKMAFQSVNSSFTVLDRQNLPKEFTISFWVRPLTAGVIFSLVHDHMMNENSSQVMISIDHSTHKSFTIIFRYLTK+WITDM+IVQNKWTHIIWSQQVIDHQSVKWKGYINDVKYEKVEFFSSDVLKGEMILGQLSRLFKSLSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYGTRGNLQLKWPSGIKVSSCTDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTR+VDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQDLATKCFLNDLHLIEGLSIFANLTDKFNINNAIDLSLCIDILDVFTELKENQESKCPSFMIERFQKREEIHQNQYTTIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFYQVTTVNVNNLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLKELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWINDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGCSVSSMLCSISLLMLIYLRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPAIAVIVVSILVLIFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASEQGEDGLHDIPYICYNDAFPNNDQLIEATKTNDNNDARNGKNERRKRFFSNVIENFNIRT+KSQSKDDIGDRSNTDNSDYELITSV
Sbjct:    1 MIWILCFGFILQIVQPLSQNECHSTYYNDPQCIDQPGGYYCNCGPGFKWNSNQCIAAGIDSKMAFQSVNSSFTVLDRQNLPKEFTISFWVRPLTAGVIFSLVHDHMMNENSSQVMISIDHSTHKSFTIIFRYLTKDWITDMVIVQNKWTHIIWSQQVIDHQSVKWKGYINDVKYEKVEFFSSDVLKGEMILGQLSRLFKSLSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYGTRGNLQLKWPSGIKVSSCTDVNTLIRTCDSSCSKRIGAQCKVDITANIEWERSKANTTIYSPCPMPKQLKLVSDNSTRLVDSRPKITRYCEETSLKLGKWKDPNVTACLSSAWNILLLKKKELQDLATKCFLNDLHLIEGLSIFANLTDKFNINNAIDLSLCIDILDVFTELKENQESKCPSFMIERFQKREEIHQNQYTTIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFYQVTTVNVNNLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLKELTYEQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHSVSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFYKDYSNISNTNCLSVSGDFRERNIHATSRSEWINDCAMENMKVDSVICLCNKLGVFTVATDMFNELWKKKKQPNDLLALPSYFGCSVSSMLCSISLLMLIYLRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKDVWLFYGPAIAVIVVSILVLIFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASEQGEDGLHDIPYICYNDAFPNNDQLIEATKTNDNNDARNGKNERRKRFFSNVIENFNIRTRKSQSKDDIGDRSNTDNSDYELITSV 1072          
BLAST of adhesion G protein-coupled receptor L2-like vs. Planmine SMEST
Match: SMESG000024001.1 (SMESG000024001.1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.295e-16
Identity = 60/211 (28.44%), Postives = 105/211 (49.76%), Query Frame = 1
Query: 2509 IHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFLSCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAVSGINKENYYSTNMCWINHKD--VWLFYGPXXXXXXXXXXXXXFTAKEHHESSYTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLFNSLQGAFFIVFYYLLNDE 3135
            IH + S+++    ++++  I    ++  C+   + +H FF S FTW+  EA  ++  IT    +      G +  ++ + W +P I+VA  +G N + Y     CW+   D  +W F GP IA I+ +ILV +  A   +  +  K E  ++A  N  +   T I L+ + W F  I +    I   Y + +F SLQG + ++FY L+N +
Sbjct: 1923 IHLNMSISLFIASLAFILVIPGQMNQKFCQTVGITMHLFFTSTFTWMFFEALYVFYAITSGVIA------GRLKYYFPIAWGIPIIIVAKTAGSNVDAYGRNTFCWLTLIDNNLWSFLGPIIAFIICTILVCLIVACNINTPA-IKGEILDEARGNIVQTACT-ISLMLIGWIFVAIFMATSIIPTAYFFAIFGSLQGLWVLIFYGLMNPD 2125          
The following BLAST results are available for this feature:
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CELSR13.973e-2630.14cadherin EGF LAG seven-pass G-type receptor 1 [Sou... [more]
ADGRL31.739e-2529.44adhesion G protein-coupled receptor L3 [Source:HGN... [more]
ADGRL31.837e-2529.44adhesion G protein-coupled receptor L3 [Source:HGN... [more]
ADGRL31.844e-2529.44adhesion G protein-coupled receptor L3 [Source:HGN... [more]
ADGRL31.847e-2529.44adhesion G protein-coupled receptor L3 [Source:HGN... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lat-23.324e-2123.25Latrophilin-like protein LAT-2 [Source:UniProtKB/... [more]
lat-23.414e-2025.57Latrophilin-like protein LAT-2 [Source:UniProtKB/... [more]
lat-13.166e-1723.64Latrophilin-like protein 1 [Source:UniProtKB/Swis... [more]
lat-13.443e-1723.64Latrophilin-like protein 1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan1.607e-1026.84gene:FBgn0024836 transcript:FBtr0304899[more]
stan1.607e-1026.84gene:FBgn0024836 transcript:FBtr0300578[more]
stan1.607e-1026.84gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.607e-1026.84gene:FBgn0024836 transcript:FBtr0303223[more]
stan1.607e-1026.84gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celsr35.898e-3026.51cadherin, EGF LAG seven-pass G-type receptor 3 [So... [more]
celsr32.646e-2926.74cadherin, EGF LAG seven-pass G-type receptor 3 [So... [more]
ADGRL32.537e-2429.28adhesion G protein-coupled receptor L3 [Source:HGN... [more]
celsr1b3.857e-2221.35cadherin EGF LAG seven-pass G-type receptor 1b [So... [more]
adgrd14.157e-2226.26adhesion G protein-coupled receptor D1 [Source:ZFI... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brinp17.816e-3125.17bone morphogenetic protein/retinoic acid inducible... [more]
brinp14.957e-3024.94bone morphogenetic protein/retinoic acid inducible... [more]
brinp15.041e-3024.94bone morphogenetic protein/retinoic acid inducible... [more]
brinp15.764e-3024.94bone morphogenetic protein/retinoic acid inducible... [more]
brinp11.089e-2924.71bone morphogenetic protein/retinoic acid inducible... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adgrl31.153e-2529.44adhesion G protein-coupled receptor L3 [Source:MGI... [more]
Adgrl31.153e-2529.44adhesion G protein-coupled receptor L3 [Source:MGI... [more]
Adgrl31.195e-2529.44adhesion G protein-coupled receptor L3 [Source:MGI... [more]
Adgrl31.216e-2529.44adhesion G protein-coupled receptor L3 [Source:MGI... [more]
Adgrl31.277e-2529.44adhesion G protein-coupled receptor L3 [Source:MGI... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NYQ6|CELR1_HUMAN1.908e-2530.14Cadherin EGF LAG seven-pass G-type receptor 1 OS=H... [more]
sp|Q80TS3|AGRL3_MOUSE7.985e-2529.44Adhesion G protein-coupled receptor L3 OS=Mus musc... [more]
sp|Q9Z173|AGRL3_RAT8.437e-2529.44Adhesion G protein-coupled receptor L3 OS=Rattus n... [more]
sp|O97827|AGRL3_BOVIN1.000e-2429.44Adhesion G protein-coupled receptor L3 OS=Bos taur... [more]
sp|Q9HAR2|AGRL3_HUMAN2.294e-2430.67Adhesion G protein-coupled receptor L3 OS=Homo sap... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GSB60.000e+035.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E1P22.178e-18035.76Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IDD01.364e-16634.04G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A1S3KGL32.176e-16335.01adhesion G protein-coupled receptor L2-like OS=Lin... [more]
A0A210QKY16.618e-15332.08Cadherin EGF LAG seven-pass G-type receptor 1 OS=M... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celsr1a2.007e-2623.54cadherin EGF LAG seven-pass G-type receptor 1a [So... [more]
celsr1a2.022e-2623.54cadherin EGF LAG seven-pass G-type receptor 1a [So... [more]
adgrl2a1.193e-2529.09adhesion G protein-coupled receptor L2 [Source:NCB... [more]
adgrl2a1.304e-2529.09adhesion G protein-coupled receptor L2 [Source:NCB... [more]
adgrl2a1.330e-2529.09adhesion G protein-coupled receptor L2 [Source:NCB... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009537.11.183e-1630.58pep scaffold:Pmarinus_7.0:GL477374:1106:43904:-1 g... [more]
ENSPMAT00000007615.12.660e-1626.67pep scaffold:Pmarinus_7.0:GL492778:1520:5295:-1 ge... [more]
ENSPMAT00000002352.18.270e-1626.49pep scaffold:Pmarinus_7.0:GL476883:4338:91444:1 ge... [more]
ENSPMAT00000004568.11.711e-1327.07pep scaffold:Pmarinus_7.0:GL476439:3807:37035:1 ge... [more]
ENSPMAT00000002840.14.742e-1326.05pep scaffold:Pmarinus_7.0:GL476598:1950067:1997882... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO324671.491e-2329.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452118.333e-2227.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345371.618e-2127.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324532.750e-2029.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482373.815e-2023.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adgrl3.16.799e-2529.09adhesion G protein-coupled receptor L3 [Source:NCB... [more]
adgrl3.17.366e-2529.09adhesion G protein-coupled receptor L3 [Source:NCB... [more]
adgrl3.17.681e-2529.09adhesion G protein-coupled receptor L3 [Source:NCB... [more]
adgrl3.17.913e-2529.09adhesion G protein-coupled receptor L3 [Source:NCB... [more]
adgrl2a1.365e-2428.18adhesion G protein-coupled receptor L2 [Source:NCB... [more]
back to top
BLAST of adhesion G protein-coupled receptor L2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000058907.10.000e+099.63SMESG000058907.1[more]
SMESG000024001.17.295e-1628.44SMESG000024001.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015266 ID=SMED30015266|Name=adhesion G protein-coupled receptor L2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3625bp
AAATAAACCATTTCTAAAATAATATATTCATGTTAATCTACTTATAGATT
TGTAAGTAGATTTTGTACATCAGTTTTAATGGGATTCACCTGATTCATTC
CTCGAAGAAATACTCAATTTTAATTGGTCTCTATCTCTACAGCTCTGTTC
TCAATTTACAATTTCTTTTCTCAGTTTGATGTAGGGTAAAGAAATTTTAT
GTTTTGACTTTGTAAAAACCGCTTTGGAATCATGATATGGATTTTATGTT
TCGGATTTATTCTACAGATTGTGCAACCTCTTTCACAAAATGAATGTCAT
TCAACATATTACAACGACCCACAGTGTATTGACCAACCGGGTGGATATTA
TTGCAACTGCGGTCCAGGATTCAAATGGAATTCGAATCAGTGTATTGCTG
CTGGCATCGATTCAAAAATGGCATTTCAATCTGTCAATTCCAGCTTTACA
GTCCTCGATCGGCAAAATCTACCGAAGGAATTCACAATATCTTTTTGGGT
GCGTCCACTTACTGCTGGGGTTATATTTTCACTAGTCCATGACCACATGA
TGAATGAAAATTCCAGCCAGGTGATGATTAGTATTGACCATAGCACCCAT
AAATCGTTCACTATAATCTTCCGGTATCTAACAAAAGAATGGATCACTGA
TATGATTATTGTACAAAACAAATGGACTCACATTATCTGGTCGCAACAAG
TAATAGATCATCAGTCTGTTAAATGGAAAGGATATATCAACGATGTCAAG
TATGAAAAGGTTGAATTCTTTTCATCAGACGTCCTTAAGGGAGAAATGAT
TCTCGGACAATTATCCAGATTATTTAAAAGTTTATCAAAAGATTACGGAT
TTTCCGGATTTTTAGCACATTTTAATGTTTGGAATTACAGTTTGAAAGAC
GATGAGTGTAGATCTTTGTATCAAGATTGCATTTATAATTTTTGCGGAAA
CATCGTTCAATGGTCAGATTTTAGGTATGGCACTCGGGGCAATCTTCAAT
TAAAATGGCCATCGGGAATAAAAGTTAGTTCATGCACCGATGTTAATACG
CTAATTCGTACATGTGATTCGTCATGCAGCAAACGAATCGGTGCTCAGTG
CAAAGTCGATATCACAGCTAATATTGAATGGGAGCGTTCGAAGGCCAACA
CTACAATTTACAGTCCATGCCCTATGCCGAAGCAATTAAAACTTGTGAGT
GATAATTCAACTCGGATGGTTGACTCAAGACCAAAAATCACTCGATATTG
TGAAGAAACCTCTTTAAAATTAGGCAAGTGGAAAGACCCTAATGTCACTG
CTTGCCTTTCTTCGGCTTGGAATATTCTTTTACTTAAGAAAAAAGAATTA
CAAGACTTAGCCACGAAGTGCTTTCTGAATGATTTGCATTTGATTGAAGG
GTTGTCAATATTTGCCAATCTCACAGACAAATTCAATATCAACAACGCAA
TTGATCTCAGCCTTTGCATTGACATTCTTGACGTATTCACGGAGTTGAAA
GAGAACCAAGAATCAAAATGTCCATCGTTCATGATCGAGAGATTCCAGAA
AAGAGAAGAAATTCATCAAAACCAATACACAACAATAAAACTGGTTTTGA
GAATTGCAAATAATTTATTGGATGCCAAAAACATAGCAGCGTGGAACTAC
ACCAGACCGTGTGGATTTGAAGGAAGAAAGTTATTAGGAGTTCTCAACAA
GTTTTATCAAGTGACAACAGTCAACGTTAATAATCTGATAAATAAGTACT
TCTATATGCCACGGGAAATGGAAATATTTATCAACAATCCAAACATCATA
TTAAAATTAAAGGCTTTTCGATGGTCGGATTTCAAAGGCACTGCATTTCC
GGACTCGGATGATCTCAAGGAATTGACATATGAACAAATAAATTCTAATG
AAATAGCTACTATAGCACTCACAAAAGACTTTCAAATTGAAAGAGACCAA
TTGCAAGTTTCACAGAATCCAAAACATATTGTGATTATAACGGTCATTTA
TCGCAAGGCTGGGTTGAATGCTGCGCATTCCGTCAGCCAAGAACAGATGA
AAATGAGGACTGGCGCTGTCTCTTTTTGGAATCAGAGGATCAATTCTGAT
ATAATAGATATCGCAGTTTCTATTGATGGCAGGAAAATTGATCAAGTCAA
ATCTAATTCATTGAAACTTCATTTCTTTTACAAAGATTATTCAAACATTT
CCAATACAAATTGTCTTTCTGTATCCGGTGACTTCAGGGAAAGAAATATC
CACGCAACAAGCCGATCTGAGTGGATTAATGATTGCGCAATGGAAAATAT
GAAAGTTGATTCTGTAATTTGTCTATGTAACAAGTTGGGAGTATTTACTG
TTGCTACAGACATGTTCAATGAACTTTGGAAGAAAAAGAAACAGCCAAAT
GATCTGCTTGCCCTGCCTTCATATTTCGGATGCTCAGTTTCATCAATGTT
ATGCTCAATATCACTGTTGATGCTCATTTATTTAAGAACGTCTTCGATTA
CATCTTCGATACACAAGCATTTCTCGATGGCAATAATTGCTGGACAGATG
TCATACATGTTCGGCATAGACAAGTATGAGCATGAGATAATTTGTAAAAT
ATTCTCACTATTGCTACACTATTTCTTTTTATCGTGTTTTACATGGCTAA
TGAATGAAGCTTTCAATTTGTATATTGTTATCACATATGCCGCTCACAGT
CATGGAGATTCCACTGATGGTCACATGTGGCGATTTTATGTACTCGGATG
GATAATGCCAGCCATATTGGTAGCTGCGGTTTCTGGAATAAACAAGGAAA
ATTATTATTCCACAAATATGTGTTGGATAAATCATAAAGATGTTTGGCTG
TTCTATGGACCTGCGATTGCAGTGATAGTAGTTTCGATTTTAGTTCTCAT
TTTTACAGCCAAGGAGCATCACGAGAGTTCTTATACAAAAAATGAGAAAG
ATAATAAAGCAATAATAAATCAAACCAAAGCTATTTGGACTCAGATCATT
CTCCTGAGTCTTTCATGGTCATTTGCATTTATTTGTGTCATCATGCAAGG
AATCATTGTTAAATATCTCTATGGACTTTTCAATAGTCTTCAAGGAGCGT
TTTTTATCGTTTTTTATTATCTTCTTAATGACGAGGTTCAAAATATTTAT
TCTAACAGAAAAAACGAAGAAAGAAAGCTTGAAGCTTCGGAACAGGGTGA
GGATGGGTTACATGACATTCCATATATTTGCTATAATGATGCATTCCCTA
ACAATGACCAGCTCATAGAAGCAACCAAGACAAATGACAACAATGATGCC
CGAAATGGCAAGAATGAGAGGCGAAAAAGATTTTTTTCCAACGTCATTGA
AAATTTTAACATCAGAACAAAGAAGTCTCAGAGTAAAGACGATATCGGTG
ATCGGAGCAATACTGATAATTCCGATTATGAACTGATTACGTCGGTTTAA
TGAGTTCTGATCAGGTTTTTAGTTTTATGATTAGATGAATCAATTTTTGT
TTTTTTTGTTTTAATCATTTATTAACGGGAAATATTTTGATGCACTTTGA
TTGTTAAAAATGCGGGTTTTTATCTATTTGTGTGATCTTGATATTTAATA
GTGTTAATTTCTAATTTTATAGCGA
back to top

protein sequence of SMED30015266-orf-1

>SMED30015266-orf-1 ID=SMED30015266-orf-1|Name=SMED30015266-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1073bp
MIWILCFGFILQIVQPLSQNECHSTYYNDPQCIDQPGGYYCNCGPGFKWN
SNQCIAAGIDSKMAFQSVNSSFTVLDRQNLPKEFTISFWVRPLTAGVIFS
LVHDHMMNENSSQVMISIDHSTHKSFTIIFRYLTKEWITDMIIVQNKWTH
IIWSQQVIDHQSVKWKGYINDVKYEKVEFFSSDVLKGEMILGQLSRLFKS
LSKDYGFSGFLAHFNVWNYSLKDDECRSLYQDCIYNFCGNIVQWSDFRYG
TRGNLQLKWPSGIKVSSCTDVNTLIRTCDSSCSKRIGAQCKVDITANIEW
ERSKANTTIYSPCPMPKQLKLVSDNSTRMVDSRPKITRYCEETSLKLGKW
KDPNVTACLSSAWNILLLKKKELQDLATKCFLNDLHLIEGLSIFANLTDK
FNINNAIDLSLCIDILDVFTELKENQESKCPSFMIERFQKREEIHQNQYT
TIKLVLRIANNLLDAKNIAAWNYTRPCGFEGRKLLGVLNKFYQVTTVNVN
NLINKYFYMPREMEIFINNPNIILKLKAFRWSDFKGTAFPDSDDLKELTY
EQINSNEIATIALTKDFQIERDQLQVSQNPKHIVIITVIYRKAGLNAAHS
VSQEQMKMRTGAVSFWNQRINSDIIDIAVSIDGRKIDQVKSNSLKLHFFY
KDYSNISNTNCLSVSGDFRERNIHATSRSEWINDCAMENMKVDSVICLCN
KLGVFTVATDMFNELWKKKKQPNDLLALPSYFGCSVSSMLCSISLLMLIY
LRTSSITSSIHKHFSMAIIAGQMSYMFGIDKYEHEIICKIFSLLLHYFFL
SCFTWLMNEAFNLYIVITYAAHSHGDSTDGHMWRFYVLGWIMPAILVAAV
SGINKENYYSTNMCWINHKDVWLFYGPAIAVIVVSILVLIFTAKEHHESS
YTKNEKDNKAIINQTKAIWTQIILLSLSWSFAFICVIMQGIIVKYLYGLF
NSLQGAFFIVFYYLLNDEVQNIYSNRKNEERKLEASEQGEDGLHDIPYIC
YNDAFPNNDQLIEATKTNDNNDARNGKNERRKRFFSNVIENFNIRTKKSQ
SKDDIGDRSNTDNSDYELITSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032471GAIN_dom_N
IPR000832GPCR_2_secretin-like
IPR013320ConA-like_dom_sf
IPR013032EGF-like_CS
IPR001879GPCR_2_extracellular_dom
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO:0007165signal transduction
GO:0007420brain development
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0043005neuron projection
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
GO:0004871signal transducer activity
GO:0030165PDZ domain binding
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 790..813
score: 24.72
coord: 872..897
score: 19.49
coord: 728..752
score: 23.8
coord: 944..965
score: 29.74
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 726..957
e-value: 2.5E-33
score: 115.4
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 717..992
e-value: 3.0E-54
score: 186.1
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 60..259
e-value: 5.4E-21
score: 77.2
NoneNo IPR availablePFAMPF13385Laminin_G_3coord: 77..225
e-value: 3.9E-9
score: 36.8
NoneNo IPR availableGENE3DG3DSA:2.60.220.50coord: 513..716
e-value: 3.9E-5
score: 25.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1049..1072
NoneNo IPR availablePANTHERPTHR12011G-PROTEIN COUPLED RECEPTORcoord: 332..1052
NoneNo IPR availableCDDcd00054EGF_CAcoord: 20..47
e-value: 7.68023E-5
score: 38.7718
NoneNo IPR availableCDDcd150407tmB2_Adhesioncoord: 730..973
e-value: 1.1024E-50
score: 177.38
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.795
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 19..56
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 769..970
NoneNo IPR availableTMHMMTMhelixcoord: 917..936
NoneNo IPR availableTMHMMTMhelixcoord: 729..751
NoneNo IPR availableTMHMMTMhelixcoord: 943..965
NoneNo IPR availableTMHMMTMhelixcoord: 871..893
NoneNo IPR availableTMHMMTMhelixcoord: 795..817
NoneNo IPR availableTMHMMTMhelixcoord: 832..854
IPR032471GAIN domain, N-terminalPFAMPF16489GAINcoord: 407..629
e-value: 2.6E-6
score: 27.0
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 41..54
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 724..966
score: 25.882
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 277..362
score: 10.031
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 62..256