Transmembrane protein 184C

Overview
NameTransmembrane protein 184C
Smed IDSMED30015251
Length (bp)3481
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 184C (SMED30015251) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 184C (SMED30015251) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 184C (SMED30015251) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 184C (SMED30015251) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015251

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015251SMESG000016924.1 Contig4574GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015251SMESG000049447.1 Contig4574GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015251SMESG000028913.1 Contig4072GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015251SMESG000048961.1 SMESG000028913.1 dd_Smed_v4_3934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015251SMESG000049447.1 dd_Smed_v4_1196_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015251SMESG000048961.1 SMESG000028913.1 dd_Smed_v4_3934_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 184C vs. Ensembl Human
Match: TMEM184C (transmembrane protein 184C [Source:HGNC Symbol;Acc:HGNC:25587])

HSP 1 Score: 370.933 bits (951), Expect = 6.546e-117
Identity = 187/396 (47.22%), Postives = 255/396 (64.39%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNN--PSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRH 1255
            NW+ W++P + +IY V I +++P  + E          +AW I GIF++  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FL ++L ++YP+   ++E K Q KH  P C CP W MG   +  C+ GVLQYT+VRP TTI+A ICE+ G+Y    F    A+ YL I+NN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFWQAVV A+L    VIS    W+    + +++  Q+F ICIEMF+AA+AHH++FS  PY  E   G   C  S LAM DVSD++ D+ E V+HVG TV+   P     P +    Q QNE T L++ +   + S  S    +   H
Sbjct:    9 NWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIEMFLAAIAHHYTFSYKPYVQEAEEG--SCFDSFLAMWDVSDIRDDISEQVRHVGRTVRGH-PRKKLFPED----QDQNEHTSLLSSSSQDAISIASSMPPSPMGH 397          
BLAST of Transmembrane protein 184C vs. Ensembl Human
Match: TMEM184C (transmembrane protein 184C [Source:HGNC Symbol;Acc:HGNC:25587])

HSP 1 Score: 271.937 bits (694), Expect = 1.052e-82
Identity = 130/252 (51.59%), Postives = 176/252 (69.84%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFW 829
            NW+ W++P + +IY V I +++P  + E          +AW I GIF++  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FL ++L ++YP+   ++E K Q KH  P C CP W MG   +  C+ GVLQYT+VRP TTI+A ICE+ G+Y    F    A+ YL I+NN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFW
Sbjct:    9 NWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFW 260          
BLAST of Transmembrane protein 184C vs. Ensembl Human
Match: TMEM184A (transmembrane protein 184A [Source:HGNC Symbol;Acc:HGNC:28797])

HSP 1 Score: 181.03 bits (458), Expect = 1.003e-48
Identity = 101/295 (34.24%), Postives = 160/295 (54.24%), Query Frame = 2
Query:  176 SSRKEAWL---------IGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLAL---GFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVE--AWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETN 1018
            SS+   WL         + GIFV  A+ ++   I  H+ SYT P  QR+IIR+L +VPIYA  +WL+L   G  +  +YFD++ +CYEA+VIY+F++    +L  +      +  +  +   L+  C          F+  C+   LQ+ LV+P+  +   I +  G YH  +F +   YLY+ ++ N S   A+Y+L +FY  T+  L+P +P+ KFL +K V+FLSFWQ ++ AIL    VI  VE           +++ +QNF IC+EM  A+VA  ++F    Y  ++ N
Sbjct:   41 SSQGAPWLFLTSALARGVSGIFVWTALVLTCHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDSWLSLLLLGDHQYYVYFDSVRDCYEAFVIYSFLSLCFQYLGGEGAIMAEIRGKPIKSSCLYGTCCLRGMTYSIGFLRFCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSGYLYVTLIYNASVSLALYALFLFYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILERCGVIPEVETSGGNKLGAGTLAAGYQNFIICVEMLFASVALRYAFPCQVYAEKKEN 335          
BLAST of Transmembrane protein 184C vs. Ensembl Human
Match: TMEM184B (transmembrane protein 184B [Source:HGNC Symbol;Acc:HGNC:1310])

HSP 1 Score: 174.866 bits (442), Expect = 1.106e-46
Identity = 99/287 (34.49%), Postives = 161/287 (56.10%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKC 1033
            A  I G FV  A+ I+   I  H+  Y+ P  QR+I+RIL++VPIYA  +WL+L F    +  +YF T+ +CYEA VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+  +   + +  G Y   +F +   YLY+ I+ NIS   A+Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AIL     I  + + ++S     +++ +Q+F IC+EMF AA+A   +F+   Y  +  + Q +C
Sbjct:   46 AQAISGFFVWTALLITCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEALVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRC 330          
BLAST of Transmembrane protein 184C vs. Ensembl Human
Match: TMEM184B (transmembrane protein 184B [Source:HGNC Symbol;Acc:HGNC:1310])

HSP 1 Score: 174.866 bits (442), Expect = 1.106e-46
Identity = 99/287 (34.49%), Postives = 161/287 (56.10%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKC 1033
            A  I G FV  A+ I+   I  H+  Y+ P  QR+I+RIL++VPIYA  +WL+L F    +  +YF T+ +CYEA VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+  +   + +  G Y   +F +   YLY+ I+ NIS   A+Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AIL     I  + + ++S     +++ +Q+F IC+EMF AA+A   +F+   Y  +  + Q +C
Sbjct:   46 AQAISGFFVWTALLITCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEALVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRC 330          
BLAST of Transmembrane protein 184C vs. Ensembl Celegans
Match: F40E10.6 (pep chromosome:WBcel235:X:14703738:14706859:-1 gene:WBGene00009574.1 transcript:F40E10.6.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40E10.6)

HSP 1 Score: 180.259 bits (456), Expect = 4.785e-49
Identity = 105/314 (33.44%), Postives = 172/314 (54.78%), Query Frame = 2
Query:  200 IGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQA--IYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKP--QVKHLF-PCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVIS---NVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPY-----RTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKH 1102
            + G+    A+ I+   I +H+  Y+ P  QR I+RIL++VPIYA  +WL+L F      IYF+++ +CYEA+VIY+F++    +L  +  +    I  KP     +L   CCL  K     +F+  C+   LQ+  ++PI  +I  +    G Y    + LD  Y+Y+ ++ N+S   A+Y + +FY  T+  L P +P+ KFL VK V+FLSFWQ  + AIL AT  I    + E  ++     +++ +QNFFICIEMF AA+A  F+F+++ Y      +   +G+P    S  +    +   +D+++   H
Sbjct:   20 LAGLCTWAALLITSHQIYQHLRFYSCPAEQRWIVRILFIVPIYAFDSWLSLIFFSDNVYIYFNSIRDCYEAFVIYSFLSLCYEYLGGE-SNIMAEIRGKPIRPTNYLTCTCCLAGK-QYTIEFLRFCKQATLQFCFIKPIMAVITLMLTAIGKYEDGNWSLDQGYIYITLVYNVSISLALYGMFLFYAATRDLLSPYRPVLKFLTVKSVIFLSFWQGFLIAILGATSAIDPIYDAEGREVIGRGTVAAGWQNFFICIEMFFAAIALRFAFNVSAYADAHNASNANDGRPVTLQSISSSLKETMNPKDIMQDAIH 331          
BLAST of Transmembrane protein 184C vs. Ensembl Celegans
Match: F40E10.6 (pep chromosome:WBcel235:X:14703733:14706857:-1 gene:WBGene00009574.1 transcript:F40E10.6.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40E10.6)

HSP 1 Score: 180.259 bits (456), Expect = 4.785e-49
Identity = 105/314 (33.44%), Postives = 172/314 (54.78%), Query Frame = 2
Query:  200 IGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQA--IYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKP--QVKHLF-PCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVIS---NVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPY-----RTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKH 1102
            + G+    A+ I+   I +H+  Y+ P  QR I+RIL++VPIYA  +WL+L F      IYF+++ +CYEA+VIY+F++    +L  +  +    I  KP     +L   CCL  K     +F+  C+   LQ+  ++PI  +I  +    G Y    + LD  Y+Y+ ++ N+S   A+Y + +FY  T+  L P +P+ KFL VK V+FLSFWQ  + AIL AT  I    + E  ++     +++ +QNFFICIEMF AA+A  F+F+++ Y      +   +G+P    S  +    +   +D+++   H
Sbjct:   20 LAGLCTWAALLITSHQIYQHLRFYSCPAEQRWIVRILFIVPIYAFDSWLSLIFFSDNVYIYFNSIRDCYEAFVIYSFLSLCYEYLGGE-SNIMAEIRGKPIRPTNYLTCTCCLAGK-QYTIEFLRFCKQATLQFCFIKPIMAVITLMLTAIGKYEDGNWSLDQGYIYITLVYNVSISLALYGMFLFYAATRDLLSPYRPVLKFLTVKSVIFLSFWQGFLIAILGATSAIDPIYDAEGREVIGRGTVAAGWQNFFICIEMFFAAIALRFAFNVSAYADAHNASNANDGRPVTLQSISSSLKETMNPKDIMQDAIH 331          
BLAST of Transmembrane protein 184C vs. Ensembl Celegans
Match: F40E10.6 (pep chromosome:WBcel235:X:14703715:14706857:-1 gene:WBGene00009574.1 transcript:F40E10.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40E10.6)

HSP 1 Score: 180.259 bits (456), Expect = 4.785e-49
Identity = 105/314 (33.44%), Postives = 172/314 (54.78%), Query Frame = 2
Query:  200 IGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQA--IYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKP--QVKHLF-PCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVIS---NVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPY-----RTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKH 1102
            + G+    A+ I+   I +H+  Y+ P  QR I+RIL++VPIYA  +WL+L F      IYF+++ +CYEA+VIY+F++    +L  +  +    I  KP     +L   CCL  K     +F+  C+   LQ+  ++PI  +I  +    G Y    + LD  Y+Y+ ++ N+S   A+Y + +FY  T+  L P +P+ KFL VK V+FLSFWQ  + AIL AT  I    + E  ++     +++ +QNFFICIEMF AA+A  F+F+++ Y      +   +G+P    S  +    +   +D+++   H
Sbjct:   20 LAGLCTWAALLITSHQIYQHLRFYSCPAEQRWIVRILFIVPIYAFDSWLSLIFFSDNVYIYFNSIRDCYEAFVIYSFLSLCYEYLGGE-SNIMAEIRGKPIRPTNYLTCTCCLAGK-QYTIEFLRFCKQATLQFCFIKPIMAVITLMLTAIGKYEDGNWSLDQGYIYITLVYNVSISLALYGMFLFYAATRDLLSPYRPVLKFLTVKSVIFLSFWQGFLIAILGATSAIDPIYDAEGREVIGRGTVAAGWQNFFICIEMFFAAIALRFAFNVSAYADAHNASNANDGRPVTLQSISSSLKETMNPKDIMQDAIH 331          
BLAST of Transmembrane protein 184C vs. Ensembl Fly
Match: CG5850 (gene:FBgn0032172 transcript:FBtr0309210)

HSP 1 Score: 343.969 bits (881), Expect = 9.015e-107
Identity = 178/410 (43.41%), Postives = 254/410 (61.95%), Query Frame = 2
Query:   77 WKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEE----TNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSRSEIKTERN 1294
            W++W++P ++I Y +   I +P +I     +      +  LIGG+FV+ AVP+S+W I++HV+ +TKP LQ+HIIRILWMVPIYAL AW+ L F K +IY D+L ECYEAYVIYNFM +LL++L     D    +E KPQV H FP C    W MGR+FI+ C+HG+LQYT+VRPITT I+ ICE+ GVY   EF  + A+ Y+ ++NNISQ  AMY L++FYR  K +LKP+KP+ KFLC+K VVF SF+Q V+  +L    +I ++    + D   ++S+ QNF ICIEMFIAAVAH +SF   P+         N     C + L+M D+SD++ D+ EH+  VG+++  +  F   S      R    +  +   G  S+S+  +    +  H P +     + R 
Sbjct:   13 WRIWIRPLLIITYVIFAIIVVPLLIVNSVKDGFQRNDQLILIGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFFPKHSIYVDSLRECYEAYVIYNFMVYLLNYLNLGM-DLEATMEYKPQVPHFFPLCCMRPWVMGREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVNNISQFVAMYCLVLFYRANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKDIFGSDVGD-TNLASLLQNFLICIEMFIAAVAHIYSFPHHPFHINSPQYWNNPNHSWCRAFLSMMDISDMQEDVTEHLGVVGSSLSRR--FQGRSTYQPLARSPRRSSSVADDGNSSNSNYQQ----QQLHLPGAAGSQPSTRQ 414          
BLAST of Transmembrane protein 184C vs. Ensembl Fly
Match: CG5850 (gene:FBgn0032172 transcript:FBtr0309211)

HSP 1 Score: 343.199 bits (879), Expect = 2.353e-106
Identity = 179/411 (43.55%), Postives = 254/411 (61.80%), Query Frame = 2
Query:   77 WKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEE----TNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYS-DNESRHKPNSRSEIKTERN 1294
            W++W++P ++I Y +   I +P +I     +      +  LIGG+FV+ AVP+S+W I++HV+ +TKP LQ+HIIRILWMVPIYAL AW+ L F K +IY D+L ECYEAYVIYNFM +LL++L     D    +E KPQV H FP C    W MGR+FI+ C+HG+LQYT+VRPITT I+ ICE+ GVY   EF  + A+ Y+ ++NNISQ  AMY L++FYR  K +LKP+KP+ KFLC+K VVF SF+Q V+  +L    +I ++    + D   ++S+ QNF ICIEMFIAAVAH +SF   P+         N     C + L+M D+SD++ D+ EH+  VG+++  +  F   S      R    +P  +  G   D + S  +   +  H P +     + R 
Sbjct:   13 WRIWIRPLLIITYVIFAIIVVPLLIVNSVKDGFQRNDQLILIGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFFPKHSIYVDSLRECYEAYVIYNFMVYLLNYLNLGM-DLEATMEYKPQVPHFFPLCCMRPWVMGREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVNNISQFVAMYCLVLFYRANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKDIFGSDVGD-TNLASLLQNFLICIEMFIAAVAHIYSFPHHPFHINSPQYWNNPNHSWCRAFLSMMDISDMQEDVTEHLGVVGSSLSRR--FQGRSTYQPLAR----SPRRSSTGVADDGNSSNSNYQQQQLHLPGAAGSQPSTRQ 415          
BLAST of Transmembrane protein 184C vs. Ensembl Fly
Match: CG5850 (gene:FBgn0032172 transcript:FBtr0309209)

HSP 1 Score: 343.584 bits (880), Expect = 3.422e-106
Identity = 169/355 (47.61%), Postives = 237/355 (66.76%), Query Frame = 2
Query:   77 WKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEE----TNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKL 1129
            W++W++P ++I Y +   I +P +I     +      +  LIGG+FV+ AVP+S+W I++HV+ +TKP LQ+HIIRILWMVPIYAL AW+ L F K +IY D+L ECYEAYVIYNFM +LL++L     D    +E KPQV H FP C    W MGR+FI+ C+HG+LQYT+VRPITT I+ ICE+ GVY   EF  + A+ Y+ ++NNISQ  AMY L++FYR  K +LKP+KP+ KFLC+K VVF SF+Q V+  +L    +I ++    + D   ++S+ QNF ICIEMFIAAVAH +SF   P+         N     C + L+M D+SD++ D+ EH+  VG+++  + 
Sbjct:   13 WRIWIRPLLIITYVIFAIIVVPLLIVNSVKDGFQRNDQLILIGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFFPKHSIYVDSLRECYEAYVIYNFMVYLLNYLNLGM-DLEATMEYKPQVPHFFPLCCMRPWVMGREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVNNISQFVAMYCLVLFYRANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKDIFGSDVGD-TNLASLLQNFLICIEMFIAAVAHIYSFPHHPFHINSPQYWNNPNHSWCRAFLSMMDISDMQEDVTEHLGVVGSSLSRRF 365          
BLAST of Transmembrane protein 184C vs. Ensembl Fly
Match: CG5850 (gene:FBgn0032172 transcript:FBtr0079890)

HSP 1 Score: 343.584 bits (880), Expect = 3.422e-106
Identity = 169/355 (47.61%), Postives = 237/355 (66.76%), Query Frame = 2
Query:   77 WKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEE----TNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKL 1129
            W++W++P ++I Y +   I +P +I     +      +  LIGG+FV+ AVP+S+W I++HV+ +TKP LQ+HIIRILWMVPIYAL AW+ L F K +IY D+L ECYEAYVIYNFM +LL++L     D    +E KPQV H FP C    W MGR+FI+ C+HG+LQYT+VRPITT I+ ICE+ GVY   EF  + A+ Y+ ++NNISQ  AMY L++FYR  K +LKP+KP+ KFLC+K VVF SF+Q V+  +L    +I ++    + D   ++S+ QNF ICIEMFIAAVAH +SF   P+         N     C + L+M D+SD++ D+ EH+  VG+++  + 
Sbjct:   13 WRIWIRPLLIITYVIFAIIVVPLLIVNSVKDGFQRNDQLILIGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFFPKHSIYVDSLRECYEAYVIYNFMVYLLNYLNLGM-DLEATMEYKPQVPHFFPLCCMRPWVMGREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVNNISQFVAMYCLVLFYRANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKDIFGSDVGD-TNLASLLQNFLICIEMFIAAVAHIYSFPHHPFHINSPQYWNNPNHSWCRAFLSMMDISDMQEDVTEHLGVVGSSLSRRF 365          
BLAST of Transmembrane protein 184C vs. Ensembl Fly
Match: CG5850 (gene:FBgn0032172 transcript:FBtr0303901)

HSP 1 Score: 343.199 bits (879), Expect = 3.605e-106
Identity = 169/355 (47.61%), Postives = 237/355 (66.76%), Query Frame = 2
Query:   77 WKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEE----TNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKL 1129
            W++W++P ++I Y +   I +P +I     +      +  LIGG+FV+ AVP+S+W I++HV+ +TKP LQ+HIIRILWMVPIYAL AW+ L F K +IY D+L ECYEAYVIYNFM +LL++L     D    +E KPQV H FP C    W MGR+FI+ C+HG+LQYT+VRPITT I+ ICE+ GVY   EF  + A+ Y+ ++NNISQ  AMY L++FYR  K +LKP+KP+ KFLC+K VVF SF+Q V+  +L    +I ++    + D   ++S+ QNF ICIEMFIAAVAH +SF   P+         N     C + L+M D+SD++ D+ EH+  VG+++  + 
Sbjct:   13 WRIWIRPLLIITYVIFAIIVVPLLIVNSVKDGFQRNDQLILIGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFFPKHSIYVDSLRECYEAYVIYNFMVYLLNYLNLGM-DLEATMEYKPQVPHFFPLCCMRPWVMGREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVNNISQFVAMYCLVLFYRANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKDIFGSDVGD-TNLASLLQNFLICIEMFIAAVAHIYSFPHHPFHINSPQYWNNPNHSWCRAFLSMMDISDMQEDVTEHLGVVGSSLSRRF 365          
BLAST of Transmembrane protein 184C vs. Ensembl Zebrafish
Match: tmem184c (transmembrane protein 184C [Source:ZFIN;Acc:ZDB-GENE-090312-89])

HSP 1 Score: 343.969 bits (881), Expect = 7.976e-107
Identity = 177/351 (50.43%), Postives = 240/351 (68.38%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSK 1126
            NW+ W++P ++++Y +++ + LP  I E       +  +AW I GIFV   +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FLL++L +QYP    M+E + Q KHL P C CP WPMG   +  C+ GVLQYT+VRP+TT+IA IC++ GVY    F    A+ YL I NN+SQ++AMY L++FY+  + EL P+KP+ KFLCVK VVF+SFWQAV  A+L    VIS+   W     + +++  Q+F IC+EMF+AA+AHHFSF+  PY  E   G   C  S LAM D+SD++ D+ E V++VG TV  +
Sbjct:    7 NWRRWIRPLVVVLYILLLLVVLPLCIWELQKSEVGTHNKAWFIAGIFVFMTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPNIAIYVDTCRECYEAYVIYNFMIFLLNYLGNQYPSLVLMLEVQEQQKHLPPLCCCPPWPMGEVLLLRCKLGVLQYTVVRPVTTVIALICQLCGVYDEGNFSSKNAWTYLVIFNNLSQLFAMYCLVLFYKALREELSPIKPVGKFLCVKLVVFVSFWQAVFIALLVKVGVISDSHTWDWDSVEAVATGLQDFIICVEMFLAAIAHHFSFTYKPYIQEAEEG--SCFDSFLAMWDISDIRADISEQVRNVGRTVMGR 355          
BLAST of Transmembrane protein 184C vs. Ensembl Zebrafish
Match: tmem184c (transmembrane protein 184C [Source:ZFIN;Acc:ZDB-GENE-090312-89])

HSP 1 Score: 337.421 bits (864), Expect = 2.185e-104
Identity = 178/358 (49.72%), Postives = 240/358 (67.04%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASS-------RKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSK 1126
            NW+ W++P ++++Y +++ + LP  I E       S         +AW I GIFV   +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FLL++L +QYP    M+E + Q KHL P C CP WPMG   +  C+ GVLQYT+VRP+TT+IA IC++ GVY    F    A+ YL I NN+SQ++AMY L++FY+  + EL P+KP+ KFLCVK VVF+SFWQAV  A+L    VIS+   W     + +++  Q+F IC+EMF+AA+AHHFSF+  PY  E   G   C  S LAM D+SD++ D+ E V++VG TV  +
Sbjct:    7 NWRRWIRPLVVVLYILLLLVVLPLCIWELQKSEVRSLFRNVGTHNKAWFIAGIFVFMTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPNIAIYVDTCRECYEAYVIYNFMIFLLNYLGNQYPSLVLMLEVQEQQKHLPPLCCCPPWPMGEVLLLRCKLGVLQYTVVRPVTTVIALICQLCGVYDEGNFSSKNAWTYLVIFNNLSQLFAMYCLVLFYKALREELSPIKPVGKFLCVKLVVFVSFWQAVFIALLVKVGVISDSHTWDWDSVEAVATGLQDFIICVEMFLAAIAHHFSFTYKPYIQEAEEG--SCFDSFLAMWDISDIRADISEQVRNVGRTVMGR 362          
BLAST of Transmembrane protein 184C vs. Ensembl Zebrafish
Match: tmem184a (transmembrane protein 184a [Source:ZFIN;Acc:ZDB-GENE-040426-2925])

HSP 1 Score: 195.667 bits (496), Expect = 6.132e-54
Identity = 107/289 (37.02%), Postives = 165/289 (57.09%), Query Frame = 2
Query:  179 SRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSD--PKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPK 1030
            S   A  + GIFV  A+ ++   I  H+ SYT P  QR+IIRIL++VPIYA  +WL+L F    +  +YFD++ +CYEA+VIYNF++    +L  +      +  +  Q   L+  C          F+  C+   LQ+ +V+PI  +I  + +  G YH  +F + G YLY+ I+ N S   A+Y+L +FY  T   L+P +P+ KFL +K V+FLSFWQ +V AIL    VI   +     +     +++ +QNF ICIEMF A++A  ++F+ + YR E+ N  P+
Sbjct:   57 STATAQALSGIFVWSALILTCHQIYLHLRSYTVPNEQRYIIRILFIVPIYAFDSWLSLLFITNDQYYVYFDSVRDCYEAFVIYNFLSLSFEYLGGESAIMSEIRGKPIQSSCLYGTCCLVGMSYSIGFLRFCKQATLQFCVVKPIMAVITILLQAFGKYHDGDFNVTGGYLYITIIYNFSVSLALYALFLFYFATSDLLRPFEPVLKFLTIKSVIFLSFWQGMVLAILERCGVIPEAQFIDGHEVGAGTVAAGWQNFIICIEMFFASIALRYAFTSSVYR-EKKNEAPE 344          
BLAST of Transmembrane protein 184C vs. Ensembl Zebrafish
Match: tmem184ba (transmembrane protein 184ba [Source:ZFIN;Acc:ZDB-GENE-050417-219])

HSP 1 Score: 184.882 bits (468), Expect = 1.544e-50
Identity = 104/287 (36.24%), Postives = 165/287 (57.49%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKC 1033
            A  + G FV  A+ ++   I  H+  Y+ P  QRHI+RIL++VPIYA  +WL+L F    +  +YFDT+ +CYEA+VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+  II  I +  G Y   +F +   YLY+ I+ NIS   ++Y+L +FY  T+  L P +PM KF  VK V+FLSFWQ ++ AIL     I  + + ++S     +++ +QNF ICIEMF AA+A   +F+ T Y  +  +   +C
Sbjct:   30 AQAVSGFFVWTALLLTCHQIYMHLRYYSSPKEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFDTVRDCYEAFVIYNFLSLCYEYLGGESAIMAEIRGKPIESSCIYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAIITVILQAFGKYRDGDFNVASGYLYVTIIYNISVSLSLYALFLFYFSTRDLLSPYRPMLKFFMVKSVIFLSFWQGMLLAILEKCGAIPQISSPEVSVGEGTVAAGYQNFIICIEMFFAALALRHAFTYTVYMDKRLDSLGRC 314          
BLAST of Transmembrane protein 184C vs. Ensembl Zebrafish
Match: tmem184ba (transmembrane protein 184ba [Source:ZFIN;Acc:ZDB-GENE-050417-219])

HSP 1 Score: 184.882 bits (468), Expect = 1.544e-50
Identity = 104/287 (36.24%), Postives = 165/287 (57.49%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKC 1033
            A  + G FV  A+ ++   I  H+  Y+ P  QRHI+RIL++VPIYA  +WL+L F    +  +YFDT+ +CYEA+VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+  II  I +  G Y   +F +   YLY+ I+ NIS   ++Y+L +FY  T+  L P +PM KF  VK V+FLSFWQ ++ AIL     I  + + ++S     +++ +QNF ICIEMF AA+A   +F+ T Y  +  +   +C
Sbjct:   30 AQAVSGFFVWTALLLTCHQIYMHLRYYSSPKEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFDTVRDCYEAFVIYNFLSLCYEYLGGESAIMAEIRGKPIESSCIYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAIITVILQAFGKYRDGDFNVASGYLYVTIIYNISVSLSLYALFLFYFSTRDLLSPYRPMLKFFMVKSVIFLSFWQGMLLAILEKCGAIPQISSPEVSVGEGTVAAGYQNFIICIEMFFAALALRHAFTYTVYMDKRLDSLGRC 314          
BLAST of Transmembrane protein 184C vs. Ensembl Xenopus
Match: fndc3c (fibronectin type III domain containing 3C [Source:Xenbase;Acc:XB-GENE-5957601])

HSP 1 Score: 371.703 bits (953), Expect = 4.455e-117
Identity = 188/397 (47.36%), Postives = 261/397 (65.74%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKS---KLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRH 1255
            NW+ W++P ++++Y V + + +P  I +          +AW I GIFV+  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY++ +W+AL +   AIY DT  ECYEAYVIYNFM FLL++L ++ P+   ++E K Q +HL P C CP W MG   +  C+ GVLQYT+VRP+TT+IA IC++ GVY   +F +  A+ YL I+NN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFWQAV  AIL    VISN   WK    +++++  Q+F IC+EMF+AAVAHHFSF+  PY  E   G   C  S LAM D+SD++ D+ E V++VG TV     K+ FN+  E      QNE T L++ +     S  S    + S H
Sbjct:    7 NWRRWIRPLVVLLYIVGLIVGVPICIWKLQKMEVGVHTKAWFIAGIFVLMTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWIALKYPDIAIYVDTCRECYEAYVIYNFMIFLLNYLTNRCPNLALVLEAKDQQRHLPPLCCCPPWAMGDVLLFRCKLGVLQYTVVRPVTTVIALICQLTGVYGEGDFSVKNAWTYLVIINNVSQVFAMYCLVLFYKVLKEELNPIQPVGKFLCVKMVVFVSFWQAVFIAILVKAGVISNTWEWK--KVQDVATGLQDFIICVEMFLAAVAHHFSFTYKPYVQEAEEG--SCFDSFLAMWDISDIRADISEQVRNVGRTVLGRPRKMFFNDDLE------QNEHTSLLSSSTQDPISAASSIPPSPSGH 393          
BLAST of Transmembrane protein 184C vs. Ensembl Xenopus
Match: fndc3c (fibronectin type III domain containing 3C [Source:Xenbase;Acc:XB-GENE-5957601])

HSP 1 Score: 323.168 bits (827), Expect = 1.941e-99
Identity = 171/397 (43.07%), Postives = 239/397 (60.20%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKS---KLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRH 1255
            NW+ W++P ++++Y V + + +P  I +          +AW I GIFV+  +PISLW IL+H+                          W+AL +   AIY DT  ECYEAYVIYNFM FLL++L ++ P+   ++E K Q +HL P C CP W MG   +  C+ GVLQYT+VRP+TT+IA IC++ GVY   +F +  A+ YL I+NN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFWQAV  AIL    VISN   WK    +++++  Q+F IC+EMF+AAVAHHFSF+  PY  E   G   C  S LAM D+SD++ D+ E V++VG TV     K+ FN+  E      QNE T L++ +     S  S    + S H
Sbjct:    7 NWRRWIRPLVVLLYIVGLIVGVPICIWKLQKMEVGVHTKAWFIAGIFVLMTIPISLWGILQHL--------------------------WIALKYPDIAIYVDTCRECYEAYVIYNFMIFLLNYLTNRCPNLALVLEAKDQQRHLPPLCCCPPWAMGDVLLFRCKLGVLQYTVVRPVTTVIALICQLTGVYGEGDFSVKNAWTYLVIINNVSQVFAMYCLVLFYKVLKEELNPIQPVGKFLCVKMVVFVSFWQAVFIAILVKAGVISNTWEWK--KVQDVATGLQDFIICVEMFLAAVAHHFSFTYKPYVQEAEEG--SCFDSFLAMWDISDIRADISEQVRNVGRTVLGRPRKMFFNDDLE------QNEHTSLLSSSTQDPISAASSIPPSPSGH 367          
BLAST of Transmembrane protein 184C vs. Ensembl Xenopus
Match: nkd1 (naked cuticle homolog 1 [Source:Xenbase;Acc:XB-GENE-480911])

HSP 1 Score: 196.438 bits (498), Expect = 3.693e-54
Identity = 118/354 (33.33%), Postives = 192/354 (54.24%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF--PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSR 1231
            A  I G FV  A+ I+   I  H+ SY+ P  QRHI+RIL++VPIYA  +WL+L F    +  +YFDT+ +CYEA+VIYNF++    +L  +  +    I  KP         CCL  K + +G  F+  C+   LQ+ +V+P+   +  I +  G Y   +F +   YLY+ I+ NIS   A+Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AI+     I  +++ ++S     +++ +QNF IC+EMF AA+A  ++F+   Y  +  + Q K  YSC   C         L+   +  + V+  +   +P    A+Q+  +++ L   + +++   +SR
Sbjct:   43 AQAISGFFVWTALLITCHQIYMHLRSYSCPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFDTVRDCYEAFVIYNFLSLCYEYLGGE-SNIMTEIRGKPIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAAVTVILQAFGKYRDGDFNVASGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAIMEKCGAIPKIDSAEVSVGEGTVAAGYQNFIICVEMFFAAIALRYAFTYKVYLDKRLDAQVKLLYSCTGRCAPMKSISSSLKETMNPHDIVQDAIHNFSP----AYQQYTQQSTLEQGSSWRNGQIISR 389          
BLAST of Transmembrane protein 184C vs. Ensembl Xenopus
Match: nkd1 (naked cuticle homolog 1 [Source:Xenbase;Acc:XB-GENE-480911])

HSP 1 Score: 189.889 bits (481), Expect = 8.158e-52
Identity = 106/288 (36.81%), Postives = 165/288 (57.29%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF--PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKC 1033
            A  I G FV  A+ I+   I  H+ SY+ P  QRHI+RIL++VPIYA  +WL+L F    +  +YFDT+ +CYEA+VIYNF++    +L  +  +    I  KP         CCL  K + +G  F+  C+   LQ+ +V+P+   +  I +  G Y   +F +   YLY+ I+ NIS   A+Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AI+     I  +++ ++S     +++ +QNF IC+EMF AA+A  ++F+   Y  +  + Q +C
Sbjct:   56 AQAISGFFVWTALLITCHQIYMHLRSYSCPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFDTVRDCYEAFVIYNFLSLCYEYLGGE-SNIMTEIRGKPIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAAVTVILQAFGKYRDGDFNVASGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAIMEKCGAIPKIDSAEVSVGEGTVAAGYQNFIICVEMFFAAIALRYAFTYKVYLDKRLDAQGRC 340          
BLAST of Transmembrane protein 184C vs. Ensembl Xenopus
Match: nkd1 (naked cuticle homolog 1 [Source:Xenbase;Acc:XB-GENE-480911])

HSP 1 Score: 189.119 bits (479), Expect = 1.087e-51
Identity = 106/288 (36.81%), Postives = 165/288 (57.29%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF--PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKC 1033
            A  I G FV  A+ I+   I  H+ SY+ P  QRHI+RIL++VPIYA  +WL+L F    +  +YFDT+ +CYEA+VIYNF++    +L  +  +    I  KP         CCL  K + +G  F+  C+   LQ+ +V+P+   +  I +  G Y   +F +   YLY+ I+ NIS   A+Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AI+     I  +++ ++S     +++ +QNF IC+EMF AA+A  ++F+   Y  +  + Q +C
Sbjct:   40 AQAISGFFVWTALLITCHQIYMHLRSYSCPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFDTVRDCYEAFVIYNFLSLCYEYLGGE-SNIMTEIRGKPIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAAVTVILQAFGKYRDGDFNVASGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAIMEKCGAIPKIDSAEVSVGEGTVAAGYQNFIICVEMFFAAIALRYAFTYKVYLDKRLDAQGRC 324          
BLAST of Transmembrane protein 184C vs. Ensembl Mouse
Match: Tmem184c (transmembrane protein 184C [Source:MGI Symbol;Acc:MGI:2384562])

HSP 1 Score: 358.221 bits (918), Expect = 7.985e-110
Identity = 168/350 (48.00%), Postives = 234/350 (66.86%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKS 1123
            NW+ W++P +++ Y   I +++P  I +F         ++W I GIF++  +P+SLW IL+H+V YT+P LQ+ IIRILWMVPIY++ +W+AL + K AIY DT  ECYEAYVIYNFM FL ++L  ++P+    +E K Q  H+ P C CP W MG   +  C+ GVLQYT+VRPITT+ A +CE+  VY    F    A+ YL ILNN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFWQAV+ A+L    VIS    W+    + +++  Q+F ICIEMF AA+AHH++FS  PY  E   G   C  S LAM DVSD++ D+ E V+ VG T++ 
Sbjct:    9 NWRRWIRPLLVLFYATTILVAVPICIWKFQKMKVGMHTKSWFIAGIFLLLTIPVSLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWVALVYPKIAIYVDTWRECYEAYVIYNFMIFLTNYLTIRFPNLILHLEAKDQQNHILPLCCCPPWAMGEMLLFRCKLGVLQYTVVRPITTVTALVCEILDVYDEGNFGFSNAWTYLVILNNLSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVLIALLVKLGVISEKRTWEWQSAEAVATGLQDFIICIEMFFAAIAHHYTFSYKPYVHEAEEG--SCFDSFLAMWDVSDIRDDISEQVRRVGRTMRG 356          
BLAST of Transmembrane protein 184C vs. Ensembl Mouse
Match: Tmem184c (transmembrane protein 184C [Source:MGI Symbol;Acc:MGI:2384562])

HSP 1 Score: 184.111 bits (466), Expect = 3.083e-52
Identity = 87/180 (48.33%), Postives = 123/180 (68.33%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTI 613
            NW+ W++P +++ Y   I +++P  I +F         ++W I GIF++  +P+SLW IL+H+V YT+P LQ+ IIRILWMVPIY++ +W+AL + K AIY DT  ECYEAYVIYNFM FL ++L  ++P+    +E K Q  H+ P C CP W MG   +  C+ GVLQYT+VRPITT+
Sbjct:   49 NWRRWIRPLLVLFYATTILVAVPICIWKFQKMKVGMHTKSWFIAGIFLLLTIPVSLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWVALVYPKIAIYVDTWRECYEAYVIYNFMIFLTNYLTIRFPNLILHLEAKDQQNHILPLCCCPPWAMGEMLLFRCKLGVLQYTVVRPITTV 228          
BLAST of Transmembrane protein 184C vs. Ensembl Mouse
Match: Tmem184b (transmembrane protein 184b [Source:MGI Symbol;Acc:MGI:2445179])

HSP 1 Score: 181.415 bits (459), Expect = 4.368e-49
Identity = 101/287 (35.19%), Postives = 163/287 (56.79%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKC 1033
            A  I G FV  A+ I+   I  H+  Y++P  QRHI+RIL++VPIYA  +WL+L F    +  +YF T+ +CYEA+VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+  +   I +  G Y   +F +   YLY+ I+ NIS   A+Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AIL     I  + + ++S     +++ +Q+F IC+EMF AA+A   +F+   Y  +  + Q +C
Sbjct:   46 AQAISGFFVWTALLITCHQIYMHLRCYSRPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEAFVIYNFLSLCYEYLGGESAIMSEIRGKAIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAVSTVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKINSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRC 330          
BLAST of Transmembrane protein 184C vs. Ensembl Mouse
Match: Tmem184b (transmembrane protein 184b [Source:MGI Symbol;Acc:MGI:2445179])

HSP 1 Score: 181.415 bits (459), Expect = 4.368e-49
Identity = 101/287 (35.19%), Postives = 163/287 (56.79%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKC 1033
            A  I G FV  A+ I+   I  H+  Y++P  QRHI+RIL++VPIYA  +WL+L F    +  +YF T+ +CYEA+VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+  +   I +  G Y   +F +   YLY+ I+ NIS   A+Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AIL     I  + + ++S     +++ +Q+F IC+EMF AA+A   +F+   Y  +  + Q +C
Sbjct:   46 AQAISGFFVWTALLITCHQIYMHLRCYSRPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEAFVIYNFLSLCYEYLGGESAIMSEIRGKAIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAVSTVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKINSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRC 330          
BLAST of Transmembrane protein 184C vs. Ensembl Mouse
Match: Tmem184b (transmembrane protein 184b [Source:MGI Symbol;Acc:MGI:2445179])

HSP 1 Score: 177.178 bits (448), Expect = 1.205e-47
Identity = 100/284 (35.21%), Postives = 161/284 (56.69%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQ 1024
            A  I G FV  A+ I+   I  H+  Y++P  QRHI+RIL++VPIYA  +WL+L F    +  +YF T+ +CYEA+VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+  +   I +  G Y   +F +   YLY+ I+ NIS   A+Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AIL     I  + + ++S     +++ +Q+F IC+EMF AA+A   +F+   Y  +  + Q
Sbjct:   46 AQAISGFFVWTALLITCHQIYMHLRCYSRPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEAFVIYNFLSLCYEYLGGESAIMSEIRGKAIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAVSTVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKINSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQ 327          
BLAST of Transmembrane protein 184C vs. UniProt/SwissProt
Match: sp|Q5ZMP3|T184C_CHICK (Transmembrane protein 184C OS=Gallus gallus OX=9031 GN=TMEM184C PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 6.699e-117
Identity = 187/397 (47.10%), Postives = 256/397 (64.48%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKS---KLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRH 1255
            NW+ W++P ++++Y V + + +P  + E          +AW I GIF++  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FL ++L ++YP+   +IE K Q +HL P C CP W MG   +  C+ GVLQYT+VRP TTIIA ICE+ GVY    F  D A+ YL ILNN+SQ++AMY L++FY+  + EL P++P+ KFLCVK VVF+SFWQAV+ A+L    VIS    W+    + +++  Q+F IC+EMF+AA+AHH+SFS  PY  E   G   C  S LAM D+SD++ D+ E V++VG TV     K+ F    E      QNE T L++ +     SD S    +   H
Sbjct:    7 NWRRWIRPLVVLLYIVGLLVVVPLCVWELQKLEVGIHTKAWFIAGIFLLMTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPNIAIYVDTCRECYEAYVIYNFMVFLSNYLTNRYPNLVLIIEAKDQQRHLPPLCCCPSWAMGEVLLFRCKLGVLQYTVVRPFTTIIALICELVGVYDEGNFSFDNAWTYLVILNNMSQLFAMYCLVLFYKVLREELNPIQPVGKFLCVKMVVFVSFWQAVLIALLVKVGVISEKHTWEWQSVEAVATGLQDFIICVEMFLAAIAHHYSFSYKPYVQEAEEG--SCFDSFLAMWDISDIRADISEQVRNVGRTVLGQPRKMFFAEDHE------QNEHTSLLSSSTQDPISDASSMPSSPMGH 395          
BLAST of Transmembrane protein 184C vs. UniProt/SwissProt
Match: sp|Q28CV2|T184C_XENTR (Transmembrane protein 184C OS=Xenopus tropicalis OX=8364 GN=tmem184c PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.360e-116
Identity = 188/397 (47.36%), Postives = 261/397 (65.74%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKS---KLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRH 1255
            NW+ W++P ++++Y V + + +P  I +          +AW I GIFV+  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY++ +W+AL +   AIY DT  ECYEAYVIYNFM FLL++L ++ P+   ++E K Q +HL P C CP W MG   +  C+ GVLQYT+VRP+TT+IA IC++ GVY   +F +  A+ YL I+NN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFWQAV  AIL    VISN   WK    +++++  Q+F IC+EMF+AAVAHHFSF+  PY  E   G   C  S LAM D+SD++ D+ E V++VG TV     K+ FN+  E      QNE T L++ +     S  S    + S H
Sbjct:    7 NWRRWIRPLVVLLYIVGLIVGVPICIWKLQKMEVGVHTKAWFIAGIFVLMTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWIALKYPDIAIYVDTCRECYEAYVIYNFMIFLLNYLTNRCPNLALVLEAKDQQRHLPPLCCCPPWAMGDVLLFRCKLGVLQYTVVRPVTTVIALICQLTGVYGEGDFSVKNAWTYLVIINNVSQVFAMYCLVLFYKVLKEELNPIQPVGKFLCVKMVVFVSFWQAVFIAILVKAGVISNTWEWK--KVQDVATGLQDFIICVEMFLAAVAHHFSFTYKPYVQEAEEG--SCFDSFLAMWDISDIRADISEQVRNVGRTVLGRPRKMFFNDDLE------QNEHTSLLSSSTQDPISAASSIPPSPSGH 393          
BLAST of Transmembrane protein 184C vs. UniProt/SwissProt
Match: sp|Q9NVA4|T184C_HUMAN (Transmembrane protein 184C OS=Homo sapiens OX=9606 GN=TMEM184C PE=1 SV=2)

HSP 1 Score: 370.933 bits (951), Expect = 3.143e-116
Identity = 187/396 (47.22%), Postives = 255/396 (64.39%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNN--PSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRH 1255
            NW+ W++P + +IY V I +++P  + E          +AW I GIF++  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FL ++L ++YP+   ++E K Q KH  P C CP W MG   +  C+ GVLQYT+VRP TTI+A ICE+ G+Y    F    A+ YL I+NN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFWQAVV A+L    VIS    W+    + +++  Q+F ICIEMF+AA+AHH++FS  PY  E   G   C  S LAM DVSD++ D+ E V+HVG TV+   P     P +    Q QNE T L++ +   + S  S    +   H
Sbjct:    9 NWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIEMFLAAIAHHYTFSYKPYVQEAEEG--SCFDSFLAMWDVSDIRDDISEQVRHVGRTVRGH-PRKKLFPED----QDQNEHTSLLSSSSQDAISIASSMPPSPMGH 397          
BLAST of Transmembrane protein 184C vs. UniProt/SwissProt
Match: sp|Q6GQE1|T184C_XENLA (Transmembrane protein 184C OS=Xenopus laevis OX=8355 GN=tmem184c PE=2 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 4.651e-116
Identity = 186/397 (46.85%), Postives = 261/397 (65.74%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKS---KLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRH 1255
            NW+ W++P ++++Y + + + +P  I +          +AW I GIFV+  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY++ +W+AL +   AIY DT  ECYEAYVIYNFM FLL++L ++ P+   ++E K Q +HL P C CP W MG   +  C+ GVLQYT+VRP+TT+IA IC++ GVY   +F +  A+ YL I+NN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFWQAV  AIL    VISN   WK    +++++  Q+F IC+EMF+AAVAHH+SF+  PY  E   G   C  S LAM D+SD++ D+ E V++VG TV     K+ FN+  E      QNE T L++ +     S  S    + S H
Sbjct:    7 NWRKWIRPLVVLLYILGLIVGVPICIWKLQKMEVGVHTKAWFIAGIFVLMTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWIALKYPDIAIYVDTCRECYEAYVIYNFMIFLLNYLTNRCPNLALVLEAKDQQRHLPPLCCCPPWAMGDVLLFRCKLGVLQYTVVRPVTTVIALICQLTGVYGEGDFSVKNAWTYLVIINNVSQVFAMYCLVLFYKVLKEELNPIQPVGKFLCVKMVVFVSFWQAVFIAILVKAGVISNTWEWKRV--QDVATGLQDFIICVEMFLAAVAHHYSFTYKPYVQEAEEG--SCFDSFLAMWDISDIRADISEQVRNVGRTVLGRPRKMFFNDDPE------QNEHTSLLSSSTQDPISAASSIPPSPSGH 393          
BLAST of Transmembrane protein 184C vs. UniProt/SwissProt
Match: sp|Q5RET6|T184C_PONAB (Transmembrane protein 184C OS=Pongo abelii OX=9601 GN=TMEM184C PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 3.712e-115
Identity = 186/396 (46.97%), Postives = 254/396 (64.14%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNN--PSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRH 1255
            NW+ W++P + +IY V I +++P  + E          +AW I GIF++  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FL ++L ++YP+   ++E K Q KH  P C CP W MG   +  C+ GVLQYT+VRP TTI+A ICE+ G+Y    F    A+ YL I+NN+SQ++AMY L++FY+  K EL P++P+ KFLCVK VVF+SFWQAVV A+L    VIS    W+    + +++  Q+F ICIEMF+AA+AHH++FS  PY  E   G   C  S LAM DVSD++ D+ E V+ VG TV+   P     P +    Q QNE T L++ +   + S  S    +   H
Sbjct:    9 NWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIEMFLAAIAHHYTFSYKPYVQEAEEG--SCFDSFLAMWDVSDIRDDISEQVRRVGRTVRGH-PRKKLFPED----QDQNEHTSLLSSSSQDAISIASSMPPSPMGH 397          
BLAST of Transmembrane protein 184C vs. TrEMBL
Match: G4VIF5 (Putative organic solute transporter OS=Schistosoma mansoni OX=6183 GN=Smp_126920 PE=4 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 6.031e-146
Identity = 219/395 (55.44%), Postives = 295/395 (74.68%), Query Frame = 2
Query:   71 MNWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQP-KCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQR-QNEETPLINYAGYQSDSDVSRYSDNES 1249
            M+W+ ++KP  ++ Y ++ICI+LPF+I +   + A +   AW + G+FV+GA+PISLWTI+EH+++YT P LQRHIIRILWMVPIYA+ AW+AL F   AIYFDTL ECYEAYVIYNF+AFLL++L+ ++PD  Y+IEQKPQ+KHL P C    W MGR FI+ CRHG LQYT++RP+TT IA ICEM GVY   +F    A+LYL I+NN+SQIWA+Y L+MFYRCT+ EL P+KP++KFLCVKFVVF+SFWQ+++ A+L AT VI  VEAWKL D + I    QNF ICIEMFIAA+AHHFSF+ TPY   + N +P  CCYS  +M DVSD++RD++EHV+H+G++V+    F++  ++S  +R       +++    + D +   Y DNE+
Sbjct:    1 MSWRAFIKPVFVVCYSLLICITLPFLILKLYEKSAPAIVSAWFVAGLFVLGAIPISLWTIIEHMINYTNPLLQRHIIRILWMVPIYAVDAWMALIFPSFAIYFDTLRECYEAYVIYNFLAFLLNYLRSEFPDLRYVIEQKPQMKHLPPFCFFSSWKMGRVFIDHCRHGALQYTVIRPLTTAIALICEMVGVYGEGDFSFRHAFLYLTIINNVSQIWALYCLVMFYRCTRLELSPMKPVAKFLCVKFVVFMSFWQSILIAVLAATGVIRKVEAWKLYDVQSIGIALQNFAICIEMFIAAIAHHFSFTWTPY--VDPNSEPTSCCYSWRSMWDVSDMRRDVVEHVRHIGHSVR-HFNFSSDRQLSRCRRLSGTYHQVVSLDADEVDCNNIVYCDNET 392          
BLAST of Transmembrane protein 184C vs. TrEMBL
Match: A0A4S2LJW8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008359 PE=4 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 3.974e-145
Identity = 211/350 (60.29%), Postives = 273/350 (78.00%), Query Frame = 2
Query:   71 MNWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVK 1120
            M W+ W+KP  +++Y +I+C++LP +I EF N  + +   AW IGG+FV+GAVPISLWTIL+H+++YTKPYLQRHIIRILWMVPIYAL AW AL F   AIYFDTL ECYEAYVIYNF+AFLL++L+H++PDF Y+IEQKPQVKHL P C CP W MGR+FI+ CRHG LQYT++RPITT IA IC+  GVY   +F    A++YL I+NN+SQ+WA+Y LI+FY+CTK EL+P+ P+SKFLCVKFVVF+SFWQ+++  IL    V  +V+ W+++D   I  + QNF ICIEMF AA+AHHFSFS  PY  ++      CC S  +M DVSD++RD+ EHV+HVG+TV+
Sbjct:    1 MRWRSWVKPAFIMVYSLILCVALPLLIIEFRNS-SPTVVSAWFIGGVFVLGAVPISLWTILDHLINYTKPYLQRHIIRILWMVPIYALDAWFALKFPSSAIYFDTLRECYEAYVIYNFLAFLLNYLRHEHPDFIYVIEQKPQVKHLIPFCCCPNWTMGRRFIDHCRHGALQYTVIRPITTAIALICDRLGVYGEGDFNFKHAFVYLTIINNVSQVWALYCLILFYQCTKEELRPMSPVSKFLCVKFVVFMSFWQSILIFILAVAGVFKDVKIWEMTDIASIGIVLQNFAICIEMFFAALAHHFSFSHLPY-VDQRAPNVDCCTSWWSMWDVSDMRRDLFEHVRHVGHTVR 348          
BLAST of Transmembrane protein 184C vs. TrEMBL
Match: A0A504YDU5 (Putative organic solute transporter ostalpha OS=Fasciola gigantica OX=46835 GN=FGIG_02735 PE=4 SV=1)

HSP 1 Score: 454.136 bits (1167), Expect = 5.858e-145
Identity = 213/350 (60.86%), Postives = 272/350 (77.71%), Query Frame = 2
Query:   71 MNWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVK 1120
            M+W+ W+KP  + +Y ++ICI LP ++ EF    + +   AW IGGIFV+GAVPISLWTIL+H++ YTKPYLQRHIIRILWMVPIYAL AWLAL F   AI+FDTL ECYEAYVIYNF+AFLL++L+H+YPDF Y++EQK QVKHL P C C +W MGR+FI+ CRHG LQYT++RPITT IA ICE+AGVY   EF    A+LYL I+NNISQ+WA+Y LI+FY+C K EL+P+ P+SKF+CVKFVVF+SFWQ+++  IL  + V  +V+ W++ D K I  + QNF ICIEMF AA+AHHFSFS  PY  +    Q  CC S  +M DVSD++RD+ EHV+H+GNT++
Sbjct:    1 MDWRTWIKPLFIGLYTILICIVLPLLVIEFRKT-SPTVVSAWFIGGIFVLGAVPISLWTILDHLIHYTKPYLQRHIIRILWMVPIYALDAWLALKFPSSAIFFDTLRECYEAYVIYNFLAFLLNYLRHEYPDFVYLVEQKEQVKHLPPFCCCKQWTMGRQFIDHCRHGTLQYTVIRPITTAIALICELAGVYGEAEFSFRQAFLYLTIINNISQVWALYCLILFYKCLKEELRPMNPVSKFICVKFVVFMSFWQSILIFILAVSGVFKDVKIWEMHDVKSIGIVLQNFAICIEMFFAALAHHFSFSHQPY-VDPNAPQGNCCTSWWSMWDVSDMRRDVFEHVRHIGNTLR 348          
BLAST of Transmembrane protein 184C vs. TrEMBL
Match: A0A4S2LJH4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008359 PE=4 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 1.108e-143
Identity = 209/348 (60.06%), Postives = 270/348 (77.59%), Query Frame = 2
Query:   71 MNWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNT 1114
            M W+ W+KP  +++Y +I+C++LP +I EF N  + +   AW IGG+FV+GAVPISLWTIL+H+++YTKPYLQRHIIRILWMVPIYAL AW AL F   AIYFDTL ECYEAYVIYNF+AFLL++L+H++PDF Y+IEQKPQVKHL P C CP W MGR+FI+ CRHG LQYT++RPITT IA IC+  GVY   +F    A++YL I+NN+SQ+WA+Y LI+FY+CTK EL+P+ P+SKFLCVKFVVF+SFWQ+++  IL    V  +V+ W+++D   I  + QNF ICIEMF AA+AHHFSFS  PY  ++      CC S  +M DVSD++RD+ EHV+HVG +
Sbjct:    1 MRWRSWVKPAFIMVYSLILCVALPLLIIEFRNS-SPTVVSAWFIGGVFVLGAVPISLWTILDHLINYTKPYLQRHIIRILWMVPIYALDAWFALKFPSSAIYFDTLRECYEAYVIYNFLAFLLNYLRHEHPDFIYVIEQKPQVKHLIPFCCCPNWTMGRRFIDHCRHGALQYTVIRPITTAIALICDRLGVYGEGDFNFKHAFVYLTIINNVSQVWALYCLILFYQCTKEELRPMSPVSKFLCVKFVVFMSFWQSILIFILAVAGVFKDVKIWEMTDIASIGIVLQNFAICIEMFFAALAHHFSFSHLPY-VDQRAPNVDCCTSWWSMWDVSDMRRDLFEHVRHVGKS 346          
BLAST of Transmembrane protein 184C vs. TrEMBL
Match: A0A0X3Q949 (Transmembrane protein 184C OS=Schistocephalus solidus OX=70667 GN=T184C PE=4 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 2.566e-142
Identity = 217/379 (57.26%), Postives = 276/379 (72.82%), Query Frame = 2
Query:   77 WKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTV---KSKLPFNNPSEVSAFQRQNEETPLINYAG 1204
            WK W+KP  +IIY V +C+ LPFII    NE   S   AW +GG FV+GA+PISLWTILEH+++YTKP+LQR+IIRILWMVPIYA  AW AL F   AIYFDTL ECYEAY IYNF+AFLL++L+ +YP+    +EQK QVKH+ P C C  WPMG +FI  CRHGVLQYT++RPITTIIA ICE+ GVY    F    AY+YL ++NNISQ+WA+Y L++FY+C K ELKP+ P+SKF+CVKFVVF+SFWQ+V+ +IL A+ +I  VEAWKL D + I    QNF ICIEMFIAAVAHHF+FS+ PYR + +  +  CC S  +M DVSDVKRD+++HV+HVG+ V    S   F+ P   +     ++   +  + G
Sbjct:    5 WKKWVKPAFIIIYVVGLCVGLPFIILNLRNEPTQSMIFAWFVGGFFVLGAIPISLWTILEHLINYTKPHLQRNIIRILWMVPIYATNAWFALRFPHTAIYFDTLRECYEAYAIYNFLAFLLNYLRREYPELNQHLEQKQQVKHIPPLCCCRPWPMGSQFIEHCRHGVLQYTVIRPITTIIALICEVCGVYGETNFSYKYAYVYLTVINNISQVWALYCLVLFYQCMKAELKPMNPVSKFVCVKFVVFMSFWQSVLISILAASGIIEKVEAWKLYDVRSIGIALQNFAICIEMFIAAVAHHFAFSVAPYR-DTSIPRSSCCTSWWSMLDVSDVKRDVVQHVRHVGSRVGFIGSDGRFSGPPRTAIVPGLSKSRAMTAHTG 382          
BLAST of Transmembrane protein 184C vs. Ensembl Cavefish
Match: ENSAMXT00000005060.2 (transmembrane protein 184C [Source:NCBI gene;Acc:103024494])

HSP 1 Score: 358.992 bits (920), Expect = 1.377e-112
Identity = 184/412 (44.66%), Postives = 259/412 (62.86%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKS---KLPFNNPSEVSAFQRQNEETPLINYAGYQS---------DSDVSRYSDNESRHKPNSRS 1273
            NW+ W++P ++++Y +++ ++LP    E +     +  +AW I G+FV   +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNF+ FLL+FL+ QYP    ++E + Q   L P C CP W MG   +  C+ GVLQYT VRP+TT++A +C++ GVY    F    A+ YL I+NN SQ++AMY L++FYR  + EL PL+P+ KFLCVK VVF SFWQAV+ A+L    VIS    W+    + +++  Q+F ICIEMF+AA+AHH+SFS  PY  E+  G   C  S LAM DVSD++ D+ E V+++G TV     KL F + +++     Q E T L++   ++           S   +Y        P SRS
Sbjct:    7 NWRRWIRPLVVLVYALLVAVALPLGAWELHRAEVGTHTKAWFIAGVFVFMTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPSIAIYVDTCRECYEAYVIYNFLMFLLNFLETQYPSLPLILEVQEQRSLLPPFCCCPPWAMGEVLLFRCKLGVLQYTAVRPVTTVVALVCQLCGVYDEGNFSFRNAWTYLVIINNASQLFAMYCLLLFYRTLREELSPLRPVGKFLCVKMVVFASFWQAVLIALLVKVGVISEKHTWEWESVEAVATGLQDFVICIEMFLAAIAHHYSFSYRPYVREDEEG--SCFDSFLAMLDVSDIRADISEQVRNMGRTVLGRPRKLFFGSEADIV----QGEHTGLLSGTSHERLGVDPLSVPASPQGQYQGLGQTDTPRSRS 412          
BLAST of Transmembrane protein 184C vs. Ensembl Cavefish
Match: TMEM184C (transmembrane protein 184C [Source:HGNC Symbol;Acc:HGNC:25587])

HSP 1 Score: 332.798 bits (852), Expect = 5.012e-103
Identity = 185/404 (45.79%), Postives = 253/404 (62.62%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSD----VSRYSDNESRHKPNSRS 1273
            NW+ W++P ++++Y +++ + LP  I E       +  +AW I GIFV   +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FLL++L  QYP    M+E + Q +HL P C CP WPMG   +  C+ GVLQYT+VRP+TT+IA IC++ GVY    F    A+ YL I+NN+SQ++AMY L++FY+  + EL P+KP+ KFLCVK VVF+SFWQAVV A+L                   +++  Q+F IC+EMF+AA+AHHFSF+  PY  E   G   C  S LAM D+SD++ D+ E V++VG TV  +      S  S    ++E T L++  G  + S       RY        P+S S
Sbjct:    7 NWRRWIRPLVVLLYILLLLVVLPLCIWELQKSEVGTHNKAWFIAGIFVFMTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPSIAIYVDTCRECYEAYVIYNFMIFLLNYLGKQYPSLVLMLEVQEQQRHLPPLCCCPPWPMGEVLLLRCKLGVLQYTVVRPVTTVIALICQLCGVYDEGNFNSKNAWTYLVIVNNVSQLFAMYCLVLFYKALREELGPIKPVGKFLCVKLVVFVSFWQAVVIALLVKVGA--------------VATGLQDFIICVEMFLAAIAHHFSFTYKPYIQEAEEG--SCFDSFLAMWDISDIRADISEQVRNVGRTVMGR---PRKSYFSEEAEEDEHTGLLSDPGLDASSTPPSPSGRYHGLGRTATPHSYS 391          
BLAST of Transmembrane protein 184C vs. Ensembl Cavefish
Match: tmem184a (transmembrane protein 184A [Source:NCBI gene;Acc:103026872])

HSP 1 Score: 196.052 bits (497), Expect = 4.539e-54
Identity = 102/283 (36.04%), Postives = 166/283 (58.66%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISN---VEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNG 1021
            A  + GIFV  A+ I+   I  H+ SYT P  QR+I+RIL++VPIYA  +WL+L F    +  +YFD++ +CYEA+VIYNF++    +L  +      +  ++ Q   L+  C          F+  C+   LQ+ +V+PI  +I  + +  G YH  +F + G YLY+ I+ N+S   A+Y+L +FY  T   L+P +P+ KFL +K V+FLSFWQ +V AIL    VI     ++  ++     +++ +QNF ICIEMF A++A  ++F+   Y+ ++++ 
Sbjct:   65 AQALSGIFVWSALLITCHQIYSHLRSYTVPNEQRYILRILFIVPIYAFDSWLSLLFISNNQYYVYFDSVRDCYEAFVIYNFLSLSFEYLGGESAIMAEIRGKQIQSSCLYGTCCLAGMSYSIGFLRFCKQATLQFCVVKPIMAVITILLQAFGKYHDGDFNVTGGYLYITIIYNVSVSLALYALFLFYSATSDLLRPYEPVLKFLTIKSVIFLSFWQGMVLAILERCGVIPEALVIDGHQVG-AGTVAAGWQNFIICIEMFFASIALRYAFTYNVYQQKKSHA 346          
BLAST of Transmembrane protein 184C vs. Ensembl Cavefish
Match: tmem184a (transmembrane protein 184A [Source:NCBI gene;Acc:103026872])

HSP 1 Score: 196.052 bits (497), Expect = 4.539e-54
Identity = 102/283 (36.04%), Postives = 166/283 (58.66%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISN---VEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNG 1021
            A  + GIFV  A+ I+   I  H+ SYT P  QR+I+RIL++VPIYA  +WL+L F    +  +YFD++ +CYEA+VIYNF++    +L  +      +  ++ Q   L+  C          F+  C+   LQ+ +V+PI  +I  + +  G YH  +F + G YLY+ I+ N+S   A+Y+L +FY  T   L+P +P+ KFL +K V+FLSFWQ +V AIL    VI     ++  ++     +++ +QNF ICIEMF A++A  ++F+   Y+ ++++ 
Sbjct:   65 AQALSGIFVWSALLITCHQIYSHLRSYTVPNEQRYILRILFIVPIYAFDSWLSLLFISNNQYYVYFDSVRDCYEAFVIYNFLSLSFEYLGGESAIMAEIRGKQIQSSCLYGTCCLAGMSYSIGFLRFCKQATLQFCVVKPIMAVITILLQAFGKYHDGDFNVTGGYLYITIIYNVSVSLALYALFLFYSATSDLLRPYEPVLKFLTIKSVIFLSFWQGMVLAILERCGVIPEALVIDGHQVG-AGTVAAGWQNFIICIEMFFASIALRYAFTYNVYQQKKSHA 346          
BLAST of Transmembrane protein 184C vs. Ensembl Cavefish
Match: tmem184ba (transmembrane protein 184B [Source:NCBI gene;Acc:103023711])

HSP 1 Score: 182.956 bits (463), Expect = 1.104e-49
Identity = 104/286 (36.36%), Postives = 163/286 (56.99%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPK 1030
            A  + G FV  A+ ++   I  H+  Y  P  QRHI+RIL++VPIYA  +WL+L F    +  +YFDT+ +CYEA+VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+   I  I +  G Y   +F +   YLY+ I+ NIS   ++Y+L +FY  T+  L P  PM KFL VK V+FLSFWQ ++ AIL     I  + + ++S     +++ +QNF ICIEMF AA+A   +F+ T Y  +  + Q +
Sbjct:   60 AQALAGFFVWTALLLTCHQIYMHLRFYRSPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFDTVRDCYEAFVIYNFLSLCYEYLGGESAIMAEIRGKPIESSCIYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAAITVILQAFGKYRDGDFNVASGYLYVTIIYNISVSLSLYALFLFYFATRDLLSPYSPMLKFLMVKSVIFLSFWQGMLLAILEKCGAIPQISSAEVSVGEGTVAAGYQNFIICIEMFFAALALRHAFTFTVYMDKRLDSQGR 343          
BLAST of Transmembrane protein 184C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005098.1 (pep scaffold:Pmarinus_7.0:GL484128:170:5822:-1 gene:ENSPMAG00000004617.1 transcript:ENSPMAT00000005098.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 334.724 bits (857), Expect = 1.634e-105
Identity = 167/345 (48.41%), Postives = 229/345 (66.38%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVG 1108
            NW+ W++P ++ +Y +++ ++LP  + E       ++ +AW I GIFV   +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W AL F   AIY +T  ECYEAYVIYNFM FLL++L    PD    +  K  V+H  P C  P WPMG   +  C+ GVLQYT++RP+TT++A I E+  VY    F     + YL I+NNISQI+AMY LI+FYR  + EL+P++P+ KFLCVK VVF+SFWQAV+ A L   +VIS    W  +  + +++  Q+F ICIEM +AA+AHH+SFS   +       +  C  S LAM DVSDV+ D+LE V++VG
Sbjct:    7 NWRRWIRPLVVTMYVMLLLVALPLCVWELQRAEIKAQTQAWFIAGIFVFLTIPISLWGILQHLVHYTQPELQKPIIRILWMVPIYSLDSWFALKFPPIAIYLNTCRECYEAYVIYNFMVFLLNYLSGSQPDLARTLAAKEPVRHWPPLCCFPAWPMGEVMLFRCKLGVLQYTVIRPLTTVVALISELLKVYGEGNFSFHNVWSYLVIINNISQIFAMYCLILFYRTLREELQPIQPVGKFLCVKTVVFVSFWQAVLIAALVKLQVISGTLGW--NSVEALATGLQDFAICIEMLLAALAHHYSFSYKAF-VLVAEREVSCLDSFLAMWDVSDVRADVLEQVRNVG 348          
BLAST of Transmembrane protein 184C vs. Ensembl Sea Lamprey
Match: tmem184bb (transmembrane protein 184bb [Source:ZFIN;Acc:ZDB-GENE-070705-124])

HSP 1 Score: 178.333 bits (451), Expect = 2.883e-49
Identity = 97/265 (36.60%), Postives = 156/265 (58.87%), Query Frame = 2
Query:  248 ILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQA---IYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCP-KWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAIL---TATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETN 1018
            I  H+  Y+ P  QRHI+RIL++VPIYA  +WL+L F       IYFD++ +CYEA+VIYNF++    +L  +      +  +  +   ++  CCLC   + +G  F+  C+   LQ+ +V+P+  ++  I +  G Y   +F +   YLY+ I+ N+S   A+Y+L +FY  T+  L P +P+ KF  VK V+FLSFWQ ++ AIL    A  +I +++   ++    +++ +QNF ICIEMF AAVA  ++FS  PY  +  +
Sbjct:   15 IYVHLKHYSCPNEQRHIVRILFIVPIYAFDSWLSLLFFSNDQFYIYFDSVRDCYEAFVIYNFLSLCYEYLGGESAIMSEIRGKPIESSCIYGTCCLCGHNYSIG--FLRFCKQATLQFCVVKPLMAVVTLILQAFGKYRDGDFDVSNGYLYVTIIYNVSVSLALYALFLFYFATRELLSPFEPVLKFFTVKSVIFLSFWQGMLLAILEKCGAIPMIYSLDGKLVAGVGTVAAGYQNFIICIEMFFAAVALRYAFSHWPYLNKRVD 277          
BLAST of Transmembrane protein 184C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001491.1 (pep scaffold:Pmarinus_7.0:GL479705:5973:17510:-1 gene:ENSPMAG00000001346.1 transcript:ENSPMAT00000001491.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 5.817e-6
Identity = 54/255 (21.18%), Postives = 107/255 (41.96%), Query Frame = 2
Query:  278 PYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQ---KPQVKHLFPCCLC----PKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNG 1021
            P  ++ +I +    P+ AL + + L   + A++ D  +  Y A  I+ FM  +++    +Y     MI +    P      PCC C    P   M R+ +   + G  Q   +RP+   +  +    G +      +D  YL++ I++  + + ++Y + + +   +  L   K + KF+  + V+ L   Q  +F +      ++ V  +  S     S M Q   + +EMF+  +     +    Y TE  +G
Sbjct:   78 PRRRKTLIWVNGAPPVVALTSCIGLWVPRSAMFTDFASSIYFAVCIHQFMIMIIA----EYGGEEAMITRFKGIPIKTSTGPCCCCCLCLPNTTMSRRTLRILKMGTFQVAFLRPVLLFLGAVLWTNGNFMPGVMTVDNGYLWITIVSGTATVLSLYPIGILFNHARFNLANQKIIPKFVLNQSVLILCQLQGSIFTMCANMGSLTCVPPF--SARARASYMHQQLLV-VEMFVVGLLARCYYR-KRYGTELVDG 324          
BLAST of Transmembrane protein 184C vs. Ensembl Yeast
Match: YKR051W_mRNA (Putative protein of unknown function [Source:SGD;Acc:S000001759])

HSP 1 Score: 119.013 bits (297), Expect = 6.246e-29
Identity = 84/263 (31.94%), Postives = 128/263 (48.67%), Query Frame = 2
Query:  224 AVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYAL-CAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCC--LCPKWPMGRKF-INTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPY 1000
            A  IS +TI  H+++Y KPY QR  IRIL +VPI+++ CA   +       Y D + E YEA+VIY F  FL   L  +      +       +H  P    +C    +   F     + G+LQY   +P       IC        + ++L    ++LN+  NIS  W++YSL +F++C   EL P KP  KFLCVK ++F S+WQ+++   L  T  +      + S       +++N  +CIEM   A+ H  +F    Y
Sbjct:   21 ATIISFYTITRHLLNYRKPYEQRLSIRILLLVPIFSVSCASGIIKPEAAQFYVDPIREFYEAFVIYTFFTFLTLLLGGERNIITVLSLNHAPTRHPIPLIGKICKPIDLSDPFDFLFVKKGILQYVWFKPFYCFGTLIC--------SAWKLPKFEIFLNVFYNISVTWSLYSLALFWKCLYPELTPYKPWLKFLCVKLIIFASYWQSIIIQGLVVTGKLGTGNQDRTS-----GYVYKNGLLCIEMVPFAILHAVAFPWNKY 270          
BLAST of Transmembrane protein 184C vs. Ensembl Nematostella
Match: EDO47105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNA4])

HSP 1 Score: 328.561 bits (841), Expect = 1.085e-102
Identity = 162/348 (46.55%), Postives = 228/348 (65.52%), Query Frame = 2
Query:   71 MNWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNT 1114
            M W+ WL+P +   Y +++C++LP  + E +   AS+  EAW I G FV   +PISLW I++H+V+Y KP LQR I+RILWMVPIY++ +WL L F K AIY D+L ECYEAYVIYNF+  LL+FL  +  D   ++  KP + H FP C+   W M RKFI+ C+ GVL YT++R +TT+IAF  E+AG Y    F    A+ Y+ ++NN SQ+WA+Y L++ Y+  K EL PL+P  KFLC+K VVF SF     F       VIS  + W     +++++  Q+F ICIEM + AVAH++ FS  PY  + ++  P CC S ++MCDV+DV+ D+ EHV+ VG+T
Sbjct:    1 MGWRSWLRPALFFSYFLLLCVALPLSVWELHKLDASTHVEAWFIAGCFVFLTIPISLWGIVQHMVNYNKPDLQRRIVRILWMVPIYSIDSWLGLRFPKAAIYLDSLRECYEAYVIYNFITLLLAFLAMEC-DLDIVMMGKPPIAHFFPFCVFAPWRMNRKFISRCKQGVLSYTVIRILTTLIAFCTELAGKYDAGNFSFKSAWSYIVVINNCSQVWALYCLVLLYKALKEELSPLEPFGKFLCIKLVVFASFCLCSTF---VQIGVISEKKTWVFYTVEDVANGIQSFIICIEMLLFAVAHYYVFSYKPY-LDTSSPPPPCCASLVSMCDVTDVRDDVAEHVRTVGST 343          
BLAST of Transmembrane protein 184C vs. Ensembl Nematostella
Match: EDO42641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0U7])

HSP 1 Score: 190.66 bits (483), Expect = 1.687e-52
Identity = 116/354 (32.77%), Postives = 182/354 (51.41%), Query Frame = 2
Query:  143 FIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQA--IYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGR-KFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPY---RTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETP 1186
            F+ +E   + A++R     I G FV  A+ I+ + I +H+  YT P  QR I+RIL++VPIYA  +WL+L F +Q+  +YFD++ +CYEA+VIYNF++    +L  +       I  +P     F C  C         F+  C+   LQ+ +++PI   I  + +  G+Y   ++R D  YLY+ I+ NIS   A+Y+L +FY+ TK  L P  P+ KF  +K V+FLSFWQ VV A+     +I     +       I++ +QNF +CIEMF AA+A  ++F    Y   R     GQ     S       +   RD+++   H  N  +S   + N   +      +  +P
Sbjct:   19 FVTQEIFFQTAAARG----ISGFFVWSALLITCYQIYQHLRYYTNPSEQRWIVRILFIVPIYAFDSWLSLLFFEQSYYVYFDSVRDCYEAFVIYNFLSLCYEYLGGEMSIMT-EIRGRPIKSSWFSCTCCLAGSQYTILFLRFCKQATLQFCIIKPIMAFITLLLQSFGLYSDGDWRADRGYLYITIVYNISVSLALYALFLFYQATKDLLSPYYPVLKFFTIKSVIFLSFWQGVVLAVAEKAGLI---RTYNHISAGTIAAGYQNFIVCIEMFFAAIALRYAFPYMTYLSQRKLNQQGQGIALKSISKNLKQTMNPRDIVDDAIH--NFSRSYQHYANAQNLKTLGDDSSASP 362          
BLAST of Transmembrane protein 184C vs. Ensembl Medaka
Match: tmem184c (transmembrane protein 184C [Source:NCBI gene;Acc:101174078])

HSP 1 Score: 346.665 bits (888), Expect = 5.115e-108
Identity = 181/400 (45.25%), Postives = 261/400 (65.25%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSRS 1273
            +W+ W++P ++++Y +++ + LPF I E       +  +AW I GIFV+  +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +W+AL +   AIY DT  ECYEAYVIYNFM FLL++L++QYP    M+E + Q KHL P C CP WPMG   +  C+ GVLQYT+VRP+TT+IA IC++  VY    F    A+ YL I+NN+SQ++AMY L++FYR  K EL+P+KP+ KFLCVK VVF+SFWQA   A+L    +IS    W     + +++  Q+F IC+EMF+AA+AHHFSF+  PY  +    +  C  S LAM D+SDV+ D+ E V++VG TV  +      S     + + E + L++ A   + ++ +   + E  ++   R+
Sbjct:    7 DWRRWIRPLVVVLYILLLIVVLPFCIWELQKSGVGTHIKAWFIAGIFVLMTIPISLWGILQHLVHYTRPELQKPIIRILWMVPIYSLDSWIALKYPNIAIYVDTCRECYEAYVIYNFMTFLLNYLENQYPSLVLMLEVQEQQKHLPPLCCCPPWPMGEVLLLRCKLGVLQYTVVRPVTTVIALICQLCKVYDEGNFSSTNAWTYLVIINNMSQLFAMYCLVLFYRALKDELRPIKPVGKFLCVKMVVFVSFWQAAFIALLVKVGIISEKRTWDWQSVEAVATGLQDFIICVEMFLAAIAHHFSFTYKPYIQDAE--EVSCFDSFLAMWDISDVRADISEQVRNVGRTVMGR---PGKSYFGEGENECERSGLLSSASQDAITEAASSPNAEGHYQGLGRT 401          
BLAST of Transmembrane protein 184C vs. Ensembl Medaka
Match: TMEM184C (transmembrane protein 184C [Source:NCBI gene;Acc:101168743])

HSP 1 Score: 337.806 bits (865), Expect = 8.124e-105
Identity = 171/351 (48.72%), Postives = 235/351 (66.95%), Query Frame = 2
Query:   74 NWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSK 1126
             W+ W++P ++++Y +++   +P  I E   +   +  +AW I G+FV   +PISLW IL+H+V YT+P LQ+ IIRILWMVPIY+L +WL L +   AIY DT  ECYEAYVIYNF+ FLL+FL +QYP    M+E + Q  HL P C CP WPMG   +  C+ GVLQYT+VRP+TT+IA IC++ GVY    F    A+ YL I+NNISQ++AMY L++ YR  + EL P++P  KFLCVK VVF+SFWQAV+ A L    VIS+   W     + +++  Q+F ICIEMF+AA+AHH++F+  PY  E   G   C  S LAM D+SD++ D+ E V++VG T   +
Sbjct:    7 QWRRWIRPLVLVLYALLLVAVVPLCIWELQKDKVGTHNKAWFIAGVFVFLTIPISLWGILQHMVHYTQPELQKPIIRILWMVPIYSLDSWLGLRYPSLAIYVDTCRECYEAYVIYNFLVFLLNFLSNQYPSLVLMLEVQQQQSHLPPLCCCPPWPMGEVLLFRCKLGVLQYTVVRPVTTVIALICQLCGVYDEANFSFRSAWSYLVIINNISQLFAMYCLVLLYRALRDELTPIRPAGKFLCVKLVVFVSFWQAVLIAFLVKVGVISDKHTWDWDSVEAVATGLQDFIICIEMFLAAIAHHYTFTYKPYVQEAEEG--SCFDSFLAMWDLSDIRADVTEQVRNVGRTFLGR 355          
BLAST of Transmembrane protein 184C vs. Ensembl Medaka
Match: tmem184a (transmembrane protein 184A [Source:NCBI gene;Acc:101175321])

HSP 1 Score: 199.134 bits (505), Expect = 3.135e-55
Identity = 113/289 (39.10%), Postives = 172/289 (59.52%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIE--QKP-QVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISN---VEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPK 1030
            A  + GIFV  A+ I+   I  H+ SYT P  QR+IIRIL++VP+YA  +WL+L F    +  +YFD++ +CYEA+VIYNF++    +L  +    G M+E   KP Q   L+  C          F+  C+   LQ+ +V+PI  +I  I +  G YH  +F ++G YLY+ I+ N S   A+Y+L +F+  T   L+P +P+ KFL +K V+FLSFWQ +V AIL    VI N   ++  ++     +++ +QNF ICIEMF AA+A  ++F+ T Y+ E+ N  P+
Sbjct:   57 AQALSGIFVWSALLITCHQIYTHLRSYTVPNEQRYIIRILFIVPVYAFDSWLSLLFISNDQYYVYFDSIRDCYEAFVIYNFLSLSFEYLGGES---GIMLEIRGKPIQSSCLYGTCCLVGMSYSIGFLRFCKQATLQFCVVKPIMAVITIILQAFGKYHDGDFNVNGGYLYITIIYNFSVSLALYALFLFFFATSDLLRPYEPVLKFLTIKSVIFLSFWQGMVLAILERCSVIPNALFIDGHEVG-AGTVAAGWQNFIICIEMFFAAIALKYAFTCTVYQ-EKKNDVPE 340          
BLAST of Transmembrane protein 184C vs. Ensembl Medaka
Match: tmem184a (transmembrane protein 184A [Source:NCBI gene;Acc:101175321])

HSP 1 Score: 196.438 bits (498), Expect = 2.473e-54
Identity = 113/288 (39.24%), Postives = 171/288 (59.38%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIE--QKP-QVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISN---VEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQP 1027
            A  + GIFV  A+ I+   I  H+ SYT P  QR+IIRIL++VP+YA  +WL+L F    +  +YFD++ +CYEA+VIYNF++    +L  +    G M+E   KP Q   L+  C          F+  C+   LQ+ +V+PI  +I  I +  G YH  +F ++G YLY+ I+ N S   A+Y+L +F+  T   L+P +P+ KFL +K V+FLSFWQ +V AIL    VI N   ++  ++     +++ +QNF ICIEMF AA+A  ++F+ T Y+ E+ N  P
Sbjct:   57 AQALSGIFVWSALLITCHQIYTHLRSYTVPNEQRYIIRILFIVPVYAFDSWLSLLFISNDQYYVYFDSIRDCYEAFVIYNFLSLSFEYLGGES---GIMLEIRGKPIQSSCLYGTCCLVGMSYSIGFLRFCKQATLQFCVVKPIMAVITIILQAFGKYHDGDFNVNGGYLYITIIYNFSVSLALYALFLFFFATSDLLRPYEPVLKFLTIKSVIFLSFWQGMVLAILERCSVIPNALFIDGHEVG-AGTVAAGWQNFIICIEMFFAAIALKYAFTCTVYQ-EKKNDVP 339          
BLAST of Transmembrane protein 184C vs. Ensembl Medaka
Match: tmem184bb (transmembrane protein 184B [Source:NCBI gene;Acc:101175570])

HSP 1 Score: 185.267 bits (469), Expect = 2.259e-50
Identity = 119/371 (32.08%), Postives = 193/371 (52.02%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGF---RKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLF-PCCLCPK-WPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLS-DPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAG---YQSDSDVSRYSDNESRHKPNSRSE 1276
            A  I G FV  A+ I+   I  H+  Y+ P  QRHI+RIL++VPIYA  +WL+L F    +  +YFDT+ +CYEA+VIYNF++    +L  +      +  +  +   ++  CCL  K + +G  F+  C+   LQ+ +V+P+  ++  I +  G Y   +F +   YLY+ I+ NIS   ++Y+L +FY  T+  L P  P+ KF  VK V+FLSFWQ ++ AIL     I  + +   S     +++ +QNF ICIEMF AAVA   +F+   Y  +  +   +C      M  +S   ++ +     V + + +  P        A+Q+  +++ L    G    +S S++S   DNE     +S  E
Sbjct:   68 AQTISGFFVWTALLITCHQIYMHLRYYSSPNEQRHIVRILFIVPIYAFDSWLSLLFFTNEEYYVYFDTVRDCYEAFVIYNFLSLCYEYLGGESAIMAEIRGKPIESSCMYGTCCLWGKTYSIG--FLRFCKQATLQFCVVKPLMAMMTVILQAFGKYKDGDFNVASGYLYVTIIYNISVSLSLYALFLFYFATRELLVPYNPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPQINSANFSVGEGTVAAGYQNFIICIEMFFAAVALRHAFTYKVYMDKRLDSYGRCA----PMKSISSSLKETMNPGDMVQDAIHNFSP--------AYQQYTQQSTLERGGGPPLSRSHSNLSTRGDNEKTLLLSSDDE 424          
BLAST of Transmembrane protein 184C vs. Planmine SMEST
Match: SMESG000028913.1 (SMESG000028913.1)

HSP 1 Score: 1130.93 bits (2924), Expect = 0.000e+0
Identity = 592/592 (100.00%), Postives = 592/592 (100.00%), Query Frame = 2
Query: 1607 TIQQNHSKKGKNRSNCTHFNAQLKNNINKPHESPIATLNFAPIDIPALDSHKYKKNNNNNGVASKKQKKINQPNHEELKSKNNLRADDSLSVSTDSSNEEKIKELEINRNSKLLIIKPNKIKSRQQKSCNLCLKKLDVNDVSKRNIYGEFDENGSTKSNDSGTEISKNSIYPKHSGNVIEHNSFRSFENIGGSMETSINHFFAQNNSEKKDKMNLNQRKHLKSQPPKAECSSNDFKQFPQIVPSAVEINSEKLKTESKNESESDELIQWENESVTVIYPEDFSILSERTNEFSNFLGLNCNKDEFYQENTNSNIENWLSSANTFTVNNCKRFEPSNIDNKGPANNNLYKNYSEEINYQNDSIYDCNSSGNLFGNYYYKNVPTLHSERYISKCNESSTFLNNEFNQSDLFTREIPVNSLNNFISLELPGIAHGRKQSLLEYERRTQKDPIECDWLTXXXXXXXXXXXXXXKRQYDNYRLLPNSMDCYWXXXXXXXXXXXXXXXDKMWSNSDEMACRSNNNTENPLWLVEKSWNQIEPGSPHDPLACTLLPIGLLSNESSNGIFSNAPENLWKFKHDVTNASLPNNCELDPQEK 3382
            TIQQNHSKKGKNRSNCTHFNAQLKNNINKPHESPIATLNFAPIDIPALDSHKYKKNNNNNGVASKKQKKINQPNHEELKSKNNLRADDSLSVSTDSSNEEKIKELEINRNSKLLIIKPNKIKSRQQKSCNLCLKKLDVNDVSKRNIYGEFDENGSTKSNDSGTEISKNSIYPKHSGNVIEHNSFRSFENIGGSMETSINHFFAQNNSEKKDKMNLNQRKHLKSQPPKAECSSNDFKQFPQIVPSAVEINSEKLKTESKNESESDELIQWENESVTVIYPEDFSILSERTNEFSNFLGLNCNKDEFYQENTNSNIENWLSSANTFTVNNCKRFEPSNIDNKGPANNNLYKNYSEEINYQNDSIYDCNSSGNLFGNYYYKNVPTLHSERYISKCNESSTFLNNEFNQSDLFTREIPVNSLNNFISLELPGIAHGRKQSLLEYERRTQKDPIECDWLTNNNNNNAASAAAAAKRQYDNYRLLPNSMDCYWNGNHNNNNKSNSFINDKMWSNSDEMACRSNNNTENPLWLVEKSWNQIEPGSPHDPLACTLLPIGLLSNESSNGIFSNAPENLWKFKHDVTNASLPNNCELDPQEK
Sbjct: 1414 TIQQNHSKKGKNRSNCTHFNAQLKNNINKPHESPIATLNFAPIDIPALDSHKYKKNNNNNGVASKKQKKINQPNHEELKSKNNLRADDSLSVSTDSSNEEKIKELEINRNSKLLIIKPNKIKSRQQKSCNLCLKKLDVNDVSKRNIYGEFDENGSTKSNDSGTEISKNSIYPKHSGNVIEHNSFRSFENIGGSMETSINHFFAQNNSEKKDKMNLNQRKHLKSQPPKAECSSNDFKQFPQIVPSAVEINSEKLKTESKNESESDELIQWENESVTVIYPEDFSILSERTNEFSNFLGLNCNKDEFYQENTNSNIENWLSSANTFTVNNCKRFEPSNIDNKGPANNNLYKNYSEEINYQNDSIYDCNSSGNLFGNYYYKNVPTLHSERYISKCNESSTFLNNEFNQSDLFTREIPVNSLNNFISLELPGIAHGRKQSLLEYERRTQKDPIECDWLTNNNNNNAASAAAAAKRQYDNYRLLPNSMDCYWNGNHNNNNKSNSFINDKMWSNSDEMACRSNNNTENPLWLVEKSWNQIEPGSPHDPLACTLLPIGLLSNESSNGIFSNAPENLWKFKHDVTNASLPNNCELDPQEK 2005          
BLAST of Transmembrane protein 184C vs. Planmine SMEST
Match: SMESG000028913.1 (SMESG000028913.1)

HSP 1 Score: 1130.55 bits (2923), Expect = 0.000e+0
Identity = 592/592 (100.00%), Postives = 592/592 (100.00%), Query Frame = 2
Query: 1607 TIQQNHSKKGKNRSNCTHFNAQLKNNINKPHESPIATLNFAPIDIPALDSHKYKKNNNNNGVASKKQKKINQPNHEELKSKNNLRADDSLSVSTDSSNEEKIKELEINRNSKLLIIKPNKIKSRQQKSCNLCLKKLDVNDVSKRNIYGEFDENGSTKSNDSGTEISKNSIYPKHSGNVIEHNSFRSFENIGGSMETSINHFFAQNNSEKKDKMNLNQRKHLKSQPPKAECSSNDFKQFPQIVPSAVEINSEKLKTESKNESESDELIQWENESVTVIYPEDFSILSERTNEFSNFLGLNCNKDEFYQENTNSNIENWLSSANTFTVNNCKRFEPSNIDNKGPANNNLYKNYSEEINYQNDSIYDCNSSGNLFGNYYYKNVPTLHSERYISKCNESSTFLNNEFNQSDLFTREIPVNSLNNFISLELPGIAHGRKQSLLEYERRTQKDPIECDWLTXXXXXXXXXXXXXXKRQYDNYRLLPNSMDCYWXXXXXXXXXXXXXXXDKMWSNSDEMACRSNNNTENPLWLVEKSWNQIEPGSPHDPLACTLLPIGLLSNESSNGIFSNAPENLWKFKHDVTNASLPNNCELDPQEK 3382
            TIQQNHSKKGKNRSNCTHFNAQLKNNINKPHESPIATLNFAPIDIPALDSHKYKKNNNNNGVASKKQKKINQPNHEELKSKNNLRADDSLSVSTDSSNEEKIKELEINRNSKLLIIKPNKIKSRQQKSCNLCLKKLDVNDVSKRNIYGEFDENGSTKSNDSGTEISKNSIYPKHSGNVIEHNSFRSFENIGGSMETSINHFFAQNNSEKKDKMNLNQRKHLKSQPPKAECSSNDFKQFPQIVPSAVEINSEKLKTESKNESESDELIQWENESVTVIYPEDFSILSERTNEFSNFLGLNCNKDEFYQENTNSNIENWLSSANTFTVNNCKRFEPSNIDNKGPANNNLYKNYSEEINYQNDSIYDCNSSGNLFGNYYYKNVPTLHSERYISKCNESSTFLNNEFNQSDLFTREIPVNSLNNFISLELPGIAHGRKQSLLEYERRTQKDPIECDWLTNNNNNNAASAAAAAKRQYDNYRLLPNSMDCYWNGNHNNNNKSNSFINDKMWSNSDEMACRSNNNTENPLWLVEKSWNQIEPGSPHDPLACTLLPIGLLSNESSNGIFSNAPENLWKFKHDVTNASLPNNCELDPQEK
Sbjct: 1410 TIQQNHSKKGKNRSNCTHFNAQLKNNINKPHESPIATLNFAPIDIPALDSHKYKKNNNNNGVASKKQKKINQPNHEELKSKNNLRADDSLSVSTDSSNEEKIKELEINRNSKLLIIKPNKIKSRQQKSCNLCLKKLDVNDVSKRNIYGEFDENGSTKSNDSGTEISKNSIYPKHSGNVIEHNSFRSFENIGGSMETSINHFFAQNNSEKKDKMNLNQRKHLKSQPPKAECSSNDFKQFPQIVPSAVEINSEKLKTESKNESESDELIQWENESVTVIYPEDFSILSERTNEFSNFLGLNCNKDEFYQENTNSNIENWLSSANTFTVNNCKRFEPSNIDNKGPANNNLYKNYSEEINYQNDSIYDCNSSGNLFGNYYYKNVPTLHSERYISKCNESSTFLNNEFNQSDLFTREIPVNSLNNFISLELPGIAHGRKQSLLEYERRTQKDPIECDWLTNNNNNNAASAAAAAKRQYDNYRLLPNSMDCYWNGNHNNNNKSNSFINDKMWSNSDEMACRSNNNTENPLWLVEKSWNQIEPGSPHDPLACTLLPIGLLSNESSNGIFSNAPENLWKFKHDVTNASLPNNCELDPQEK 2001          
BLAST of Transmembrane protein 184C vs. Planmine SMEST
Match: SMESG000049447.1 (SMESG000049447.1)

HSP 1 Score: 973.385 bits (2515), Expect = 0.000e+0
Identity = 494/494 (100.00%), Postives = 494/494 (100.00%), Query Frame = 2
Query:   71 MNWKVWLKPCXXXXXXXXXXXSLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSRSEIKTERNXXXXXXXXXXXXXXXXLADLILSNQIGANASNSFSIDSKSSLNNHLMSSHESAVTLVPVREQIDDSFETSVSFCTSEKLPNVPGPR 1552
            MNWKVWLKPCIMIIYGVIICISLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSRSEIKTERNQSQSQQSIESIGSGSSLADLILSNQIGANASNSFSIDSKSSLNNHLMSSHESAVTLVPVREQIDDSFETSVSFCTSEKLPNVPGPR
Sbjct:    1 MNWKVWLKPCIMIIYGVIICISLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSRSEIKTERNQSQSQQSIESIGSGSSLADLILSNQIGANASNSFSIDSKSSLNNHLMSSHESAVTLVPVREQIDDSFETSVSFCTSEKLPNVPGPR 494          
BLAST of Transmembrane protein 184C vs. Planmine SMEST
Match: SMESG000049447.1 (SMESG000049447.1)

HSP 1 Score: 959.133 bits (2478), Expect = 0.000e+0
Identity = 473/473 (100.00%), Postives = 473/473 (100.00%), Query Frame = 2
Query:  134 SLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSRSEIKTERNXXXXXXXXXXXXXXXXLADLILSNQIGANASNSFSIDSKSSLNNHLMSSHESAVTLVPVREQIDDSFETSVSFCTSEKLPNVPGPR 1552
            SLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSRSEIKTERNQSQSQQSIESIGSGSSLADLILSNQIGANASNSFSIDSKSSLNNHLMSSHESAVTLVPVREQIDDSFETSVSFCTSEKLPNVPGPR
Sbjct:   11 SLPFIIKEFNNEHASSRKEAWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQAIYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVKSKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSRSEIKTERNQSQSQQSIESIGSGSSLADLILSNQIGANASNSFSIDSKSSLNNHLMSSHESAVTLVPVREQIDDSFETSVSFCTSEKLPNVPGPR 483          
BLAST of Transmembrane protein 184C vs. Planmine SMEST
Match: SMESG000009898.1 (SMESG000009898.1)

HSP 1 Score: 174.096 bits (440), Expect = 3.875e-47
Identity = 90/268 (33.58%), Postives = 153/268 (57.09%), Query Frame = 2
Query:  191 AWLIGGIFVMGAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQA---IYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCCLCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLDGAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFLSFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVAHHFSF 985
            A  + GI   GA+ +++  I  H+  Y+ P  QR I+RIL++VP+YA  +WL+L F       +YFD++ +CYEA+VIY+F++    +L  +      +  +  +  + F  C     P    F+  C+   LQ+ +V+P+ +I+  I + AG+Y    +     YLY+ ++ N+S   A+Y L++F+  T+  L+P  P+ KF  VK V+FLSFWQ V+ AIL  T ++ ++     ++   +++  QNF IC+EM  AA+A  F+F
Sbjct:   27 AQTVAGISGFGAILLTVHQIFLHLRFYSCPSEQRWIVRILFIVPLYAFQSWLSLMFLTHENYYVYFDSIRDCYEAFVIYSFLSLCYEYLGGESNIMNDLRGKLIEKSYTFCTCCFSGMPYTIGFLRFCKQATLQFCVVKPVASILTIILQAAGLYQHGNWNFRLGYLYITVIYNVSVSLALYGLLIFFFSTREMLRPYDPILKFSVVKSVIFLSFWQGVILAILEKTGIVPSLPN---TNSGTVAAGIQNFIICLEMLAAAIALRFAF 291          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 184C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM184C6.546e-11747.22transmembrane protein 184C [Source:HGNC Symbol;Acc... [more]
TMEM184C1.052e-8251.59transmembrane protein 184C [Source:HGNC Symbol;Acc... [more]
TMEM184A1.003e-4834.24transmembrane protein 184A [Source:HGNC Symbol;Acc... [more]
TMEM184B1.106e-4634.49transmembrane protein 184B [Source:HGNC Symbol;Acc... [more]
TMEM184B1.106e-4634.49transmembrane protein 184B [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F40E10.64.785e-4933.44pep chromosome:WBcel235:X:14703738:14706859:-1 gen... [more]
F40E10.64.785e-4933.44pep chromosome:WBcel235:X:14703733:14706857:-1 gen... [more]
F40E10.64.785e-4933.44pep chromosome:WBcel235:X:14703715:14706857:-1 gen... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG58509.015e-10743.41gene:FBgn0032172 transcript:FBtr0309210[more]
CG58502.353e-10643.55gene:FBgn0032172 transcript:FBtr0309211[more]
CG58503.422e-10647.61gene:FBgn0032172 transcript:FBtr0309209[more]
CG58503.422e-10647.61gene:FBgn0032172 transcript:FBtr0079890[more]
CG58503.605e-10647.61gene:FBgn0032172 transcript:FBtr0303901[more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem184c7.976e-10750.43transmembrane protein 184C [Source:ZFIN;Acc:ZDB-GE... [more]
tmem184c2.185e-10449.72transmembrane protein 184C [Source:ZFIN;Acc:ZDB-GE... [more]
tmem184a6.132e-5437.02transmembrane protein 184a [Source:ZFIN;Acc:ZDB-GE... [more]
tmem184ba1.544e-5036.24transmembrane protein 184ba [Source:ZFIN;Acc:ZDB-G... [more]
tmem184ba1.544e-5036.24transmembrane protein 184ba [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fndc3c4.455e-11747.36fibronectin type III domain containing 3C [Source:... [more]
fndc3c1.941e-9943.07fibronectin type III domain containing 3C [Source:... [more]
nkd13.693e-5433.33naked cuticle homolog 1 [Source:Xenbase;Acc:XB-GEN... [more]
nkd18.158e-5236.81naked cuticle homolog 1 [Source:Xenbase;Acc:XB-GEN... [more]
nkd11.087e-5136.81naked cuticle homolog 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmem184c7.985e-11048.00transmembrane protein 184C [Source:MGI Symbol;Acc:... [more]
Tmem184c3.083e-5248.33transmembrane protein 184C [Source:MGI Symbol;Acc:... [more]
Tmem184b4.368e-4935.19transmembrane protein 184b [Source:MGI Symbol;Acc:... [more]
Tmem184b4.368e-4935.19transmembrane protein 184b [Source:MGI Symbol;Acc:... [more]
Tmem184b1.205e-4735.21transmembrane protein 184b [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 184C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZMP3|T184C_CHICK6.699e-11747.10Transmembrane protein 184C OS=Gallus gallus OX=903... [more]
sp|Q28CV2|T184C_XENTR2.360e-11647.36Transmembrane protein 184C OS=Xenopus tropicalis O... [more]
sp|Q9NVA4|T184C_HUMAN3.143e-11647.22Transmembrane protein 184C OS=Homo sapiens OX=9606... [more]
sp|Q6GQE1|T184C_XENLA4.651e-11646.85Transmembrane protein 184C OS=Xenopus laevis OX=83... [more]
sp|Q5RET6|T184C_PONAB3.712e-11546.97Transmembrane protein 184C OS=Pongo abelii OX=9601... [more]
back to top
BLAST of Transmembrane protein 184C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VIF56.031e-14655.44Putative organic solute transporter OS=Schistosoma... [more]
A0A4S2LJW83.974e-14560.29Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YDU55.858e-14560.86Putative organic solute transporter ostalpha OS=Fa... [more]
A0A4S2LJH41.108e-14360.06Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0X3Q9492.566e-14257.26Transmembrane protein 184C OS=Schistocephalus soli... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000005060.21.377e-11244.66transmembrane protein 184C [Source:NCBI gene;Acc:1... [more]
TMEM184C5.012e-10345.79transmembrane protein 184C [Source:HGNC Symbol;Acc... [more]
tmem184a4.539e-5436.04transmembrane protein 184A [Source:NCBI gene;Acc:1... [more]
tmem184a4.539e-5436.04transmembrane protein 184A [Source:NCBI gene;Acc:1... [more]
tmem184ba1.104e-4936.36transmembrane protein 184B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005098.11.634e-10548.41pep scaffold:Pmarinus_7.0:GL484128:170:5822:-1 gen... [more]
tmem184bb2.883e-4936.60transmembrane protein 184bb [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000001491.15.817e-621.18pep scaffold:Pmarinus_7.0:GL479705:5973:17510:-1 g... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YKR051W_mRNA6.246e-2931.94Putative protein of unknown function [Source:SGD;A... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO471051.085e-10246.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426411.687e-5232.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 184C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem184c5.115e-10845.25transmembrane protein 184C [Source:NCBI gene;Acc:1... [more]
TMEM184C8.124e-10548.72transmembrane protein 184C [Source:NCBI gene;Acc:1... [more]
tmem184a3.135e-5539.10transmembrane protein 184A [Source:NCBI gene;Acc:1... [more]
tmem184a2.473e-5439.24transmembrane protein 184A [Source:NCBI gene;Acc:1... [more]
tmem184bb2.259e-5032.08transmembrane protein 184B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Transmembrane protein 184C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028913.10.000e+0100.00SMESG000028913.1[more]
SMESG000028913.10.000e+0100.00SMESG000028913.1[more]
SMESG000049447.10.000e+0100.00SMESG000049447.1[more]
SMESG000049447.10.000e+0100.00SMESG000049447.1[more]
SMESG000009898.13.875e-4733.58SMESG000009898.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015251 ID=SMED30015251|Name=Transmembrane protein 184C|organism=Schmidtea mediterranea sexual|type=transcript|length=3481bp
CTGATACTCAATTAAACAGCAATGTTTTAAATTATTTTATTCAAAATTAA
TTTTCAAAATTTTATATGAAATGAATTGGAAAGTATGGTTGAAGCCTTGT
ATAATGATTATTTATGGAGTTATTATTTGTATATCTTTGCCATTCATTAT
TAAAGAATTTAATAATGAACATGCAAGTTCTCGTAAAGAAGCATGGTTAA
TTGGTGGTATTTTTGTTATGGGGGCTGTTCCAATATCGCTTTGGACTATT
TTAGAACATGTAGTTAGTTATACAAAGCCCTATTTGCAAAGGCATATCAT
TAGAATTTTATGGATGGTTCCTATTTATGCATTATGCGCGTGGTTGGCGC
TTGGATTCAGAAAACAGGCCATTTATTTCGACACGTTAACAGAGTGCTAC
GAAGCTTACGTAATTTATAATTTCATGGCTTTCTTATTGAGTTTCCTAAA
ACATCAATATCCGGATTTCGGGTATATGATCGAACAGAAACCCCAAGTAA
AGCATTTGTTTCCCTGCTGTTTGTGTCCTAAATGGCCCATGGGACGCAAA
TTTATAAACACGTGTCGTCACGGCGTTCTCCAATACACTCTTGTCAGACC
CATCACGACAATTATTGCTTTCATATGTGAAATGGCGGGTGTTTATCACA
TGAATGAATTCCGATTGGATGGCGCTTATCTCTACCTGAATATTCTCAAT
AACATATCTCAAATTTGGGCCATGTATTCCCTCATCATGTTCTACCGATG
CACCAAGACAGAACTGAAACCACTCAAACCAATGTCGAAATTTCTCTGTG
TGAAATTTGTAGTTTTCCTGTCTTTTTGGCAGGCAGTCGTGTTCGCCATT
CTCACAGCTACCAAAGTAATAAGCAACGTTGAAGCATGGAAGCTCAGCGA
TCCAAAAGAAATATCCTCAATGTTCCAGAATTTTTTCATCTGTATTGAGA
TGTTCATTGCTGCCGTGGCGCACCATTTCTCGTTTTCCATTACTCCTTAT
CGAACTGAAGAAACAAATGGTCAACCAAAATGTTGTTACTCCTGTTTAGC
AATGTGTGACGTGTCAGATGTGAAGCGTGACATGTTGGAACACGTGAAAC
ATGTCGGAAATACCGTCAAGTCCAAACTACCTTTTAATAATCCAAGTGAA
GTCAGTGCATTTCAAAGACAAAACGAGGAAACCCCATTAATTAATTACGC
CGGCTACCAATCAGATTCAGACGTCTCTCGGTACTCTGATAATGAATCTC
GACATAAGCCGAATTCTCGATCAGAGATTAAAACCGAGAGAAATCAGAGC
CAAAGCCAGCAATCCATTGAAAGTATTGGTTCAGGCTCATCTCTGGCGGA
TTTAATTTTATCCAATCAAATCGGAGCGAATGCATCAAATTCATTTTCCA
TTGACAGTAAATCAAGTCTCAATAATCATCTAATGTCGAGCCATGAATCT
GCAGTCACATTGGTTCCTGTCAGGGAGCAAATCGACGACTCATTTGAAAC
CTCTGTTTCTTTCTGTACATCTGAAAAATTGCCAAACGTTCCGGGACCAA
GAAATGGCCACAATTCAAACAACAATAATAATCATAATAATAATAATAAT
AATAACACCATCCAACAGAATCATTCAAAGAAAGGTAAAAATCGATCGAA
TTGTACGCATTTCAATGCGCAATTGAAAAATAATATCAATAAACCACATG
AATCTCCAATCGCAACTTTGAATTTTGCACCAATCGATATACCGGCTCTG
GATTCTCACAAATACAAGAAAAATAATAATAATAACGGAGTCGCAAGTAA
AAAGCAAAAGAAAATCAACCAACCAAATCATGAGGAATTGAAATCGAAAA
ATAATTTAAGGGCCGATGACAGTTTGTCAGTAAGCACTGATAGTAGCAAT
GAAGAAAAGATTAAGGAACTGGAAATCAACAGGAACTCTAAATTGCTTAT
TATAAAACCCAATAAAATTAAATCGAGGCAACAAAAATCGTGTAATTTAT
GTTTGAAGAAACTTGATGTCAATGATGTTAGTAAACGAAATATTTACGGA
GAATTTGATGAGAACGGTTCAACTAAGTCCAATGATAGTGGAACTGAAAT
CAGCAAAAATAGCATCTATCCAAAACACTCAGGAAATGTCATAGAGCACA
ATAGCTTTCGTAGCTTTGAAAATATAGGCGGGTCTATGGAGACTTCAATA
AATCATTTTTTCGCACAGAATAATTCGGAAAAGAAAGACAAAATGAATTT
GAACCAAAGAAAACATTTAAAATCTCAACCGCCTAAAGCAGAATGCTCTT
CAAATGATTTTAAACAGTTTCCACAAATTGTTCCATCTGCTGTCGAAATA
AATTCTGAAAAGTTAAAAACCGAGTCAAAAAATGAAAGTGAGTCTGATGA
GTTAATACAGTGGGAAAATGAAAGTGTTACAGTTATATACCCAGAGGATT
TTTCAATTCTATCCGAAAGAACAAATGAGTTTTCTAATTTTCTCGGATTG
AATTGTAATAAAGATGAATTTTATCAAGAAAATACTAATTCTAACATCGA
GAATTGGCTTTCTTCTGCAAACACATTCACCGTAAACAATTGCAAACGAT
TTGAACCCAGTAATATCGATAATAAAGGCCCCGCAAACAATAATCTCTAT
AAAAACTATTCTGAAGAAATAAATTATCAAAATGATTCAATTTACGATTG
TAATTCTTCTGGTAATCTATTTGGAAATTATTATTACAAGAACGTACCGA
CATTGCATTCAGAGAGATATATTTCTAAATGTAATGAGAGTTCGACTTTT
TTGAATAATGAATTCAACCAATCAGATTTGTTTACTCGTGAAATTCCCGT
CAACAGTCTTAATAATTTCATTTCCCTTGAATTACCGGGAATAGCTCATG
GCCGTAAACAATCTTTGTTAGAGTATGAAAGAAGAACACAGAAAGATCCA
ATTGAATGTGATTGGTTGACGAATAACAATAACAACAACGCAGCTTCCGC
CGCCGCTGCCGCTAAAAGACAGTATGATAATTATCGATTGCTTCCCAATT
CAATGGATTGTTATTGGAATGGAAATCATAATAACAATAATAAAAGTAAT
TCTTTCATAAATGATAAAATGTGGAGTAATTCCGATGAAATGGCCTGTCG
AAGTAATAATAATACTGAAAACCCGCTGTGGTTGGTGGAAAAATCCTGGA
ATCAAATTGAACCCGGTAGTCCTCACGATCCTTTGGCATGTACCTTATTG
CCGATTGGCCTGTTATCAAATGAGAGTTCCAATGGAATATTTTCAAATGC
TCCAGAAAATCTCTGGAAGTTCAAACACGATGTTACTAATGCTTCTTTGC
CAAATAATTGTGAATTAGATCCCCAGGAAAAATAAATCATTGCGAATGTT
GAAATTTTAATTAATTCGATGCATTTTATTCGATTTTATGTTATAAATTA
ATAGAAGGACAAATATTTAAGTTTATTGCTG
back to top

protein sequence of SMED30015251-orf-1

>SMED30015251-orf-1 ID=SMED30015251-orf-1|Name=SMED30015251-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1105bp
MNWKVWLKPCIMIIYGVIICISLPFIIKEFNNEHASSRKEAWLIGGIFVM
GAVPISLWTILEHVVSYTKPYLQRHIIRILWMVPIYALCAWLALGFRKQA
IYFDTLTECYEAYVIYNFMAFLLSFLKHQYPDFGYMIEQKPQVKHLFPCC
LCPKWPMGRKFINTCRHGVLQYTLVRPITTIIAFICEMAGVYHMNEFRLD
GAYLYLNILNNISQIWAMYSLIMFYRCTKTELKPLKPMSKFLCVKFVVFL
SFWQAVVFAILTATKVISNVEAWKLSDPKEISSMFQNFFICIEMFIAAVA
HHFSFSITPYRTEETNGQPKCCYSCLAMCDVSDVKRDMLEHVKHVGNTVK
SKLPFNNPSEVSAFQRQNEETPLINYAGYQSDSDVSRYSDNESRHKPNSR
SEIKTERNQSQSQQSIESIGSGSSLADLILSNQIGANASNSFSIDSKSSL
NNHLMSSHESAVTLVPVREQIDDSFETSVSFCTSEKLPNVPGPRNGHNSN
NNNNHNNNNNNNTIQQNHSKKGKNRSNCTHFNAQLKNNINKPHESPIATL
NFAPIDIPALDSHKYKKNNNNNGVASKKQKKINQPNHEELKSKNNLRADD
SLSVSTDSSNEEKIKELEINRNSKLLIIKPNKIKSRQQKSCNLCLKKLDV
NDVSKRNIYGEFDENGSTKSNDSGTEISKNSIYPKHSGNVIEHNSFRSFE
NIGGSMETSINHFFAQNNSEKKDKMNLNQRKHLKSQPPKAECSSNDFKQF
PQIVPSAVEINSEKLKTESKNESESDELIQWENESVTVIYPEDFSILSER
TNEFSNFLGLNCNKDEFYQENTNSNIENWLSSANTFTVNNCKRFEPSNID
NKGPANNNLYKNYSEEINYQNDSIYDCNSSGNLFGNYYYKNVPTLHSERY
ISKCNESSTFLNNEFNQSDLFTREIPVNSLNNFISLELPGIAHGRKQSLL
EYERRTQKDPIECDWLTNNNNNNAASAAAAAKRQYDNYRLLPNSMDCYWN
GNHNNNNKSNSFINDKMWSNSDEMACRSNNNTENPLWLVEKSWNQIEPGS
PHDPLACTLLPIGLLSNESSNGIFSNAPENLWKFKHDVTNASLPNNCELD
PQEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR005178Ostalpha/TMEM184C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005178Organic solute transporter subunit alpha/Transmembrane protein 184PFAMPF03619Solute_trans_acoord: 41..310
e-value: 1.2E-91
score: 306.9
IPR005178Organic solute transporter subunit alpha/Transmembrane protein 184PANTHERPTHR23423ORGANIC SOLUTE TRANSPORTER-RELATEDcoord: 23..436
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 493..508
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 387..403
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 404..419
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 384..419
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 486..508
NoneNo IPR availablePANTHERPTHR23423:SF10TRANSMEMBRANE PROTEIN 184Ccoord: 23..436
NoneNo IPR availableTMHMMTMhelixcoord: 109..126
NoneNo IPR availableTMHMMTMhelixcoord: 206..228
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 283..305
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 42..64
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
NoneNo IPR availableTMHMMTMhelixcoord: 77..94