Mitochondrial inner membrane protein OXA1L

Overview
NameMitochondrial inner membrane protein OXA1L
Smed IDSMED30015252
Length (bp)7877
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial inner membrane protein OXA1L (SMED30015252) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial inner membrane protein OXA1L (SMED30015252) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial inner membrane protein OXA1L (SMED30015252) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial inner membrane protein OXA1L (SMED30015252) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015252

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015252SMESG000039158.1 SmedASXL_008039SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015252SMESG000039158.1 SmedASXL_008039SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30015252SMESG000039158.1 dd_Smed_v4_4072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015252SMESG000039158.1 dd_Smed_v4_4072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015252SMESG000039158.1 dd_Smed_v4_4072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015252SMESG000039158.1 dd_Smed_v4_4072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30015252SMESG000039158.1 dd_Smed_v4_4072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015252SMESG000039158.1 dd_Smed_v4_4072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Fly
Match: OXA1L (gene:FBgn0027615 transcript:FBtr0076271)

HSP 1 Score: 79.337 bits (194), Expect = 1.845e-14
Identity = 44/131 (33.59%), Postives = 70/131 (53.44%), Query Frame = 1
Query: 7477 VGADVKK--NTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRLGLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKARTSSIPKTYKYDPTKV 7863
            +G D  +    N   +K+ +R+LPIV   FT   P+A+L YW  S+ +SL    ++ IP V+    +  +   AP+A   K G++   KES    +I+K  ++   L+   + KA    + KTYK+DPTKV
Sbjct:  291 IGTDSARLSAANMNTMKYVLRALPIVIFPFTMNFPAAILTYWACSNFISLGQVAVLRIPSVREYFKIEKMLTHAPSALPPKKGFVGGMKESWDNMKISKEIEERQRLDEIRFAKAGKGPLVKTYKFDPTKV 421          
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Fly
Match: OXA1L (gene:FBgn0027615 transcript:FBtr0076272)

HSP 1 Score: 79.337 bits (194), Expect = 1.845e-14
Identity = 44/131 (33.59%), Postives = 70/131 (53.44%), Query Frame = 1
Query: 7477 VGADVKK--NTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRLGLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKARTSSIPKTYKYDPTKV 7863
            +G D  +    N   +K+ +R+LPIV   FT   P+A+L YW  S+ +SL    ++ IP V+    +  +   AP+A   K G++   KES    +I+K  ++   L+   + KA    + KTYK+DPTKV
Sbjct:  291 IGTDSARLSAANMNTMKYVLRALPIVIFPFTMNFPAAILTYWACSNFISLGQVAVLRIPSVREYFKIEKMLTHAPSALPPKKGFVGGMKESWDNMKISKEIEERQRLDEIRFAKAGKGPLVKTYKFDPTKV 421          
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Mouse
Match: Oxa1l (oxidase assembly 1-like [Source:MGI Symbol;Acc:MGI:1916339])

HSP 1 Score: 50.8322 bits (120), Expect = 1.118e-6
Identity = 27/77 (35.06%), Postives = 41/77 (53.25%), Query Frame = 1
Query: 7528 IRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRLGLSALSYQAPTATDSKLGYLQNFKES--NAE 7752
            IR +P+V L  T   PSA+ +YW +S+  SL     + IP V+T L +       P     + G+L++FK+   NAE
Sbjct:    5 IRVMPLVVLPVTIHFPSAVFMYWLSSNVFSLCQVACLRIPAVRTVLKIPQRVVHDPDKLPPREGFLKSFKKGWKNAE 81          
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Mouse
Match: Oxa1l (oxidase assembly 1-like [Source:MGI Symbol;Acc:MGI:1916339])

HSP 1 Score: 54.6842 bits (130), Expect = 1.172e-6
Identity = 31/127 (24.41%), Postives = 61/127 (48.03%), Query Frame = 1
Query: 7477 VGADVKKNTNS-GYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRLGLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKARTSSIPKTYKYDP 7854
            +GA+    +N   +++  IR +P+V L  T   PSA+ +YW +S+  SL     + IP V+T L +       P     + G+L++FK+      I +  ++      ++   A    + +T+ ++P
Sbjct:  274 LGAETGVQSNDLQFMRNIIRVMPLVVLPVTIHFPSAVFMYWLSSNVFSLCQVACLRIPAVRTVLKIPQRVVHDPDKLPPREGFLKSFKKGWKNAEIAQQLREREQRMQKHLDLAARGPLRQTFTHNP 400          
BLAST of Mitochondrial inner membrane protein OXA1L vs. TrEMBL
Match: A0A4C1U5Q1 (Uncharacterized protein OS=Eumeta variegata OX=151549 GN=EVAR_16197_1 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.238e-14
Identity = 43/76 (56.58%), Postives = 57/76 (75.00%), Query Frame = -3
Query: 5755 NETISPIITKIRRVVKLFRRSSMKND-VLQQHVKNEFGKEICFILDSGTRWNSLLDMVERFL*LKSCARNSLIDLN 5979
            +E I  +I K+R+VV  F+RS +KN+ VLQ++VK E GKE+  +LD  TRWNSLL M+ERF  LKSC + +LIDLN
Sbjct:   39 DENIKELIEKVRKVVIYFKRSPLKNETVLQKYVKIEHGKELSLLLDCKTRWNSLLTMLERFYLLKSCIQKALIDLN 114          
BLAST of Mitochondrial inner membrane protein OXA1L vs. TrEMBL
Match: A0A2T7NGV5 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18540 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.058e-13
Identity = 48/139 (34.53%), Postives = 74/139 (53.24%), Query Frame = 1
Query: 7450 VIQFNLLY*VGAD-VKKNTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRLGLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKARTSSIPKTYKYDPTKV 7863
            ++ F L   +G D VK  T S  +KW  R +PI+ L F    P+A+L YW+TS+  SLV    + IP V+    +  L     TA   K G+L+ FK+S    ++ +  ++ H ++   + +A    I KTY YDPTK+
Sbjct:  197 MLTFFLTIELGVDGVKAGTMSHTMKWFFRGMPIIMLPFIANFPAAMLCYWFTSNGFSLVQVLFLKIPRVREFFKIEQLVKHPVTALPKKKGFLEGFKDSMNNAKLAREMEERHRVDALRFKQAGQGPITKTYAYDPTKL 335          
BLAST of Mitochondrial inner membrane protein OXA1L vs. TrEMBL
Match: A0A4C1UUF6 (Uncharacterized protein OS=Eumeta variegata OX=151549 GN=EVAR_20189_1 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.155e-13
Identity = 43/76 (56.58%), Postives = 57/76 (75.00%), Query Frame = -3
Query: 5755 NETISPIITKIRRVVKLFRRSSMKND-VLQQHVKNEFGKEICFILDSGTRWNSLLDMVERFL*LKSCARNSLIDLN 5979
            +E I  +I K+R+VV  F+RS +KN+ VLQ++VK E GKE+  +LD  TRWNSLL M+ERF  LKSC + +LIDLN
Sbjct:   82 DENIKELIEKVRKVVIYFKRSPLKNETVLQKYVKIEHGKELSLLLDCKTRWNSLLTMLERFYLLKSCIQKALIDLN 157          
BLAST of Mitochondrial inner membrane protein OXA1L vs. TrEMBL
Match: A0A4C1ZW55 (Uncharacterized protein OS=Eumeta variegata OX=151549 GN=EVAR_66010_1 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.470e-13
Identity = 38/79 (48.10%), Postives = 54/79 (68.35%), Query Frame = -3
Query: 5740 ETISPIITKIRRVVKLFRRSSMKNDVLQQHVKNEFGKEICFILDSGTRWNSLLDMVERFL*LKSCARNSLIDLNIEFLY 5976
            E ++  + + R +VKLFRRS +KN  LQ++VK EFG+E+  ILD   RWNS+L M  RFL LK+  + +LIDL +  L+
Sbjct:   14 ENLTKALEETRTIVKLFRRSPLKNITLQKYVKEEFGRELNLILDVKIRWNSMLQMTHRFLKLKNAIKKALIDLEMSRLW 92          
BLAST of Mitochondrial inner membrane protein OXA1L vs. TrEMBL
Match: A0A2S2QKB9 (Dimer_Tnp_hAT domain-containing protein OS=Sipha flava OX=143950 GN=g.106181 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.486e-13
Identity = 43/73 (58.90%), Postives = 56/73 (76.71%), Query Frame = -3
Query: 5755 ISPIITKIRRVVKLFRRSSMKND-VLQQHVKNEFGKEICFILDSGTRWNSLLDMVERFL*LKSCARNSLIDLN 5970
            IS +I KIR+VV   +RS  KND +LQ++VK E+GKEI  +LD   RWNSLLDM+ERF+ LK+C + SL+DLN
Sbjct:   50 ISVVIKKIRKVVMYLKRSPTKNDTILQKYVKAEYGKEIKLLLDCKMRWNSLLDMLERFILLKTCIQKSLMDLN 122          
BLAST of Mitochondrial inner membrane protein OXA1L vs. Planmine SMEST
Match: SMESG000039158.1 (SMESG000039158.1)

HSP 1 Score: 273.863 bits (699), Expect = 3.550e-81
Identity = 131/133 (98.50%), Postives = 132/133 (99.25%), Query Frame = 1
Query: 7477 VGADVKKNTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRLGLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKARTSSIPKTYKYDPTKVNPTQ 7875
            VGADVKKNTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTR+GLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKA TSSIPKTYKYDPTKVNPTQ
Sbjct:  250 VGADVKKNTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRVGLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKAGTSSIPKTYKYDPTKVNPTQ 382          
BLAST of Mitochondrial inner membrane protein OXA1L vs. Planmine SMEST
Match: SMESG000039158.1 (SMESG000039158.1)

HSP 1 Score: 273.478 bits (698), Expect = 4.847e-81
Identity = 131/133 (98.50%), Postives = 132/133 (99.25%), Query Frame = 1
Query: 7477 VGADVKKNTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRLGLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKARTSSIPKTYKYDPTKVNPTQ 7875
            VGADVKKNTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTR+GLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKA TSSIPKTYKYDPTKVNPTQ
Sbjct:  247 VGADVKKNTNSGYLKWGIRSLPIVALAFTCRLPSALLLYWWTSSCMSLVFSGIMSIPFVKTRVGLSALSYQAPTATDSKLGYLQNFKESNAEKRITKLAKQYHNLEHENWIKAGTSSIPKTYKYDPTKVNPTQ 379          
BLAST of Mitochondrial inner membrane protein OXA1L vs. Planmine SMEST
Match: SMESG000052429.1 (SMESG000052429.1)

HSP 1 Score: 223.016 bits (567), Expect = 3.229e-64
Identity = 119/165 (72.12%), Postives = 135/165 (81.82%), Query Frame = 1
Query: 6619 LQIIPQPKMNSIGEDL*EFVMTMKNYFNMIELDEQQINAFVREYLDERSMKQYDEILYESKLEERLRKAFETQTNLAEDLQNALSYRKANSTVEDYIKAIEKYVKLVMRRKIT-----AFLLKYCLDCEEDRREIQRCEITEDLIKAKLYKEERKVDDEEQRSSA 7098
            LQII +PKM SI EDL +FV+++K YF+MI+LDEQQ N  VR YLDER+ K+YDE  Y++ L+ERLR AFETQTNLAEDLQNALSYRK+NSTV+DYIK IEK VK VM  KIT     AFLLKYCLDCEED REIQ  E TEDLIK KL+ EERKVD+EEQRSSA
Sbjct:   94 LQIISKPKMYSICEDLDQFVVSIKIYFDMIKLDEQQRNVVVRAYLDERNRKKYDETPYKNNLKERLRNAFETQTNLAEDLQNALSYRKSNSTVDDYIKTIEKNVKRVMSHKITSSKLAAFLLKYCLDCEEDIREIQHYENTEDLIKVKLFNEERKVDNEEQRSSA 258          
BLAST of Mitochondrial inner membrane protein OXA1L vs. Planmine SMEST
Match: SMESG000043054.1 (SMESG000043054.1)

HSP 1 Score: 189.119 bits (479), Expect = 4.179e-53
Identity = 96/106 (90.57%), Postives = 99/106 (93.40%), Query Frame = 1
Query: 6643 MNSIGEDL*EFVMTMKNYFNMIELDEQQINAFVREYLDERSMKQYDEILYESKLEERLRKAFETQTNLAEDLQNALSYRKANSTVEDYIKAIEKYVKLVMRRKITA 6960
            M SIGEDL EFVMTMKNYFNMIELDEQQINAFVREYLDERSMKQYDEILYESKLEERLRKAFETQTNLAEDLQNALSYRKANSTV+DYIK I K V+ VMR KIT+
Sbjct:    1 MYSIGEDLEEFVMTMKNYFNMIELDEQQINAFVREYLDERSMKQYDEILYESKLEERLRKAFETQTNLAEDLQNALSYRKANSTVDDYIKTIVKDVESVMRHKITS 106          
BLAST of Mitochondrial inner membrane protein OXA1L vs. Planmine SMEST
Match: SMESG000030608.1 (SMESG000030608.1)

HSP 1 Score: 155.992 bits (393), Expect = 6.431e-42
Identity = 85/117 (72.65%), Postives = 94/117 (80.34%), Query Frame = 1
Query: 6766 MKQYDEILYESKLEERLRKAFETQTNLAEDLQNALSYRKANSTVEDYIKAIEKYVKLVMRRKIT-----AFLLKYCLDCEEDRREIQRCEITEDLIKAKLYKEERKVDDE-EQRSSA 7098
            MK+YDE  YE+ LE RLRK FE +TNLAEDLQNAL+ RKAN T +DYIK IEK V+ VMR KIT     AFLLKYCLDCEEDRR+IQR EITEDLIKAKLYKEERKV +E E+R  A
Sbjct:    1 MKKYDETPYENNLEGRLRKTFEAKTNLAEDLQNALNNRKANLTADDYIKTIEKNVERVMRYKITSSKLIAFLLKYCLDCEEDRRKIQRYEITEDLIKAKLYKEERKVGNEKEKRGPA 117          
The following BLAST results are available for this feature:
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
OXA1L1.845e-1433.59gene:FBgn0027615 transcript:FBtr0076271[more]
OXA1L1.845e-1433.59gene:FBgn0027615 transcript:FBtr0076272[more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Oxa1l1.118e-635.06oxidase assembly 1-like [Source:MGI Symbol;Acc:MGI... [more]
Oxa1l1.172e-624.41oxidase assembly 1-like [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4C1U5Q12.238e-1456.58Uncharacterized protein OS=Eumeta variegata OX=151... [more]
A0A2T7NGV51.058e-1334.53Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4C1UUF62.155e-1356.58Uncharacterized protein OS=Eumeta variegata OX=151... [more]
A0A4C1ZW552.470e-1348.10Uncharacterized protein OS=Eumeta variegata OX=151... [more]
A0A2S2QKB92.486e-1358.90Dimer_Tnp_hAT domain-containing protein OS=Sipha f... [more]
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial inner membrane protein OXA1L vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039158.13.550e-8198.50SMESG000039158.1[more]
SMESG000039158.14.847e-8198.50SMESG000039158.1[more]
SMESG000052429.13.229e-6472.12SMESG000052429.1[more]
SMESG000043054.14.179e-5390.57SMESG000043054.1[more]
SMESG000030608.16.431e-4272.65SMESG000030608.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015252 ID=SMED30015252|Name=Mitochondrial inner membrane protein OXA1L|organism=Schmidtea mediterranea sexual|type=transcript|length=7877bp
TGCACATAGATTTCAATAATGCTTTCTCCAACTAGAAAACTGATTTTCCT
TTTATTTTACGAGAAAGATTCAATTTGAAAGTCTCTGATTAATAATATTT
TTAATAGGTCGTTGTTTGACTCTTATAACTGAGGAACATTTAATGGAAAT
GGGAATATCTACCAAGGCAGATCGAATTAAATTACTCAAGCACATTTATC
GATTAAGATTGAAACACGATTTGATTAATTTAAACAAATGACTTAAAGAA
GATTTAATATTTTAAAGATTTATAAATTATTGTTCTTTTTTACAATGACA
ATTTTCCAGCTGTTTTGTTTATTTTAATAAAAATTCTTTACCTTGCACAT
TCTATGCGGTCAGCTAATTGATTTTTTGAAAATTATTCGCATGATGTGAT
TGAAATTGGCGTAAAACTCAAATATTTTTTTTATTGCGAGCATTTTGAAA
TATAATTTTCAATTTCAAATAATTGAGCGTTATATCTTGCTGTTTGCACT
TGTTCGTTTTCGTGATTATTGATTCCTATACAGAGATTATTGTCTATATT
AGGGAGAAGTAAATCATAGAGAAAAAAGATCAGAGGAGTATAGCAATATT
TTTTAAAAAAATTTATAGATTTTTTAAATTAAATGAGTTAAGAAATATTT
TGTTCAAATCATTATAGAAAATTTTTAAAAATCCTAGCTGATTCGCTTAT
AACTCACATAAGCTACCAAAAACCAAACCCCTCAATAGTCATAAGAGACA
ATGACCTTAGAAAAATTAAAATTTCCTTATTTGCTTAAAAACGTGAATTT
TTGGAAAATAAGTGATTTTAAGTTCATAAACTAGTTCATAAACATGGTCG
TTTATGTGTAATTAAGGATTGTTTACAGGGTCAGTAAAATTTTCCCATTG
GCTCATAAGTTGCCGACCACTGCTATAGATCAAGACTTTGTTCTTATATT
ATTATTTGTAAAAAACTTTTGGTGTGATTTTTAAATTAAAAGACATATAG
TGACACAATGTATCAGAAAATTGGATCATTTTGTACACGATATTATGTGA
TAATTCGAGTTTTATAAATTTTTCTGAAACTAAATTAAAATAATTTTTTG
GAATTATTTTGAAATGCTTTTTTGGGAATGAAAGAAGTGAGAAACGGCGT
TCTGTAGAAATTGAATCAAGTAGGAGTCCGAAGTAAACTTAAAGAATATT
CAAAAATAACTTTAGTTGTGGTTTGAAAGGGTATAGGATTAAATAAGAGT
TTTCAAACGACAAAAATTTATTCGAATAAAATACATTGGCATCTAGAAAT
ATTTATTTTACAGAAAAGTTTGTGTTGCAAAAGAGATGTTAAATTAAAAA
GTTTAATGTGTTACTGGAAATGCATCATAGTTTTAGAACTAATCCCGATC
AAGATTGGTTAGTTCTGTTGTGGCGGAGGGGGGCGAGTTGTAATTATGCA
GAACGAATTTTGACCGTTTCCATCATTTGCAAATATTATTGTTCCTAAAC
TTTTAACAATCTACGAAGTACTTGAATTAACGACTTCTGGAAATAGTTTT
CAATAGAATTTTATTTTACGTCTGTCATTTACTACAAGTCAAGTCATACG
TGAAGGTGAATAACTAGTTGGCACGGTTCTACAAATACGTTAGCTCTAAT
TCAACTAGGATTTCCCACGACAGTCGTGTTCATTTCAAACTCTGATTTAT
TAGAATTTGGTTTAAATTTATTCAAATTCAAACATGGCAGAATTTCACAA
GTTTGCAAAGTGCAAGATGGCAGAATGAATATTGCAGTCGAAATTTGCTA
TTCTGATTAATTAATATTTAAATTAAAATTTTCATTAATTTTAAATTCTA
TAAAATTATTTTATTTTCTAGATTTATGTAAATTAATTAATTAGTTATTT
TTTATGAAAGTATTTTATGGAATGATTTCATATTTATTGAATGACTGACT
GATTGAGACATAAAATTTATGAATTACTAATGAATGGCCGTTTTGTAACT
GTTGAGTTGACAGTAAAAACCTCCTATATGACTTTCTTGATTGCGCAATT
TTTCGACAGGAAATTATTAGATTTATTGTAGTGAATCGTGTTTGCAATGG
CGATTAAAAGTTTTAATTTTAAACAATTTTGTCGTCATATTTAGATATTA
TTTGAAGAAAAGAAAATGGATCCTAACATTTTGGATATCGAGATTTATCA
GAAATCAAACAATTCTTTGATGGAAAAACAAATTTGTTTATAGCGAGAGT
TCAGCGTGTACTTAATTCATCGGCGAAGGAGTTAATGCAACATAAAATGT
ATATTAATTCTTTATACAAAAACGAACCACTGCTGAAGGAAATAAAGCTT
CATTCATTAATGCAGCTAGAATGGTAGCTTAACATTCAGAGATATTTTTA
CAAAAAAAAATCACTGTCAGAATGCTGTATAACCAATGTTGAGAGATGAA
AGGTAAATGTTACTGAAAATGAAAATTGAAATGAAAACTGACCATTTACT
TTTACCAGATAATTTATTTAGTGATAACTATTTCTTAATAAATAATGAGA
AACGTATTTTATACACCTTTCTGAAGCAATCATAGAACCAAAGATGCATG
GAATGGATAATGCAAAAGTTCAGGAAGACCTTCTAGCATTCATTTAGTTA
GTAAGATAGCAGGATTACGCGATAATAAAAAATAAAAAGATGCTGATGAG
ATGAATAAGGTAAATGATTTAAATCGGAGTAAAATAAATTTTTTTTGTTA
CCATTGAATTTTCTTTAAAATTTACATTATTTTAAAATTACTTTTTAAAC
ATTTATAACTTTTTATTTACTTCAGATAACTTCTTTCCGAAAAATATTAA
TTTTTAAATTTTGAATATAATTTGAATACAACTCGTGTTTTCGTGGATGT
CAGCCGATTGTGAGATAGTTCTCTAAGAACCAAATTCATAACAGTTATTT
TGTCTCTGTTGGTGACATCAGCATTTTTCAATAAAATTTTCCTCGTGTTT
GAAGCTTGATCTGGGTGGCAAACAAAAGACTCGAATCTCTGTACTATAGT
ACTATGCCCCTTAATCCAACATACCGAAACTCCCTCAAGGTCATATGACA
TAATATGTCAAGGTCACGTGACAGGTAAAGGTCATATTATATAATAGTTC
AGGTAATAGTATGTCATCGCCATTTTTTGAAATTTTTGCCTAAATATTCA
GATTTAAGCCAAACAACATAATTTTTAGGTTAATTTTGAAAAAAAATCAT
GATATCAGGGTACTTTGGGAGGTTATGTCGTTGAAAGGGGTCAGGATCGG
ATTTTGAAAAAAAAATTGATTTCAGTGAAACAACAAATTTGGGATAATTT
TGCATTAAAAAGTCTTGTGTCAAAATCTACGAATTAATTGTCAAAATATG
TCTAATGGATATATATGGTCAAGGATTAAGGATCAAATTTTGATCTAAAA
GTCTTTTCTTGAATGACAGGTCTAAACTTCAGATAATCGGATGAATTCCG
ATGAGAAAAAAGTAAGTCTTTGATCTTTAAAACTTTCAGCAGCACCAGTC
CGCCTATTCTTTAGATATTTTCCATTACTCTTTGTGGAAAAAACCTCAAC
CTCATTTGATAATGATTAATTTTCATTTTGATGTTTGGGTTTTGGCCATT
TTATTTATCTAATTCGAATCTATCTTATGATTGTAATCTTGACACGAAAG
TATTTGTCTGTCCATTTCTTTTAAAACTTCAAATAATAATAACTCAATTA
ATTCTGTCTGGATTGCCAAAACAGTTGCATCATGATAATAAATTTCACAA
AATCAGGAATAAATCATTAAAATCTATTCAAAAAATTAATTTAAGTGTAA
AATTTATTTTAAAAATCCAAAAAATTTATAAATATTTTGCAGTGGAAACC
GGTATGAGCGTATGCCAAATGATGAGGCGAGCTCAATTAAAATAAAATAA
AGGAAAATACTCAGAAAAAAATATTTAAAGAAAATTAAAAGTAGTTAAAA
GATAATTATCAAATGGAAAACCCAAGCAATGTGAGAAACCAGAGTTCTCA
ATTTTTAAAAACCTATCCCACCACAAGAAAATAAAAATTCATTCGAAAAT
ATGAAATGATATTGAAAATAGTTTTGTCTTGAAAGTAGTTATTGAATTTG
TGCGCGTAAAGTTGTAATTATTGTGGCGATTCTAAATAATCGTTCAAAAT
ATGCACCATTATAATTTTTATAATTGTAGGCTAATTATTGAGGAAATAAT
CACTTCTGGGCTCAAAAACCACGATTTCAAGGCGCTTTTCTCTATGAAAG
GGTTCAAGATGTAATTTTGAACAAAAAGTCATATTTCAGCCATATTTAGG
TTAATTCTGTATTCAGTTGTTCGAAATAAGGACACCGAGAAATAAGAAAT
TGGTACTGACTTATCATAAATACCAAGAAAATGAGATTCCAAAAATAAAA
ATATATAAATTCCAAAAACACGGAATGCAATTCAAATTCAAACAAAGATC
AGCATAATATAACTCAAGAAATGTATTATTTTTAAAACAAAAGCAATTTG
ATCTAGTTCCAGCAATTCTGAAACAACAAGTAGCACTAAAATTTTGATCG
CCAAAAATTACTACTGTATAATAATAATGTAACGTGCCACATAATGCAAT
AATACGTCAAGAAATATCTTTCAGTGCTCACACACAAAAGTCATGAAATA
AAATCTCATTACAGCACAAGGATGTAAAAAGGAAGACAAGCGCCGAAAAA
TTGAGTAGAAACACGAGTTGATTCATGATAGATGCCCAAGAAACGTGTTT
TGTAGGTCCCTCGGATTTTGCGTTAGGCGGGTTTAATTTTTCTACACGTG
CAAAGTTGAAATCCAGTAATATATCGTTATACTTTATACATGATTCGTTT
TTTAAAATAATTCCGGCCCGAGCATAAATTTATTACCCGATCCGGATCAG
TACAATTACGGGATATATTGCCAGTTTCACCAATTAACCCAAAGATTGAT
CAAACATATTTATTTTTGAGTTGCTTTATTACTTTTCTTCAATTTTATAT
TGCTCTTCATTCCAGCGGCATTGTTTAATCATTTGATTTTAATTCGATTT
CAATTTTTTATTGACCATTTATTCCTACATTTTACAAATTCCTCACGCAC
CATAAAATTATAAAATCAAAATTCATTTTTGATTTCCATAAATTTTCTCC
AAACAAATCATTATAAAAACATTCAATAAATTTATTTAATAATCACAAAT
CAATAGAAAATAACAGATAATAATAATAACCATAATATTTATAATAAAAA
ACAAATTTTCCCACTTTACATTCTGTCAGAACAAAATTATTGATTTCCAA
CAAATTAAATCCATATAAATACAGCTGGCAAAAATCAAATAAAATAATAG
TTTATTAATTTAAATAAATCAATAATAATTATTTATTAAATTTATAACTT
CCTGAAAGTCTTTTTTGCAATTATTATCCCACTACATAAAAGTTGATATT
CTTCAATTACATTTCCATCAATTCATTTTATTAATCCTTGTTGTTTTGTA
CTTTGTACAATTTGTGTTGTAGCATTTAAAAAACAAACTCGCCACTTCAT
TCATAGATGTATTGAAAAAATATACATTCCACATTTCTTTTTAATATTCG
AAGATTTCGGAAGAAATCAATCTGGAATCTTATATTGGCTACATATATAT
TCGTTCAATTGTTGAAGTATAGAAGTTTTACATTGGAGGGTACAAAAATT
CAATATTTAAATCAATAAGACTATTTCTGGCACATGATTTTAATTACAAG
AAGCGTTCAACCATATCTAATAAACTGTTCCATCTTGTCCCACTGTCCAA
AATAAAACATATTTCTTTCCCAAATTCATTTTTCACGTGCTGTTGAAGAA
CATCATTTTTCATGGATGAACGACGAAATAATTTTACCACTCGTCGAATT
TTTGTTATAATTGGTGATATAGTTTCGTTTTAAACATCAATTTCATCCAC
TGACGAAATTAGTGTGGAAGCATCTGTTTCCGCCCGTTTTAATAGATTTA
CTTGGTGCTGGCTCTTTAGATGATCATGTAATCCACTAGTTGAACCTCCA
CAAGCTTTCAATATTTTTTTTGCAATAGTTGCATTTGGCCTTAACTTACC
CATCCCGAGTCTTCTTTGTTTTTTCGGTCTCCATGACTTTAAATTCAAAT
GTATATTATTGTAAAATGTTTTATGGATAAAAAATAAAATATAATAAATA
CTTTCTACACACTTATTTTAAAATTCTAGTAACAATATTTAAAATAAGGC
AGTATTAAACTAACTTCAAGACACTGCCCACAACTTAACACAATTATGAA
ATATTTGAAACCATATTTAAAATAAGACAGCAGAATTACAATGAACTCTA
ATTTAAATTCACAATTTAAAACTAACTTCTTCTATGACCTCAAATTAACA
CAATTTTCAGAACTTATAGTTTTAATTGGTGAAGTTGAATAACGGATATG
AATTTAAAGTATAGTTCAGTGATTTTTCAAGGATAATATTGGAAAAATTA
CCGAAATCACCGGTAATCAAATTGGCGGATAAAACCGATTAACCGTTTAC
CAGTTCTGCAATACCTAGCTGCAGATTATTCCTCAACCAAAAATGAACTC
GATTGGTGAAGATCTTTAAGAATTTGTCATGACAATGAAAAATTATTTTA
ATATGATCGAACTAGATGAACAACAAATAAATGCCTTTGTTCGAGAATAT
CTAGACGAAAGAAGCATGAAGCAATATGATGAAATTCTATATGAAAGCAA
ATTGGAAGAAAGATTAAGAAAGGCTTTTGAAACACAAACAAATCTAGCGG
AAGATTTACAAAACGCTTTGAGCTATCGAAAAGCCAATTCAACTGTCGAA
GACTACATCAAGGCAATAGAGAAATACGTAAAGCTTGTAATGAGGCGTAA
AATAACAGCATTTTTATTAAAATATTGTTTGGATTGTGAAGAAGACAGAA
GAGAAATTCAGCGTTGCGAAATTACAGAGGATTTAATTAAAGCAAAACTC
TACAAAGAAGAAAGGAAAGTTGACGATGAAGAACAGAGGTCCAGCGCCAA
GTAAATACATAAAATGTATTTTTAAAAAAGTGGAAGAATCGAAACTCAAT
GAAAATTTATTCCTGGCGTCTGACCAAAAATTCAGGGCATACATGTCAGA
TGGTATTTTACAATAACGGGAAGTTACTGTATATATGTATATATCATAAA
TCAATAAGGAAAATTGACACTGAGGAAAAACACTAACTTTAGGAATTTAT
ATATACTATATAATTTTTTTATATTTAATAATCTTCTTAAGGCACACAGG
CTGGTTTTCTAATAAATATATATATTCTGTTTCCTAAATTTTTATGATTA
GTGGGAAAATCATACAACCCGTCTGTCTCGTTTTTCAAATAACTTTTTTG
TAATACAATTTAATTTGCTTTATTAGGTTGGAGCGGATGTAAAGAAGAAT
ACCAATTCTGGATATTTAAAATGGGGGATTCGTAGTCTCCCAATTGTTGC
TCTTGCATTCACTTGTCGTTTACCATCGGCTCTTTTGCTTTATTGGTGGA
CGTCGTCTTGTATGTCTTTAGTTTTTTCTGGAATAATGTCCATTCCATTT
GTAAAAACACGCTTGGGTCTTTCAGCTCTTAGTTACCAGGCACCAACCGC
GACTGATTCAAAACTTGGATACTTACAAAATTTTAAAGAATCAAATGCTG
AAAAGCGAATAACTAAACTAGCTAAGCAATATCACAATCTTGAACATGAA
AATTGGATTAAAGCAAGAACTTCCTCCATCCCCAAAACGTACAAGTATGA
TCCAACAAAAGTTAACCCAACGCAGTT
back to top

protein sequence of SMED30015252-orf-1

>SMED30015252-orf-1 ID=SMED30015252-orf-1|Name=SMED30015252-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MFGFWPFYLSNSNLSYDCNLDTKVFVCPFLLKLQIIITQLILSGLPKQLH
HDNKFHKIRNKSLKSIQKINLSVKFILKIQKIYKYFAVETGMSVCQMMRR
AQLK*
back to top

protein sequence of SMED30015252-orf-2

>SMED30015252-orf-2 ID=SMED30015252-orf-2|Name=SMED30015252-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=142bp
MTMKNYFNMIELDEQQINAFVREYLDERSMKQYDEILYESKLEERLRKAF
ETQTNLAEDLQNALSYRKANSTVEDYIKAIEKYVKLVMRRKITAFLLKYC
LDCEEDRREIQRCEITEDLIKAKLYKEERKVDDEEQRSSAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0032977membrane insertase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0090150establishment of protein localization to membrane
GO:0051205protein insertion into membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001660SAM
IPR013761SAM/pointed_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane