Kinase-like protein

Overview
NameKinase-like protein
Smed IDSMED30015243
Length (bp)2414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase-like protein (SMED30015243) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase-like protein (SMED30015243) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase-like protein (SMED30015243) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase-like protein (SMED30015243) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015243

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015243SMESG000053627.1 PL08011X1C03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30015243SMESG000053627.1 dd_Smed_v4_3194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30015243SMESG000053627.1 Contig48300newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30015243SMESG000053627.1 Contig48300uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinase-like protein vs. Ensembl Human
Match: STK24 (serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403])

HSP 1 Score: 135.961 bits (341), Expect = 1.611e-33
Identity = 83/214 (38.79%), Postives = 124/214 (57.94%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P+  + ++   +++D K +I ME++  GS    LE  G L+ETQI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  +++  ++   I K    +L+   S  L   ++ CL  +P  RP  ++LL++ F 
Sbjct:   69 QEITVLSQCDSPY--VTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFI 274          
BLAST of Kinase-like protein vs. Ensembl Human
Match: STK24 (serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403])

HSP 1 Score: 135.191 bits (339), Expect = 2.947e-33
Identity = 83/214 (38.79%), Postives = 124/214 (57.94%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P+  + ++   +++D K +I ME++  GS    LE  G L+ETQI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  +++  ++   I K    +L+   S  L   ++ CL  +P  RP  ++LL++ F 
Sbjct:   81 QEITVLSQCDSPY--VTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFI 286          
BLAST of Kinase-like protein vs. Ensembl Human
Match: STK24 (serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403])

HSP 1 Score: 132.494 bits (332), Expect = 7.095e-33
Identity = 78/192 (40.62%), Postives = 112/192 (58.33%), Query Frame = 3
Query: 1779 FIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +++D K +I ME++  GS    LE  G L+ETQI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV     Y S ADIWS GIT IE+  G+ P  +++  ++   I K    +L+   S  L   ++ CL  +P  RP  ++LL++ F 
Sbjct:    7 YLKDTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFI 192          
BLAST of Kinase-like protein vs. Ensembl Human
Match: OXSR1 (oxidative stress responsive kinase 1 [Source:HGNC Symbol;Acc:HGNC:8508])

HSP 1 Score: 130.954 bits (328), Expect = 1.081e-31
Identity = 76/237 (32.07%), Postives = 122/237 (51.48%), Query Frame = 3
Query: 1701 VNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEH--------NGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF--TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSD---------NLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            ++E+L+EI   SQ   H  I+ +   F+   + ++ M+ +  GS+   ++H        +G L+E+ I     ++LEGLEYLH     HRD+KA N+LL +D + +++DFG++       D     ++++  GT  WMAPEV      Y   ADIWSFGIT IE+ TG  P+      ++     +    SL+  V D         +   ++  CLQ DP+ RP   +LL + FF+
Sbjct:   57 MDELLKEIQAMSQCH-HPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQ 292          
BLAST of Kinase-like protein vs. Ensembl Human
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6854])

HSP 1 Score: 133.265 bits (334), Expect = 1.122e-31
Identity = 103/306 (33.66%), Postives = 146/306 (47.71%), Query Frame = 3
Query: 1485 FTQFYKDSEIMPSEENICAITVSKF---------KQIKDW---KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLP--SNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYF--IEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDIN-YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDF 2348
            FT  Y DS I     +I   T++           +   +W   KL+G G +  VY   L  +  TG++  +KQ+     S ++  EVN +  EI     +  H RI+Q+       ++    I ME+M  GS+K  L+  G L E   + ++ QILEG+ YLHS  I HRDIK AN+L D   N KL DFG +      T  L     +S  GT  WM+PEV +G  YG  ADIWS   T++EM+T K P+ +      I+    +  N  L   VSD     L +    + K RP   +LL + F
Sbjct:  317 FTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGKLLGQGAFGRVY---LCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQ--TICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIF-VEAKLRPSADELLRHMF 615          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 134.035 bits (336), Expect = 2.698e-32
Identity = 88/259 (33.98%), Postives = 138/259 (53.28%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK-KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G + EVY      +  TG+   +K + L   ++ DE+ ++ +EI   SQ    + + ++   F++  K +I ME++  GS    L  +G+L+E+ I     +IL+GLEYLHS+   HRDIKAANVL+ +  + K++DFG+A    E     I  +     G+  WMAPE+    +Y   ADIWS GIT IE+  G+ P  D++   +   I K     L+  + S      ++ CL  DP++RP    LL++ F K
Sbjct:   20 IGRGSFGEVYKG---IDNRTGRVVAIKIIDL--EQAEDEIEDIQQEIQVLSQCD-SQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFV-----GSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 266          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 134.806 bits (338), Expect = 2.840e-32
Identity = 88/259 (33.98%), Postives = 138/259 (53.28%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK-KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G + EVY      +  TG+   +K + L   ++ DE+ ++ +EI   SQ    + + ++   F++  K +I ME++  GS    L  +G+L+E+ I     +IL+GLEYLHS+   HRDIKAANVL+ +  + K++DFG+A    E     I  +     G+  WMAPE+    +Y   ADIWS GIT IE+  G+ P  D++   +   I K     L+  + S      ++ CL  DP++RP    LL++ F K
Sbjct:  190 IGRGSFGEVYKG---IDNRTGRVVAIKIIDL--EQAEDEIEDIQQEIQVLSQCD-SQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFV-----GSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 436          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 134.035 bits (336), Expect = 2.958e-32
Identity = 88/259 (33.98%), Postives = 138/259 (53.28%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK-KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G + EVY      +  TG+   +K + L   ++ DE+ ++ +EI   SQ    + + ++   F++  K +I ME++  GS    L  +G+L+E+ I     +IL+GLEYLHS+   HRDIKAANVL+ +  + K++DFG+A    E     I  +     G+  WMAPE+    +Y   ADIWS GIT IE+  G+ P  D++   +   I K     L+  + S      ++ CL  DP++RP    LL++ F K
Sbjct:   40 IGRGSFGEVYKG---IDNRTGRVVAIKIIDL--EQAEDEIEDIQQEIQVLSQCD-SQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFV-----GSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 286          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 133.65 bits (335), Expect = 3.106e-32
Identity = 88/259 (33.98%), Postives = 138/259 (53.28%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK-KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G + EVY      +  TG+   +K + L   ++ DE+ ++ +EI   SQ    + + ++   F++  K +I ME++  GS    L  +G+L+E+ I     +IL+GLEYLHS+   HRDIKAANVL+ +  + K++DFG+A    E     I  +     G+  WMAPE+    +Y   ADIWS GIT IE+  G+ P  D++   +   I K     L+  + S      ++ CL  DP++RP    LL++ F K
Sbjct:   25 IGRGSFGEVYKG---IDNRTGRVVAIKIIDL--EQAEDEIEDIQQEIQVLSQCD-SQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFV-----GSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 271          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 132.494 bits (332), Expect = 1.502e-31
Identity = 90/259 (34.75%), Postives = 138/259 (53.28%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNA-KLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK-KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G + EVY      +  TG+   +K + L   ++ DE+ ++ +EI   SQ    + + ++   F++  K +I ME++  GS    L  +G+L+E+ I     +IL+GLEYLHS+   HRDIK ANVLLD    A K+ D+G+A       D +++    +  GT  +MAPEV  G Y   ADIWS GIT IE+  G+ P  D++   +   I K     L+  + S      ++ CL  DP++RP    LL++ F K
Sbjct:  190 IGRGSFGEVYKG---IDNRTGRVVAIKIIDL--EQAEDEIEDIQQEIQVLSQCD-SQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPL----DTVLKA--NTFVGTPFFMAPEVVKGEYSIEADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 435          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 135.961 bits (341), Expect = 7.230e-33
Identity = 85/259 (32.82%), Postives = 137/259 (52.90%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G + EV+      N     Q V+   ++   ++ DE++++ +EI+  SQ  +P+  + ++   F++  K +I ME++  GS    ++  G   E  I     ++L+GL+YLHS+   HRDIKAANVLL +  + KL+DFG+A      T       + +  GT  WMAPEV     Y + ADIWS GIT IE+  G+ P  +++   +   I K     L    + +    ++ CL  DP++RP  ++LL+Y F K
Sbjct:   19 IGKGSFGEVFKG--IDNR---TQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQCDSPY--VTKYYGSFLKGTKLWIIMEYLGGGSALDLMKA-GSFEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSK-----RNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQLTGSYTKSFKDFVEACLNKDPENRPTAKELLKYPFIK 264          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: Mekk1 (gene:FBgn0024329 transcript:FBtr0083684)

HSP 1 Score: 133.65 bits (335), Expect = 1.506e-31
Identity = 91/267 (34.08%), Postives = 137/267 (51.31%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANV-LLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFT----GNYGSPADIWSFGITMIEMITGKDPFP--DINYKEIYN---RIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G + +VYT     N  TG+   +K++ +   ++   +  V  E+     I  H+ ++++    +   +  I ME    G+L+S +E  G L E   + F++Q+L G+  LH   I HRDIK AN+ L+D  N+ KL DFG A      T   + G  Q   GT  +MAPEVFT      +G  ADIWS G  ++EM +GK P+   D N++ ++      K    +SL +E  D     +D CLQ DPK R    +LLE++F K
Sbjct: 1288 IGQGRFGKVYT---AVNNNTGELMAMKEIAIQPGET-RALKNVAEELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTT--VPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHD----FIDHCLQHDPKRRLTAVELLEHNFCK 1543          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: Mekk1 (gene:FBgn0024329 transcript:FBtr0331353)

HSP 1 Score: 133.65 bits (335), Expect = 1.601e-31
Identity = 91/267 (34.08%), Postives = 137/267 (51.31%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANV-LLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFT----GNYGSPADIWSFGITMIEMITGKDPFP--DINYKEIYN---RIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G + +VYT     N  TG+   +K++ +   ++   +  V  E+     I  H+ ++++    +   +  I ME    G+L+S +E  G L E   + F++Q+L G+  LH   I HRDIK AN+ L+D  N+ KL DFG A      T   + G  Q   GT  +MAPEVFT      +G  ADIWS G  ++EM +GK P+   D N++ ++      K    +SL +E  D     +D CLQ DPK R    +LLE++F K
Sbjct: 1195 IGQGRFGKVYT---AVNNNTGELMAMKEIAIQPGET-RALKNVAEELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTT--VPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHD----FIDHCLQHDPKRRLTAVELLEHNFCK 1450          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: mbt (gene:FBgn0025743 transcript:FBtr0074285)

HSP 1 Score: 129.413 bits (324), Expect = 1.096e-30
Identity = 85/260 (32.69%), Postives = 138/260 (53.08%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK--KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            IG G    V    + T++ TG+Q  +K++ L       +  E+L   +   +   H  I++    F+ + + ++ ME+++ G+L   + H+ R++E QI     Q L+ L YLHS+ + HRDIK+ ++LL  D   KLSDFG   C  + + +L +  ++S  GT  WM+PEV +   YG   DIWS GI +IEM+ G+ PF +    +   RI+     +LK   +VS  L + LD+ L  DP  R    +LL + F +
Sbjct:  374 IGEGSTGTVC---IATDKSTGRQVAVKKMDL----RKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGALTDIVTHS-RMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGF--CA-QVSQELPK--RKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLR 620          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0083819)

HSP 1 Score: 128.257 bits (321), Expect = 7.034e-30
Identity = 96/269 (35.69%), Postives = 138/269 (51.30%), Query Frame = 3
Query: 1581 LIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHN-GRL--NETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDD-DNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF---TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYG----NKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            ++G G Y  VY      ++ T  +  +K++  P   S D V  +  EI   SQ+  HR I+++     E+G F I ME +  GSL   LE   G L  NE+ +  +S QILEGL+YLH + I HRDIK  NVL++      K+SDFG +          I  + ++  GT+++MAPEV       YG  ADIWSFG T +EM TGK PF  I     +  + K G    + ++ +E+S N    + +C      DRP   +LLE  F +
Sbjct:  423 VLGKGTYGTVYAAR---DKQTQVRIAIKEV--PEKNSQD-VQPLHEEIKLHSQLR-HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAR-----INPMTETFTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPF--IELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQ 677          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: stk24a (serine/threonine kinase 24a (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-070424-52])

HSP 1 Score: 141.354 bits (355), Expect = 1.151e-35
Identity = 93/257 (36.19%), Postives = 139/257 (54.09%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            IG G + EV+      +  T  Q V+   ++   ++ DEV ++ +EI   SQ      I ++   +++D K +I ME++  GS    L   G L+ET I     +IL+GL+YLHS+   HRDIKAANVLL +  + KL+DFG+A    + TD  I+  + +  GT  WMAPEV     Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+   +  L   +D CL  DP  RP  ++LL++   
Sbjct:   23 IGKGSFGEVFKG---IDNRT--QKVVAIKIIDLEEAEDEVEDIQQEITVLSQ-CDSLFITKYFGSYLKDTKLWIIMEYLGGGSALDLL-GPGALDETHIATILREILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSEYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKENPPTLEGNYNKALKEFVDACLNKDPNFRPTAKELLKHKLI 267          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 135.191 bits (339), Expect = 1.529e-33
Identity = 83/214 (38.79%), Postives = 121/214 (56.54%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P   + ++   +++D K +I ME++  GS    LE  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+      L   ++ CL  +P  RP  ++LL++   
Sbjct:   69 QEITVLSQCDSPF--VTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLI 274          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 134.806 bits (338), Expect = 2.022e-33
Identity = 83/214 (38.79%), Postives = 121/214 (56.54%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P   + ++   +++D K +I ME++  GS    LE  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+      L   ++ CL  +P  RP  ++LL++   
Sbjct:   57 QEITVLSQCDSPF--VTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLI 262          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: stk26 (serine/threonine protein kinase 26 [Source:ZFIN;Acc:ZDB-GENE-080516-5])

HSP 1 Score: 134.035 bits (336), Expect = 3.280e-33
Identity = 93/258 (36.05%), Postives = 140/258 (54.26%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            IG G + EV+      +  T  QNV+    +   ++ DE+ ++ +EI   SQ  +PH  + ++   +++  K +I ME++  GS    L   G  +E QI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  +++  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  D++   +   I K    +L  + S      +D CL  DP  RP  ++LL++ F 
Sbjct:   30 IGKGSFGEVFKG---IDRQT--QNVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPH--VTKYYGSYLKGSKLWIIMEYLGGGSALDLL-RAGPFDEYQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAG---QLTDTQIK--RETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNGDFSKIFKEFVDSCLNKDPAFRPTAKELLKHKFI 274          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 136.732 bits (343), Expect = 3.800e-33
Identity = 91/263 (34.60%), Postives = 136/263 (51.71%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVL--PSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIE--DGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDIN-YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDF 2348
            KL+G G +  VY   L  +  TG++   KQ+     S ++  EV+ +  EI     +  H RI+Q+     +  +    I ME+M  GS+K  L+  G L E   + ++ QILEG+ YLHS  I HRDIK AN+L D   N KL DFG +            G++ S  GT  WM+PEV +G  YG  AD+WS G T++EM+T K P+ +      I+    +  N  L   +S++    L +C+  + K RP  ++LL + F
Sbjct:  348 KLLGQGAFGRVY---LCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSST-GVR-SVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPSHISEHTRDFL-RCIFVEAKYRPSAEELLRHPF 603          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: slc39a7 (solute carrier family 39 member 7 [Source:Xenbase;Acc:XB-GENE-492963])

HSP 1 Score: 136.732 bits (343), Expect = 5.856e-34
Identity = 96/284 (33.80%), Postives = 150/284 (52.82%), Query Frame = 3
Query: 1506 SEIMPSEENICAITVSKFKQIKDWKLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            S + P    I ++     +  +  + IG G + EV+      +  T K   +K + L   +   E  +  +EI   SQ  +P+  + ++   +++D K +I ME++  GS    LE  G L+ETQI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  +++  ++   I K    +L+   S  L   ++ CL  +P  RP  ++LL++ F 
Sbjct:    4 SPVQPGLPGIQSLKADPEELFRKLEKIGKGSFGEVFKG---IDNRTQKVVAIKIIDLEEAEDEIEDIQ--QEITVLSQCDSPY--VTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKGLKEFVEACLNKEPSFRPSAKELLKHKFI 274          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: slc39a7 (solute carrier family 39 member 7 [Source:Xenbase;Acc:XB-GENE-492963])

HSP 1 Score: 136.346 bits (342), Expect = 8.151e-34
Identity = 83/214 (38.79%), Postives = 124/214 (57.94%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P+  + ++   +++D K +I ME++  GS    LE  G L+ETQI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  +++  ++   I K    +L+   S  L   ++ CL  +P  RP  ++LL++ F 
Sbjct:   67 QEITVLSQCDSPY--VTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKGLKEFVEACLNKEPSFRPSAKELLKHKFI 272          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 133.65 bits (335), Expect = 2.886e-33
Identity = 94/264 (35.61%), Postives = 143/264 (54.17%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLD------EVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            IG G + EVY          G +N  K++V  + K +D      E+ ++ +EI   SQ  +P+  I ++   +++  K +I ME++  GS    L+  G L E  I     +IL+GL+YLHS+   HRDIKAANVLL +  + KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y   ADIWS GIT IE+  G+ P+ D++   +   I K    SL+ + S      ++ CL  DP+ RP  ++LL++ F 
Sbjct:   13 IGKGSFGEVYK---------GIENRSKEVV--AIKIIDLEEAEDEIEDIQQEITVLSQCDSPY--ITRYYGSYLKGSKLWIIMEYLGGGSALDLLK-PGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFI 257          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 134.035 bits (336), Expect = 3.301e-33
Identity = 94/264 (35.61%), Postives = 143/264 (54.17%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLD------EVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            IG G + EVY          G +N  K++V  + K +D      E+ ++ +EI   SQ  +P+  I ++   +++  K +I ME++  GS    L+  G L E  I     +IL+GL+YLHS+   HRDIKAANVLL +  + KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y   ADIWS GIT IE+  G+ P+ D++   +   I K    SL+ + S      ++ CL  DP+ RP  ++LL++ F 
Sbjct:   13 IGKGSFGEVYK---------GIENRSKEVV--AIKIIDLEEAEDEIEDIQQEITVLSQCDSPY--ITRYYGSYLKGSKLWIIMEYLGGGSALDLLK-PGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFI 257          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 134.035 bits (336), Expect = 3.371e-33
Identity = 94/264 (35.61%), Postives = 143/264 (54.17%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLD------EVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            IG G + EVY          G +N  K++V  + K +D      E+ ++ +EI   SQ  +P+  I ++   +++  K +I ME++  GS    L+  G L E  I     +IL+GL+YLHS+   HRDIKAANVLL +  + KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y   ADIWS GIT IE+  G+ P+ D++   +   I K    SL+ + S      ++ CL  DP+ RP  ++LL++ F 
Sbjct:   25 IGKGSFGEVYK---------GIENRSKEVV--AIKIIDLEEAEDEIEDIQQEITVLSQCDSPY--ITRYYGSYLKGSKLWIIMEYLGGGSALDLLK-PGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFI 269          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Stk24 (serine/threonine kinase 24 [Source:MGI Symbol;Acc:MGI:2385007])

HSP 1 Score: 133.65 bits (335), Expect = 6.017e-33
Identity = 82/214 (38.32%), Postives = 122/214 (57.01%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P+  + ++   +++D K +I ME++  GS    LE  G L+E QI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV     Y S ADIWS GIT IE+  G+ P  +++  ++   I K    +L+   S  L   ++ CL  +P  RP  ++LL++ F 
Sbjct:   69 QEITVLSQCDSPY--VTKYYGSYLKDTKLWIIMEYLGGGSALDLLE-PGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFI 274          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 134.806 bits (338), Expect = 2.413e-32
Identity = 104/307 (33.88%), Postives = 148/307 (48.21%), Query Frame = 3
Query: 1485 FTQFYKDSEIMPSEENI--CAITVSKF-------KQIKDW---KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVL--PSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYF--IEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDIN-YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            FT  Y DS I     +I    +TV+         +   +W   KL+G G +  VY   L  +  TG++  +KQ+     S ++  EVN +  EI     +  H RI+Q+       ++    I ME+M  GS+K  L+  G L E   + ++ QILEG+ YLHS  I HRDIK AN+L D   N KL DFG +      T  L     +S  GT  WM+PEV +G  YG  ADIWS   T++EM+T K P+ +      I+    +  N  L   VSD     L +    + K RP  ++LL + F 
Sbjct:  317 FTPEYDDSRIRRRGSDIDNPTLTVTDISPPSRSPRAPTNWRLGKLLGQGAFGRVY---LCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQ--TICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIF-VEAKLRPSAEELLRHMFV 616          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 133.65 bits (335), Expect = 5.304e-32
Identity = 94/285 (32.98%), Postives = 143/285 (50.18%), Query Frame = 3
Query: 1524 EENICAITVSKFKQIKDWKLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLP--SNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGK--FYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDIN-YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK*V 2360
            E N+   + S     +  KL+G G +  VY   L  +  TG++   KQ+     S ++  EV+ +  EI     +  H RI+Q+     +  +    I ME+M  GS+K  L+  G L E+  + ++ QILEG+ YLHS  I HRDIK AN+L D   N KL DFG +            GI+ S  GT  WM+PEV +G  YG  AD+WS G T++EM+T K P+ +      I+    +  N  L   +S++    L +    + + RP  ++LL + F + V
Sbjct:  348 ERNVPTKSPSAPINWRRGKLLGQGAFGRVY---LCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ-HERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGT-GIR-SVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIF-VEARQRPSAEELLTHHFAQLV 625          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Stk4 (serine/threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1929004])

HSP 1 Score: 131.339 bits (329), Expect = 7.785e-32
Identity = 88/262 (33.59%), Postives = 135/262 (51.53%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLE-HNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEV--SDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            +G G Y  VY      ++ TG+   +KQ+ + S+     + E+++EI    Q  +PH  ++++   + ++   +I ME+   GS+   +   N  L E +I       L+GLEYLH     HRDIKA N+LL+ + +AKL+DFG+A    + TD + +  + +  GT  WMAPEV     Y   ADIWS GIT IEM  GK P+ DI+       I      + +K    SDN    + +CL   P+ R    +LL++ F K
Sbjct:   36 LGEGSYGSVYK---AIHKETGQIVAIKQVPVESD-----LQEIIKEISIMQQCDSPH--VVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAG---QLTDTMAK--RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVK 282          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Oxsr1 (oxidative-stress responsive 1 [Source:MGI Symbol;Acc:MGI:1917378])

HSP 1 Score: 130.568 bits (327), Expect = 2.493e-31
Identity = 76/237 (32.07%), Postives = 121/237 (51.05%), Query Frame = 3
Query: 1701 VNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEH--------NGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF--TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSD---------NLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            ++E+L+EI   SQ   H  I+ +   F+   + ++ M+ +  GS+   ++H        +G L+E  I     ++LEGLEYLH     HRD+KA N+LL +D + +++DFG++       D     ++++  GT  WMAPEV      Y   ADIWSFGIT IE+ TG  P+      ++     +    SL+  V D         +   ++  CLQ DP+ RP   +LL + FF+
Sbjct:   57 MDELLKEIQAMSQCH-HPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDEPTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQ 292          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|Q9CAD5|YODA_ARATH (Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.340e-37
Identity = 98/293 (33.45%), Postives = 153/293 (52.22%), Query Frame = 3
Query: 1506 SEIMPSEENICAITVSKFKQIKDWKLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSN--KSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGS--PADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFT----LLDKCLQFDPKDRPMCQKLLEYDFFK*V 2360
            S  +P        TVS   + K  +L+G G +  VY   L  N  +G+   +K++ L S+  KS +   ++ +EI   S++  H+ I+Q+      D K YI +E++  GS+   L+  G+  E  I++++ QIL GL YLH+K+  HRDIK AN+L+D     K++DFG+A      +  L      S  G+  WMAPEV   + GS    DIWS G T++EM T K P+   +  E    + K GN     ++ D+L       + KCLQ +P +RP   +LL++ F + V
Sbjct:  380 SPSVPRSPARAEATVSPGSRWKKGRLLGMGSFGHVY---LGFNSESGEMCAMKEVTLCSDDPKSRESAQQLGQEISVLSRLR-HQNIVQYYGSETVDDKLYIYLEYVSGGSIYKLLQEYGQFGENAIRNYTQQILSGLAYLHAKNTVHRDIKGANILVDPHGRVKVADFGMAKHITAQSGPL------SFKGSPYWMAPEVIKNSNGSNLAVDIWSLGCTVLEMATTKPPW---SQYEGVPAMFKIGNSKELPDIPDHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRNV 659          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|Q9FZ36|M3K2_ARATH (Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 3.510e-36
Identity = 104/285 (36.49%), Postives = 152/285 (53.33%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSN-----KSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF--TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFT----LLDKCLQFDPKDRPMCQKLLEYDFFK*VSHYFFNKHLIKFI 2399
            +LIG G +  VY   +  N  +G+   +KQ+++ SN     K+   + E+  E+     ++ H  I+++     ED    I +EF+  GS+ S LE  G   E+ ++ +++Q+L GLEYLH+ +I HRDIK AN+L+D+    KL+DFG +    E     I G K S  GT  WMAPEV   TG+  S ADIWS G T+IEM+TGK P+    YKEI   I   G       + DN+ +     L KCLQ +P  RP   +LL++ F         +K L  F+
Sbjct:   72 QLIGRGAFGTVY---MGMNLDSGELLAVKQVLITSNCASKEKTQAHIQELEEEVKLLKNLS-HPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANILVDNQGCIKLADFGASKQVAELA--TISGAK-SMKGTPYWMAPEVILQTGHSFS-ADIWSVGCTVIEMVTGKAPWSQ-QYKEIA-AIFHIGTTKSHPPIPDNISSDANDFLLKCLQQEPNLRPTASELLKHPFVTGKQKESASKDLTSFM 346          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|Q01389|BCK1_YEAST (Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCK1 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.714e-34
Identity = 91/289 (31.49%), Postives = 150/289 (51.90%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLP----SNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF--TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTL--------LDKCLQFDPKDRPMCQKLLEYDFFK*VSHY-FFNKHLIKFI 2399
            ++IG G +  VY   L  N  TG+   +KQ+ +P     N+++    E LR  ++  +   H  I+Q+  +  ++  + + +E++  GS+ S +   GR +E  IKH ++Q+L+GL YLHSK I HRD+KA N+LLD D   K+SDFG++      + D+      +  GT+ WMAPE+      Y +  DIWS G  ++EM  GK P+ ++   E+   + K G       + ++   L        LD C + +P+ RP   +LL + F +    + F +  L KFI
Sbjct: 1179 EMIGKGSFGAVY---LCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPFSEVNETFNFKSTRLAKFI 1457          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|P28829|BYR2_SCHPO (Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr2 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.373e-33
Identity = 88/262 (33.59%), Postives = 133/262 (50.76%), Query Frame = 3
Query: 1581 LIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPS-NKSLDEVNEVLREI---ITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFH-EATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDF 2348
            LIG G + +VY   L  N  +G+   +KQ++L S ++S D   ++L  +   I   Q   H  I+Q+    +      I +E++  GS+   L   G   ET +K+F  Q L+GLEYLHS+ I HRDIK AN+L+D+    K+SDFG++      +T     G + S  G+  WMAPEV     +    DIWS G  +IEM+T K P+P+ +  +   RI +         +S +    L+K    D   RP   +LL + F
Sbjct:  399 LIGSGSFGQVY---LGMNASSGELMAVKQVILDSVSESKDRHAKLLDALAGEIALLQELSHEHIVQYLGSNLNSDHLNIFLEYVPGGSVAGLLTMYGSFEETLVKNFIKQTLKGLEYLHSRGIVHRDIKGANILVDNKGKIKISDFGISKKLELNSTSTKTGGARPSFQGSSFWMAPEVVKQTMHTEKTDIWSLGCLVIEMLTSKHPYPNCDQMQAIFRIGENILPEFPSNISSSAIDFLEKTFAIDCNLRPTASELLSHPF 657          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|O22040|ANP1_ARATH (Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 3.116e-33
Identity = 98/269 (36.43%), Postives = 144/269 (53.53%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSN-----KSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF--TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFT----LLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +LIG G +  VY   +  N  +G+   +KQ+++ +N     K+   + E+  E+     ++ H  I+++     ED    I +EF+  GS+ S LE  G   E+ ++ ++ Q+L GLEYLH+ +I HRDIK AN+L+D+    KL+DFG +    E     + G K S  GT  WMAPEV   TG+  S ADIWS G T+IEM+TGK P+    YKE+   I   G       + D L +     L KCLQ  P  RP   +LL++ F 
Sbjct:   73 QLIGRGAFGTVY---MGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKLLKNLS-HPNIVRYLGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQLLLGLEYLHNHAIMHRDIKGANILVDNKGCIKLADFGASKQVAELA--TMTGAK-SMKGTPYWMAPEVILQTGHSFS-ADIWSVGCTVIEMVTGKAPWSQ-QYKEVA-AIFFIGTTKSHPPIPDTLSSDAKDFLLKCLQEVPNLRPTASELLKHPFV 331          
BLAST of Kinase-like protein vs. TrEMBL
Match: A9TWT1 (Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens OX=3218 GN=PHYPADRAFT_151978 PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.973e-43
Identity = 98/265 (36.98%), Postives = 147/265 (55.47%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVN---EVLREIITFSQIAPHRRIMQFTDYF--IEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDIN--YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDF 2348
            +L+G G Y +V    L  N+ TG+   +KQL L       E       L   I   +I  H+ I+ + D     E G  Y+ +E++  GS++S LE  GR +E  ++ ++ Q+L GLEYLH K I HRDIK  NVL+D D   KL+DFG +  FH+ T     G K S  G++ WMAPEV  G+ YG  ADIWS G T++EM+T + P+P+++  +  I++  K      + + VSD +   L +C Q + + RP   +LL++ F
Sbjct:    7 ELLGEGAYGKVVYAGL--NQDTGELMAVKQLKLNIAAEGQERQFYLAALEREIALYKIMRHKHIVGYIDMEQDTETGSLYVFLEYVSGGSIQSMLERFGRFSEPLVRVYTRQLLLGLEYLHGKKIVHRDIKGGNVLVDADGVIKLADFGASKAFHDPTQ--TDGFK-SIRGSVFWMAPEVIKGDGYGRRADIWSVGCTVVEMLTAEHPWPEMDNTWTAIFHIAKASSGPPIPEGVSDVVKDFLSQCFQLEARRRPTSTELLQHPF 266          
BLAST of Kinase-like protein vs. TrEMBL
Match: A0A1Y1HMA4 (MEKK and related serine/threonine protein kinases OS=Klebsormidium nitens OX=105231 GN=KFL_000190400 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 8.246e-43
Identity = 102/266 (38.35%), Postives = 152/266 (57.14%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVL-PSNKSLD---EVNEVLREIITFSQIAPHRRIMQFTDYFIED--GKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDIN--YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDF 2348
            +L+G G Y +V+      N+  G+   +KQL L  S++S +    V  + REI  + ++  HR I+ + +   +D  G  Y+ +E++  GS+ S LE  GR +E  ++ ++ Q+L+GLEYLH   I HRDIK  NVL+D D   KL+DFG +  FH+AT  L  G K S  G++ WMAPEV  G+ YG  ADIWS G T+IEM+TG  P+P I+  +  I++  K      + +  S      L+ C   DPK+RP    LL++ F
Sbjct:   69 ELLGEGAYGKVFAG---LNQENGQLMAVKQLKLNDSDQSREYQRHVAALEREISLYRKMR-HRHIVGYINMERDDASGSLYVFLEYVSGGSIHSMLERFGRFSEPLVRVYTRQLLQGLEYLHECKIIHRDIKGGNVLVDRDGVIKLADFGASKAFHDAT--LTDGCK-SIRGSVFWMAPEVIKGDGYGRRADIWSVGCTVIEMLTGSHPWPGIDNTWTAIFHIAKALTGPPMPEIASPLAKEFLNLCFALDPKERPTATDLLQHPF 327          
BLAST of Kinase-like protein vs. TrEMBL
Match: A0A109FMJ1 (Pkinase-domain-containing protein OS=Rhodotorula sp. JG-1b OX=1305733 GN=RHOSPDRAFT_14255 PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.186e-40
Identity = 91/267 (34.08%), Postives = 144/267 (53.93%), Query Frame = 3
Query: 1581 LIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDE-----VNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIK---QSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            LIG G +  V+   L  N +TG    +KQ+ LP+  S +E     + + L   I   ++  H  I+Q+ D   +D    I +E++  GS+ + L++ G   E  +  F  QIL GLEYLH + I HRDIK AN+L+D+  N K+SDFG++    +  D+L+ G K    S  G++ WMAPEV     Y S ADIWS G  ++EM+TG  P+ ++   +   RI      ++  ++S      LD+  + + +DRP   +LL++ F +
Sbjct:    8 LIGAGSFGSVF---LGMNPMTGSLMAVKQVELPTGNSHNEERKKGMLDALEREIELLKVLQHDNIVQYLDSSTDDKHLNIFLEYVPGGSVAALLQNYGAFEEALVSKFVRQILTGLEYLHEREIIHRDIKGANILVDNKGNIKISDFGISK---KVEDNLLTGAKVHRPSLQGSVYWMAPEVVKQTAYTSKADIWSLGCLVVEMLTGAHPWANLTQMQAIFRIGSSSRPTVPDDISAEANDFLDQTFEIEHEDRPAATELLQHAFIR 268          
BLAST of Kinase-like protein vs. TrEMBL
Match: A0A367KPG3 (Uncharacterized protein OS=Rhizopus stolonifer OX=4846 GN=CU098_012163 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.002e-40
Identity = 100/289 (34.60%), Postives = 145/289 (50.17%), Query Frame = 3
Query: 1512 IMPSEENICAITVSKFKQIKDW---KLIGGGGYAEVYTN-ELYTNELTGKQNVLKQLVLP--SNKSLDEVNEVLREIITFSQIAPHRRIMQFT--DYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            + P EEN   +          W    LIG G ++ VY    L T E    + V   +      N+ L   ++ L   I   +   H  I+Q+   DY  ++G  YI +E++  GS+ S L+  G LNE  I  F+ QIL+GL YLH K I HRDIK  NVL+D D   K++DFGL+   HE+             GT+ WMAPEV   +Y    DIWS G T++EMITG+ P+ ++       +I  +   ++   +SD     L +CLQ DP+ RP   +LL++ F +
Sbjct:  455 VKPGEENRIELPTLAQPAKMQWMRGDLIGHGSFSRVYHALNLATLEWMAVKQVDAVITQADQHNQDLKAASDALYREIQLLKDLDHENIVQYIAYDYNPDEGHIYIFLEYVPGGSISSLLDKYGSLNECLIGFFTRQILQGLAYLHEKGILHRDIKGGNVLIDHDGVCKITDFGLSKSQHESD-----STHSHMKGTLYWMAPEVLEHHYSPKVDIWSLGCTVLEMITGEHPWMELTTLAALYQIGLHNAPAIPTNISDQAKDFLQQCLQIDPEQRPTASELLQHPFVQ 738          
BLAST of Kinase-like protein vs. TrEMBL
Match: A0A0B7NJX5 (Uncharacterized protein OS=Parasitella parasitica OX=35722 GN=PARPA_13195.1 scaffold 46252 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 5.135e-40
Identity = 107/296 (36.15%), Postives = 164/296 (55.41%), Query Frame = 3
Query: 1509 EIMPSEENICAITVSKFKQIKDW---KLIGGGGYAEVYTNELYTNELTGKQNVLKQL---VLPSNK---SLDEVNEVL-REIITFSQIAPHRRIMQFTDYFI--EDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTN--GTMKWMAPEVFTGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            E++P     C++ V+  K I  W    LIG G +  VY    Y N  TG+   +KQ+   V  S+K   +L E ++ L REI+    +  H  I+Q+  Y +  E+G  YI +E++  GS+ S L     L+E+  K F+ QIL+GL+YLH++ I HRDIK  NVL+D+D   K++DFGL+    + ++         T   GT+ WMAPEV T NY +  D+WS G T++EMITG+ P+  +       +I  +   ++ + +SD     L +CL+  P+DRP   +LLE+ F K
Sbjct:  602 ELLPHS---CSLEVTPNKMI--WMRGNLIGRGSFGRVY--HAY-NIATGEWFAVKQVDAVVTQSDKRNVALQEASDALYREILLLKDLD-HVNIVQYLGYNLNMEEGHIYIFLEYVPGGSISSLLSEYKFLDESLTKFFTRQILQGLQYLHTRHILHRDIKGGNVLIDNDGVCKITDFGLSKNQQQDSNGPYDAHSSHTQMKGTLYWMAPEVLTNNYSAKVDVWSLGCTVLEMITGEHPWMKLTTLAALYQIGLHNAPAIPENISDEAKDFLGQCLRIKPEDRPTATELLEHPFVK 888          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: stk26 (serine/threonine kinase 26 [Source:NCBI gene;Acc:103024322])

HSP 1 Score: 136.346 bits (342), Expect = 4.324e-34
Identity = 93/258 (36.05%), Postives = 141/258 (54.65%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            IG G + EV+      +  T  QNV+    +   ++ DE+ ++ +EI   SQ  +PH  + ++   +++  K +I ME++  GS    L   G  +E QI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  +++  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  D++   +   I K    +L  + S +    +D CL  DP  RP  ++LL++ F 
Sbjct:   30 IGKGSFGEVFKG---IDRRT--QNVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPH--VTKYYGSYLKGSKLWIIMEYLGGGSALDLL-RAGPFDECQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAG---QLTDTQIK--RETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNGDFSKSFKEFVDSCLNKDPTFRPTAKELLKHKFI 274          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: stk26 (serine/threonine kinase 26 [Source:NCBI gene;Acc:103024322])

HSP 1 Score: 136.732 bits (343), Expect = 7.536e-34
Identity = 93/258 (36.05%), Postives = 141/258 (54.65%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            IG G + EV+      +  T  QNV+    +   ++ DE+ ++ +EI   SQ  +PH  + ++   +++  K +I ME++  GS    L   G  +E QI     +IL+GL+YLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  +++  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  D++   +   I K    +L  + S +    +D CL  DP  RP  ++LL++ F 
Sbjct:   51 IGKGSFGEVFKG---IDRRT--QNVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPH--VTKYYGSYLKGSKLWIIMEYLGGGSALDLLR-AGPFDECQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAG---QLTDTQIK--RETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKNTPPTLNGDFSKSFKEFVDSCLNKDPTFRPTAKELLKHKFI 295          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: stk24b (serine/threonine-protein kinase 24-like [Source:NCBI gene;Acc:103028447])

HSP 1 Score: 135.191 bits (339), Expect = 8.373e-34
Identity = 87/230 (37.83%), Postives = 126/230 (54.78%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK*VSHYFFNKHLIKFI 2399
            +EI   SQ  +P   + ++   +++  K +I ME++  GS    LE  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV     Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+   S  L   ++ CL  +P  RP  ++LL++     V H     +L + I
Sbjct:   42 QEITVLSQCDSPF--VTKYYGSYLKGTKLWIIMEYLGGGSALDLLE-PGALDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKLI--VRHAKKTSYLTELI 261          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: stk24b (serine/threonine-protein kinase 24-like [Source:NCBI gene;Acc:103028447])

HSP 1 Score: 135.576 bits (340), Expect = 1.006e-33
Identity = 87/230 (37.83%), Postives = 126/230 (54.78%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK*VSHYFFNKHLIKFI 2399
            +EI   SQ  +P   + ++   +++  K +I ME++  GS    LE  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV     Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+   S  L   ++ CL  +P  RP  ++LL++     V H     +L + I
Sbjct:   69 QEITVLSQCDSPF--VTKYYGSYLKGTKLWIIMEYLGGGSALDLLE-PGALDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKLI--VRHAKKTSYLTELI 288          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000008518.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:14507502:14520436:1 gene:ENSAMXG00000008289.2 transcript:ENSAMXT00000008518.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 2.713e-32
Identity = 81/214 (37.85%), Postives = 121/214 (56.54%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P   + ++   +++  K +I ME++  GS    LE  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +  + KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  +++  ++   I K    +L+      L   ++ CL  +P  RP  ++LL++   
Sbjct:   66 QEITVLSQCDSPF--VTKYYGSYLKGTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLI 271          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 128.257 bits (321), Expect = 4.646e-31
Identity = 89/263 (33.84%), Postives = 129/263 (49.05%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVL--PSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGK--FYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDIN-YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDF 2348
            KL+G G +  VY   L  +  TG++  +KQ+     S ++  EVN +  EI     +  H RI+Q+     +  +    I ME+M  GS+K  L   G L E   + ++ QILEG+ +LH   I HRDIK AN+L D   N KL DFG +               +S  GT  WM+PEV  G  YG  ADIWS G T++EM+T K P+ +      I+    +  +  L    S++   LL +    + K RP  + LL + F
Sbjct:  363 KLLGQGAFGRVY---LCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNLQ-HERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGT--AMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTDPRLPLHASEHARDLLRRIF-VEAKLRPSAEDLLRHPF 618          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 120.553 bits (301), Expect = 2.267e-29
Identity = 79/217 (36.41%), Postives = 120/217 (55.30%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIK--AANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            +EI   SQ  +P+  +  +   +++  K +I ME++  GS    ++  G L E QI     +IL+GL+YLHS+   HRDIK  AANVLL +  + KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y   ADIWS GIT IE+  G+ P  +++   +   I K    +L+   S      +D CL  DP+ RP  ++LL++ F +
Sbjct:   71 QEITVLSQCDSPY--VTHYFGSYLKGTKLWIIMEYLGGGSALDLIK-PGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLEGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQ 279          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 122.094 bits (305), Expect = 1.107e-28
Identity = 81/265 (30.57%), Postives = 131/265 (49.43%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFT----GNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSL----KKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            +G G Y +V+      N  TG+   +K + L      D+ + + +EI+   +   H  I+ +   ++   K +I ME    GSL+      G L E QI + + + L+GL YLHS+   HRDIK AN+LL DD + KL+DFG++    + T  + +  ++S  GT  WMAPEV      G Y    D+W+ GIT IE+   + P  D++       + K G +      K++ S      +   L  +PK RP  +K+L + + +
Sbjct:   20 LGSGTYGDVHKAR---NVQTGELVAIKIIKLEPG---DDFSVIQQEIVMMKECK-HTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSA---QITATIAK--RKSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKMLTHSYVQ 272          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 119.398 bits (298), Expect = 3.914e-28
Identity = 74/247 (29.96%), Postives = 125/247 (50.61%), Query Frame = 3
Query: 1623 LYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK--KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            L  +  +G+Q  +K++ L   +       +  E++   +      +  +  Y + D + ++ MEF++ G+L   + H  R+NE QI      +L  L YLH + + HRDIK+ ++LL  D   KLSDFG      + + ++ R  ++S  GT  WMAPEV +   YG   D+WS GI +IEM+ G+ P+ +    +   RI+      +K  ++ S  L   LD+ L  DP  R    +LL++ F +
Sbjct:  435 LAVDRRSGRQVAVKKMHL---RKQQRRELLFNEVVIMREYHHENVVDMYNSYLVAD-ELWVVMEFLEGGALTDIVTHT-RMNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCA---QVSKEVTR--RKSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQ 671          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002959.1 (pep scaffold:Pmarinus_7.0:GL476671:15807:33413:-1 gene:ENSPMAG00000002691.1 transcript:ENSPMAT00000002959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 7.539e-28
Identity = 81/267 (30.34%), Postives = 133/267 (49.81%), Query Frame = 3
Query: 1572 DWKLIGGGGYAEVY-TNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLE-HNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF----TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKK-EVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            D K IG G +  VY    ++T+E+      +K++     +S ++  ++++E+   +++  H  I+++   ++ +   ++ ME+   GS    LE H   L E +I   +   L+GL +LH+ ++ HRD+KA N+LL +    KL+DFG A+    A          S  GT  WMAPEV      G Y    D+WS GIT IE+   K P  ++N       I +  + +L+  E SD     +D CLQ + +DRP    LL + F 
Sbjct:   30 DLKEIGHGSFGAVYFARNIHTSEVVA----IKKMSYSGKQSNEKWQDIIKEVKFLTKLK-HPNIIEYKGCYLREHTAWMIMEYCL-GSASDLLEVHKKPLQEIEIAAIAHGALQGLAFLHNHTMIHRDVKAGNILLTEPGQVKLADFGSASLTAPAN---------SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPTLQSPEWSDYFRNFVDSCLQKNGQDRPTSAGLLRHAFV 281          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 146.362 bits (368), Expect = 2.469e-36
Identity = 91/289 (31.49%), Postives = 150/289 (51.90%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLP----SNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF--TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTL--------LDKCLQFDPKDRPMCQKLLEYDFFK*VSHY-FFNKHLIKFI 2399
            ++IG G +  VY   L  N  TG+   +KQ+ +P     N+++    E LR  ++  +   H  I+Q+  +  ++  + + +E++  GS+ S +   GR +E  IKH ++Q+L+GL YLHSK I HRD+KA N+LLD D   K+SDFG++      + D+      +  GT+ WMAPE+      Y +  DIWS G  ++EM  GK P+ ++   E+   + K G       + ++   L        LD C + +P+ RP   +LL + F +    + F +  L KFI
Sbjct: 1179 EMIGKGSFGAVY---LCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPFSEVNETFNFKSTRLAKFI 1457          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 134.806 bits (338), Expect = 3.795e-33
Identity = 82/261 (31.42%), Postives = 134/261 (51.34%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGSPA---DIWSFGITMIEMITGKDPFPDINYKEIYNRIK-KYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            +G GG+A  +  +  + E+   + V K     S KS     ++L EI     ++ H  I+QF D F +D   YI +E   NGSL   L+    L E +++ F++QI   ++Y+HS+ + HRD+K  N+  D + N K+ DFGLA      ++      K +  GT  ++APEV  G +   +   DIWS G+ +  ++ GK PF   +   IY RIK +  +    K +SD    L+   L  DP +RP   ++++Y +F+
Sbjct:   88 LGEGGFARCFQIKDDSGEIFAAKTVAKA----SIKSEKTRKKLLSEIQIHKSMS-HPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESER-----KYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFR 338          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 132.109 bits (331), Expect = 4.679e-32
Identity = 83/261 (31.80%), Postives = 140/261 (53.64%), Query Frame = 3
Query: 1578 KLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGR-LNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGSP--ADIWSFGITMIEMITGKDPFPDINYKEIYNRIKK---YGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEY 2342
            ++IG G Y  VY      N+ T +   +K++V  ++   +E+N+++ EI     +  H  I+++  +  +  + YI +E+  NGSL+  +  +   L+E + K + +Q L GL+YLH + + HRDIKAAN+LL  DN  KL+DFG++   + +   L         GT+ WMAPE+  GN G+   +DIWS G T++EM+T   P+ ++    IY  ++    Y   S  + + D     L KC   +   RP   +LL++
Sbjct:   29 QVIGRGSYGVVYKA---INKHTDQVVAIKEVVYEND---EELNDIMAEISLLKNLN-HNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLA--------GTLNWMAPEIL-GNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKD----FLSKCFVKNMYKRPTADQLLKH 269          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 129.413 bits (324), Expect = 3.398e-31
Identity = 96/263 (36.50%), Postives = 139/263 (52.85%), Query Frame = 3
Query: 1584 IGGGGYAEVYTN-ELYTN-ELTGKQ-NVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTN-GTMKWMAPEVFT-GNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKE--VSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            IG G    VYT  E+ TN  +  KQ N+ KQ   P  + +  +NE+L  ++  S+   H  I+ F D ++  G  ++ ME+M+ GSL   + H   L E QI     + L GLE+LHSK + HRDIK+ N+LL  + + KL+DFG     +E        +K++T  GT  WMAPEV +   YG   DIWS GI +IEMI G+ P+ +         I   G   LK+   +S +L   LD CL  +P+DR    +LL  ++ 
Sbjct:  626 IGQGASGGVYTAYEIGTNVSVAIKQMNLEKQ---PKKELI--INEIL--VMKGSK---HPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTH-CILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINEL------NLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYI 871          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 127.102 bits (318), Expect = 2.048e-30
Identity = 90/265 (33.96%), Postives = 136/265 (51.32%), Query Frame = 3
Query: 1569 KDWKLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN--YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK-KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            K  ++IG G +  VY      N  TG+   +K L L S+   DEV +V REI   + +     I ++   +++D   +I ME    GSL+S L   G+++E  I     ++L  L+ +H  ++ HRDIKAANVL+ ++ N KL DFG+A   ++ +   +R  +Q+  GT  WMAPEV      Y +  DIWS GIT  E+ TG  P+ D+        I K     L+ +  S +L   +  CL  DPK+R     LL+  F +
Sbjct:   24 KRTEVIGRGKFGVVYKG---YNVKTGRVYAIKVLNLDSDS--DEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRP-GKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTS---LR--RQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIR 277          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 142.895 bits (359), Expect = 4.341e-38
Identity = 92/261 (35.25%), Postives = 135/261 (51.72%), Query Frame = 3
Query: 1578 KLIGGGGYAEVY-TNELYTN-ELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDIN-YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDF 2348
            KL+G G + +VY  ++L T  EL  KQ    QL    N S     + L   I F +   + RI+Q+     +D   YI ME++  GS+   ++ +G LNE+  + +S QILEG+ YLH+  I HRDIK AN+L D   N KL+DFG +            G + S +GT  WMAPEV  G  YG  AD+WS G T++EM+T K P+ D      ++    +     L  ++S +    +   L+ + K RP   +LL + F
Sbjct:    8 KLLGAGAFGQVYMCHDLDTGRELAVKQIETGQL----NSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKT--GFR-SVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSF 261          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 125.561 bits (314), Expect = 9.366e-32
Identity = 90/287 (31.36%), Postives = 134/287 (46.69%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF----TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSL-------KKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK*VSHYFFNKHLIKFILISL 2411
            +GGG Y +V+   +          V+K  V P +       E++++ I   Q   H  I+ +   ++   K +I ME+   GS++      G  +ETQI   + + L+GL YLH KS+ HRDIK AN+LL  +   KL+DFG++    E         ++S  GT  WMAPE+     TG Y    DIW+ GIT IEM   + P  D++       I   G KS        K + S+ +   +   L  +PK RP   K+L        +H F  +HL K +L  L
Sbjct:   24 VGGGTYGDVFKARVIATGDLAAVKVVK--VEPGDDF-----ELIQQEIAMMQQCRHNNIINYIGAYMRRDKLWIGMEYCGGGSIQDVYCVTGPCSETQISFVTVETLKGLAYLHEKSLMHRDIKGANILLTTNGEVKLADFGISARITETMKK-----RKSFIGTPYWMAPEMAAVERTGGYDLKCDIWAVGITAIEMAELQPPMFDLHPMRALYII---GKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKML--------THPFCCRHLTKAVLQDL 287          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 124.02 bits (310), Expect = 1.523e-31
Identity = 89/279 (31.90%), Postives = 140/279 (50.18%), Query Frame = 3
Query: 1572 DWK---LIGGGGYAEVYTNELYTNELTGKQNVLKQLVL-PSNKSLDEVN-EVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIE--MEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLAN--CF---HEATDDLIRGIKQSTNGTMKWMAPEVF--TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKS----LKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            +W+   ++G G +  V+   + T EL      +KQ+ L P+N    E   E L+E +   +   H+ I+Q+    ++D +  I   MEF+  GS+   L+  G   E   + ++ QIL+G+ YLH+ ++ HRDIK  N++L  +   KL DFG A   C    H +  +++R    S  GT  WMAPEV   TG +G  +DIWS G T+ EM TG+ P+ ++      + I   GN S    L +  S      +  C+  D   RP   +LL +DF +
Sbjct:    4 EWQKGNVLGKGAFGTVFLGLVNTGELI----AVKQVELHPNNVDAAERQYEKLQEEVGLLKSLKHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAHVSKSNILR----SMRGTPYWMAPEVIRETG-HGRKSDIWSIGCTVFEMATGQPPWSNV---PPLSAIFAIGNGSPVPRLDESFSAAAIDFVTSCMTRDQDTRPSADELLRHDFLQ 270          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO37827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEP8])

HSP 1 Score: 130.183 bits (326), Expect = 1.987e-31
Identity = 90/293 (30.72%), Postives = 141/293 (48.12%), Query Frame = 3
Query: 1515 MPSEENICAITVSKFKQIKDWKLIGGGGYAEVY------TNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGS-PADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK*VSHYF 2372
            +P E +   +   + K+    K +G GG+A+ Y      TN++Y  ++  K  + K    P  K      ++  EI    ++  H+ I+ F  YF +    YI +E     SL    +    L E ++++F  QI++   YLH   I HRD+K  N+ L+DD   K+ DFGLA    E         K++  GT  ++APEV +    S   D+WS G  +  ++ GK PF   + K  Y+RIK+     +  +VS     L+ K L+ DP  RP  Q++L+ DFFK  S Y 
Sbjct:    6 IPRELDQIIVDADRKKRYYRGKFLGKGGFAKCYELTDLDTNKIYAGKIISKSMLTK----PHQK-----EKMAMEIEIHGKVM-HKHIVGFHGYFEDRDYIYILLELCPRRSLMELHKRRRALTEPEVRYFMKQIIDACIYLHKSRIIHRDLKLGNLFLNDDMEVKVGDFGLATRAEEGER------KKTLCGTPNYIAPEVLSKRGHSFEVDVWSVGCILYTLLVGKPPFETQSLKTTYDRIKR-NEYYIPSKVSHTAQLLIIKLLRPDPTTRPTMQQVLDDDFFKPSSGYM 281          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 123.635 bits (309), Expect = 7.161e-31
Identity = 82/261 (31.42%), Postives = 136/261 (52.11%), Query Frame = 3
Query: 1584 IGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLE-HNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK--KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            +G G Y  V+      ++ +G+   +KQ+ + ++     + E+++EI    Q      +  +  YF ++   +I ME+   GS+   ++  N  L E +IK      L+GLEYLH +   HRDIKA N+LL+ + +AKL+DFG+A    + TD + +  + +  GT  WMAPEV     Y   ADIWS GIT +EM  GK P+ DI+       I      + +   + S++    + KCL  +P++R    +LL++ F +
Sbjct:   30 LGEGSYGSVFKA---MHKESGQVVAIKQVPVDTD-----LQEIIKEISMMQQCDSPYVVKYYGSYF-KNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAG---QLTDTMAK--RNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQ 276          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: ENSORLT00000022068.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 136.732 bits (343), Expect = 2.330e-34
Identity = 85/214 (39.72%), Postives = 122/214 (57.01%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P   I ++   +++  K +I ME++  GS    LE  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV    +Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+   S  L   ++ CL  DP  RP  ++LL++ + 
Sbjct:   67 QEITVLSQCHSPF--ITKYFGSYLKSTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYI 272          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: ENSORLT00000022064.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 137.117 bits (344), Expect = 2.656e-34
Identity = 85/214 (39.72%), Postives = 122/214 (57.01%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P   I ++   +++  K +I ME++  GS    LE  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV    +Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+   S  L   ++ CL  DP  RP  ++LL++ + 
Sbjct:   67 QEITVLSQCHSPF--ITKYFGSYLKSTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYI 272          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: ENSORLT00000022066.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 137.117 bits (344), Expect = 2.656e-34
Identity = 85/214 (39.72%), Postives = 122/214 (57.01%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVF-TGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P   I ++   +++  K +I ME++  GS    LE  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV    +Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+   S  L   ++ CL  DP  RP  ++LL++ + 
Sbjct:   67 QEITVLSQCHSPF--ITKYFGSYLKSTKLWIIMEYLGGGSALDLLE-PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYI 272          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: stk24b (serine/threonine kinase 24 [Source:NCBI gene;Acc:101160144])

HSP 1 Score: 133.65 bits (335), Expect = 4.683e-33
Identity = 82/214 (38.32%), Postives = 121/214 (56.54%), Query Frame = 3
Query: 1716 REIITFSQI-APHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFF 2351
            +EI   SQ  +P   + ++   +++D K +I ME++  GS    +E  G L+ETQI     +IL+GLEYLHS+   HRDIKAANVLL +    KL+DFG+A    + TD  I+  + +  GT  WMAPEV   + Y S ADIWS GIT IE+  G+ P  D++  ++   I K    +L+      L   ++ CL  +P  RP  ++LL++   
Sbjct:   69 QEITVLSQCDSPF--VTKYYGSYLKDTKLWIIMEYLGGGSALDLME-PGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAG---QLTDTQIK--RNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGSYCKPLKEFVEACLNKEPSFRPTAKELLKHKLI 274          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 136.346 bits (342), Expect = 5.646e-33
Identity = 95/285 (33.33%), Postives = 141/285 (49.47%), Query Frame = 3
Query: 1512 IMPSEENICAITVSKFKQIKDWKLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLP--SNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGK--FYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTG-NYGSPADIWSFGITMIEMITGKDPFPDIN-YKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDF 2348
            + P E ++   + S     +  KL+G G +  VY   L  +  TG++   KQ+     S ++  EV+ +  EI     +  H RI+Q+     +  +    I ME+M  GS+K  L+  G L E   + ++ QILEG+ YLHS  I HRDIK AN+L D   N KL DFG +            GI+ S  GT  WM+PEV +G  YG  AD+WS G T++EM+T K P+ +      I+    +  N  L    SD     +  C+  + K RP  ++LL + F
Sbjct:  335 LRPQERSVSHKSPSAPVTWRRGKLLGQGAFGLVY---LCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGT-GIR-SVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPLLPSHTSDQARDFI-HCIFVEAKHRPSAEELLRHPF 612          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000053627.1 (SMESG000053627.1)

HSP 1 Score: 1461.82 bits (3783), Expect = 0.000e+0
Identity = 726/730 (99.45%), Postives = 729/730 (99.86%), Query Frame = 3
Query:  165 MHRYRYKEKEYQNPGYKIRLIKEDLANSVKLSSSNLILVYRNMILEDCERIIHYEIDKKDFIWFGTKDDYDGEFGQHLIITIKADECYESIDISEKLLVKSTYKIVHIRNILGRIYKWITKVKFLNVNRNKLSDDQLIEECQLIENPFIIIGSPEFKVDRGNLDELQSNLRYFGGTRLRLNPFEMSPLMEILKLMTDKTNRNRSFLSIFMDLIKLENPEDVNIKHDTELFLCDWTKYYDRADRNQLSIEDKTSIYRQDYSDNLNDVTDEVEIGTADEHYQVMLSLYQVGVQFIEKYFPTPFDNLKNSLAPIFEAYSKSRDLNLNNDKFADLRLGRRLTFFFKRFLDNGYRLNDKEFNVXXXXXXXXXXXXXXKINSLIMNYWTQINYSGTNSFKKLYVHPNLEKDRPCIIFTPADVTAGQTRKILSDSNPEKEVFLASSDFTQFYKDSEIMPSEENICAITVSKFKQIKDWKLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            MHRYRYKEKEYQNPGYKIRLIKEDLANSVKLSSSNLILVYRNMILEDCERIIHYEIDKKDFIWFGTKDDYDGEFGQHLIITIKADECYESIDISEKLLVKSTYKIVH+RNILGRIYKWITKVKFLNVNRNKLSDDQLIEECQLIENPFIIIGSPEFKVDRGNLDELQSNL YFGGTRLRLNPFEMSPLMEILKL+TDKTNRNRSFLSIFMDLIKLENPEDVNIKHDTELFLCDWTKYYDRADRNQLSIEDKTSIYRQDYSDNLNDVTDEVEIGTADEHYQVMLSLYQVGVQFIEKYFPTPFDNLKNSLAPIFEAYS+SRDLNLNNDKFADLRLGRRLTFFFKRFLDNGYRLNDKEFNVQFILILPDLLQILQKINSLIMNYWTQINYSGTNSFKKLYVHPNLEKDRPCIIFTPADVTAGQTRKILSDSNPEKEVFLASSDFTQFYKDSEIMPSEENICAITVSKFKQIKDWKLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK
Sbjct:    1 MHRYRYKEKEYQNPGYKIRLIKEDLANSVKLSSSNLILVYRNMILEDCERIIHYEIDKKDFIWFGTKDDYDGEFGQHLIITIKADECYESIDISEKLLVKSTYKIVHVRNILGRIYKWITKVKFLNVNRNKLSDDQLIEECQLIENPFIIIGSPEFKVDRGNLDELQSNLIYFGGTRLRLNPFEMSPLMEILKLITDKTNRNRSFLSIFMDLIKLENPEDVNIKHDTELFLCDWTKYYDRADRNQLSIEDKTSIYRQDYSDNLNDVTDEVEIGTADEHYQVMLSLYQVGVQFIEKYFPTPFDNLKNSLAPIFEAYSRSRDLNLNNDKFADLRLGRRLTFFFKRFLDNGYRLNDKEFNVQFILILPDLLQILQKINSLIMNYWTQINYSGTNSFKKLYVHPNLEKDRPCIIFTPADVTAGQTRKILSDSNPEKEVFLASSDFTQFYKDSEIMPSEENICAITVSKFKQIKDWKLIGGGGYAEVYTNELYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGNYGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 730          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 218.779 bits (556), Expect = 1.304e-61
Identity = 134/346 (38.73%), Postives = 195/346 (56.36%), Query Frame = 3
Query: 1383 PCIIFTPADVTAGQTRKILSDSN---PEKEVFLASSDFTQFYKDSEIMPSEE-----------NICAITVSKFKQIKDWKLIGGGGYAEVYTNE-LYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGK-FYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATD-DLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK----KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            P ++     +T    +K ++D     PE+ + + S+   Q  KD E + + E            I    +SK + I +   +G GG+ +VY  E L TN++      +K++ +P NK L +V   ++EI+TFS++  H+RI+Q+ D+F +D K F I ME+M NGSL S+LE NG L E +I   S+Q+LEGL YLH+  I HRDIK  N+LLDD  NAKL+DFGL+ C  E +  D   GI QS  GT  W APEV     YG  ADIWSFG T++EM+ G+ P+ D  Y+ +    K   +K ++    K ++  L   +  CL+ +P +RP  Q LL  DF K
Sbjct:  250 PMLVVGTEKITVSDCKKAVADRVKRLPEEIILIKSN---QCLKDDETISNYEYSPDSYFALRSGISYFRLSKLENIVNQDPVGEGGFGKVYQCEDLATNKVMA----VKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYAD--YESVQLTFKLLTDKKIEFTPPKTMTRQLEEFIAWCLKPEPHERPTAQLLLNSDFIK 586          

HSP 2 Score: 84.7297 bits (208), Expect = 9.122e-17
Identity = 56/191 (29.32%), Postives = 102/191 (53.40%), Query Frame = 3
Query:  171 RYRYKEKEYQNPGYKIRLIKEDLANSVKLSSSNLILVYRNMILEDCERIIHYEID---KKDFIWFGTKDDYDGEFGQHLIITIKADECYES--------IDISEKLLVKSTYKIVHIRNILGRIYKWITKVKFLNVNRNKLSDDQLIEECQLIENPFIIIGSP-EFKVDRGNLDELQSNLRYFGGTRLRLN 707
            ++R   KE  +   +I L+K DL+ +V++  ++ +L+  +MILE  + I +Y I     +D IWFG   DY  +  + +I+    D    +        I ++ +L+V+   +I  IRN +G+IYKWI K+ F N N+ +L DDQ++EE  L+    I + +P  + V   ++   QS +   G  ++ ++
Sbjct:   73 KFRGFGKELYSDKEQIDLVKMDLSKAVRVDKNDFVLICDDMILESDDWIKYYRIPNPVTEDVIWFGKIADY-LKLNEIIIVMKSMDRSGGNSEPGSMFCIPVNIQLIVRLDQRIGEIRNHIGKIYKWIAKIPFWNFNKERLKDDQMVEESGLLNTSIIYMSTPMSYNVALSSISTDQSPMLVVGTEKITVS 262          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 218.779 bits (556), Expect = 2.699e-61
Identity = 134/346 (38.73%), Postives = 195/346 (56.36%), Query Frame = 3
Query: 1383 PCIIFTPADVTAGQTRKILSDSN---PEKEVFLASSDFTQFYKDSEIMPSEE-----------NICAITVSKFKQIKDWKLIGGGGYAEVYTNE-LYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGK-FYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATD-DLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK----KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            P ++     +T    +K ++D     PE+ + + S+   Q  KD E + + E            I    +SK + I +   +G GG+ +VY  E L TN++      +K++ +P NK L +V   ++EI+TFS++  H+RI+Q+ D+F +D K F I ME+M NGSL S+LE NG L E +I   S+Q+LEGL YLH+  I HRDIK  N+LLDD  NAKL+DFGL+ C  E +  D   GI QS  GT  W APEV     YG  ADIWSFG T++EM+ G+ P+ D  Y+ +    K   +K ++    K ++  L   +  CL+ +P +RP  Q LL  DF K
Sbjct:  278 PMLVVGTEKITVSDCKKAVADRVKRLPEEIILIKSN---QCLKDDETISNYEYSPDSYFALRSGISYFRLSKLENIVNQDPVGEGGFGKVYQCEDLATNKVMA----VKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYAD--YESVQLTFKLLTDKKIEFTPPKTMTRQLEEFIAWCLKPEPHERPTAQLLLNSDFIK 614          

HSP 2 Score: 84.3445 bits (207), Expect = 1.273e-16
Identity = 56/191 (29.32%), Postives = 102/191 (53.40%), Query Frame = 3
Query:  171 RYRYKEKEYQNPGYKIRLIKEDLANSVKLSSSNLILVYRNMILEDCERIIHYEID---KKDFIWFGTKDDYDGEFGQHLIITIKADECYES--------IDISEKLLVKSTYKIVHIRNILGRIYKWITKVKFLNVNRNKLSDDQLIEECQLIENPFIIIGSP-EFKVDRGNLDELQSNLRYFGGTRLRLN 707
            ++R   KE  +   +I L+K DL+ +V++  ++ +L+  +MILE  + I +Y I     +D IWFG   DY  +  + +I+    D    +        I ++ +L+V+   +I  IRN +G+IYKWI K+ F N N+ +L DDQ++EE  L+    I + +P  + V   ++   QS +   G  ++ ++
Sbjct:  101 KFRGFGKELYSDKEQIDLVKMDLSKAVRVDKNDFVLICDDMILESDDWIKYYRIPNPVTEDVIWFGKIADY-LKLNEIIIVMKSMDRSGGNSEPGSMFCIPVNIQLIVRLDQRIGEIRNHIGKIYKWIAKIPFWNFNKERLKDDQMVEESGLLNTSIIYMSTPMSYNVALSSISTDQSPMLVVGTEKITVS 290          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 218.779 bits (556), Expect = 4.642e-61
Identity = 134/346 (38.73%), Postives = 195/346 (56.36%), Query Frame = 3
Query: 1383 PCIIFTPADVTAGQTRKILSDSN---PEKEVFLASSDFTQFYKDSEIMPSEE-----------NICAITVSKFKQIKDWKLIGGGGYAEVYTNE-LYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGK-FYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATD-DLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK----KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            P ++     +T    +K ++D     PE+ + + S+   Q  KD E + + E            I    +SK + I +   +G GG+ +VY  E L TN++      +K++ +P NK L +V   ++EI+TFS++  H+RI+Q+ D+F +D K F I ME+M NGSL S+LE NG L E +I   S+Q+LEGL YLH+  I HRDIK  N+LLDD  NAKL+DFGL+ C  E +  D   GI QS  GT  W APEV     YG  ADIWSFG T++EM+ G+ P+ D  Y+ +    K   +K ++    K ++  L   +  CL+ +P +RP  Q LL  DF K
Sbjct:  317 PMLVVGTEKITVSDCKKAVADRVKRLPEEIILIKSN---QCLKDDETISNYEYSPDSYFALRSGISYFRLSKLENIVNQDPVGEGGFGKVYQCEDLATNKVMA----VKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYAD--YESVQLTFKLLTDKKIEFTPPKTMTRQLEEFIAWCLKPEPHERPTAQLLLNSDFIK 653          

HSP 2 Score: 83.1889 bits (204), Expect = 3.259e-16
Identity = 52/163 (31.90%), Postives = 90/163 (55.21%), Query Frame = 3
Query:  171 RYRYKEKEYQNPGYKIRLIKEDLANSVKLSSSNLILVYRNMILEDCERIIHYEID---KKDFIWFGTKDDYDGEFGQHLIITIKADECYES--------IDISEKLLVKSTYKIVHIRNILGRIYKWITKVKFLNVNRNKLSDDQLIEECQLIENPFIIIGSP 626
            ++R   KE  +   +I L+K DL+ +V++  ++ +L+  +MILE  + I +Y I     +D IWFG   DY  +  + +I+    D    +        I ++ +L+V+   +I  IRN +G+IYKWI K+ F N N+ +L DDQ++EE  L+    I + +P
Sbjct:   73 KFRGFGKELYSDKEQIDLVKMDLSKAVRVDKNDFVLICDDMILESDDWIKYYRIPNPVTEDVIWFGKIADY-LKLNEIIIVMKSMDRSGGNSEPGSMFCIPVNIQLIVRLDQRIGEIRNHIGKIYKWIAKIPFWNFNKERLKDDQMVEESGLLNTSIIYMSTP 234          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 218.779 bits (556), Expect = 8.185e-61
Identity = 134/346 (38.73%), Postives = 195/346 (56.36%), Query Frame = 3
Query: 1383 PCIIFTPADVTAGQTRKILSDSN---PEKEVFLASSDFTQFYKDSEIMPSEE-----------NICAITVSKFKQIKDWKLIGGGGYAEVYTNE-LYTNELTGKQNVLKQLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGK-FYIEMEFMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAANVLLDDDNNAKLSDFGLANCFHEATD-DLIRGIKQSTNGTMKWMAPEVFTGN-YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLK----KEVSDNLFTLLDKCLQFDPKDRPMCQKLLEYDFFK 2354
            P ++     +T    +K ++D     PE+ + + S+   Q  KD E + + E            I    +SK + I +   +G GG+ +VY  E L TN++      +K++ +P NK L +V   ++EI+TFS++  H+RI+Q+ D+F +D K F I ME+M NGSL S+LE NG L E +I   S+Q+LEGL YLH+  I HRDIK  N+LLDD  NAKL+DFGL+ C  E +  D   GI QS  GT  W APEV     YG  ADIWSFG T++EM+ G+ P+ D  Y+ +    K   +K ++    K ++  L   +  CL+ +P +RP  Q LL  DF K
Sbjct:  345 PMLVVGTEKITVSDCKKAVADRVKRLPEEIILIKSN---QCLKDDETISNYEYSPDSYFALRSGISYFRLSKLENIVNQDPVGEGGFGKVYQCEDLATNKVMA----VKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYAD--YESVQLTFKLLTDKKIEFTPPKTMTRQLEEFIAWCLKPEPHERPTAQLLLNSDFIK 681          

HSP 2 Score: 83.1889 bits (204), Expect = 3.712e-16
Identity = 52/163 (31.90%), Postives = 90/163 (55.21%), Query Frame = 3
Query:  171 RYRYKEKEYQNPGYKIRLIKEDLANSVKLSSSNLILVYRNMILEDCERIIHYEID---KKDFIWFGTKDDYDGEFGQHLIITIKADECYES--------IDISEKLLVKSTYKIVHIRNILGRIYKWITKVKFLNVNRNKLSDDQLIEECQLIENPFIIIGSP 626
            ++R   KE  +   +I L+K DL+ +V++  ++ +L+  +MILE  + I +Y I     +D IWFG   DY  +  + +I+    D    +        I ++ +L+V+   +I  IRN +G+IYKWI K+ F N N+ +L DDQ++EE  L+    I + +P
Sbjct:  101 KFRGFGKELYSDKEQIDLVKMDLSKAVRVDKNDFVLICDDMILESDDWIKYYRIPNPVTEDVIWFGKIADY-LKLNEIIIVMKSMDRSGGNSEPGSMFCIPVNIQLIVRLDQRIGEIRNHIGKIYKWIAKIPFWNFNKERLKDDQMVEESGLLNTSIIYMSTP 262          
The following BLAST results are available for this feature:
BLAST of Kinase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK241.611e-3338.79serine/threonine kinase 24 [Source:HGNC Symbol;Acc... [more]
STK242.947e-3338.79serine/threonine kinase 24 [Source:HGNC Symbol;Acc... [more]
STK247.095e-3340.63serine/threonine kinase 24 [Source:HGNC Symbol;Acc... [more]
OXSR11.081e-3132.07oxidative stress responsive kinase 1 [Source:HGNC ... [more]
MAP3K21.122e-3133.66mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-12.698e-3233.98Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-12.840e-3233.98Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-12.958e-3233.98Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-13.106e-3233.98Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-11.502e-3134.75Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GckIII7.230e-3332.82gene:FBgn0266465 transcript:FBtr0083399[more]
Mekk11.506e-3134.08gene:FBgn0024329 transcript:FBtr0083684[more]
Mekk11.601e-3134.08gene:FBgn0024329 transcript:FBtr0331353[more]
mbt1.096e-3032.69gene:FBgn0025743 transcript:FBtr0074285[more]
Ask17.034e-3035.69gene:FBgn0014006 transcript:FBtr0083819[more]
back to top
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk24a1.151e-3536.19serine/threonine kinase 24a (STE20 homolog, yeast)... [more]
stk24b1.529e-3338.79serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
stk24b2.022e-3338.79serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
stk263.280e-3336.05serine/threonine protein kinase 26 [Source:ZFIN;Ac... [more]
map3k33.800e-3334.60mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc39a75.856e-3433.80solute carrier family 39 member 7 [Source:Xenbase;... [more]
slc39a78.151e-3438.79solute carrier family 39 member 7 [Source:Xenbase;... [more]
stk252.886e-3335.61serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk253.301e-3335.61serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk253.371e-3335.61serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk246.017e-3338.32serine/threonine kinase 24 [Source:MGI Symbol;Acc:... [more]
Map3k22.413e-3233.88mitogen-activated protein kinase kinase kinase 2 [... [more]
Map3k35.304e-3232.98mitogen-activated protein kinase kinase kinase 3 [... [more]
Stk47.785e-3233.59serine/threonine kinase 4 [Source:MGI Symbol;Acc:M... [more]
Oxsr12.493e-3132.07oxidative-stress responsive 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Kinase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CAD5|YODA_ARATH1.340e-3733.45Mitogen-activated protein kinase kinase kinase YOD... [more]
sp|Q9FZ36|M3K2_ARATH3.510e-3636.49Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q01389|BCK1_YEAST1.714e-3431.49Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS... [more]
sp|P28829|BYR2_SCHPO1.373e-3333.59Protein kinase byr2 OS=Schizosaccharomyces pombe (... [more]
sp|O22040|ANP1_ARATH3.116e-3336.43Mitogen-activated protein kinase kinase kinase ANP... [more]
back to top
BLAST of Kinase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A9TWT12.973e-4336.98Predicted protein (Fragment) OS=Physcomitrella pat... [more]
A0A1Y1HMA48.246e-4338.35MEKK and related serine/threonine protein kinases ... [more]
A0A109FMJ11.186e-4034.08Pkinase-domain-containing protein OS=Rhodotorula s... [more]
A0A367KPG34.002e-4034.60Uncharacterized protein OS=Rhizopus stolonifer OX=... [more]
A0A0B7NJX55.135e-4036.15Uncharacterized protein OS=Parasitella parasitica ... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk264.324e-3436.05serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
stk267.536e-3436.05serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
stk24b8.373e-3437.83serine/threonine-protein kinase 24-like [Source:NC... [more]
stk24b1.006e-3337.83serine/threonine-protein kinase 24-like [Source:NC... [more]
ENSAMXT00000008518.22.713e-3237.85pep primary_assembly:Astyanax_mexicanus-2.0:19:145... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k24.646e-3133.84mitogen-activated protein kinase kinase kinase 2 [... [more]
stk25a2.267e-2936.41serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
MAP4K31.107e-2830.57mitogen-activated protein kinase kinase kinase kin... [more]
pak43.914e-2829.96p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
ENSPMAT00000002959.17.539e-2830.34pep scaffold:Pmarinus_7.0:GL476671:15807:33413:-1 ... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK12.469e-3631.49MAPKKK acting in the protein kinase C signaling pa... [more]
CDC53.795e-3331.42Polo-like kinase; controls targeting and activatio... [more]
CDC154.679e-3231.80Protein kinase of the Mitotic Exit Network; locali... [more]
STE203.398e-3136.50Cdc42p-activated signal transducing kinase; involv... [more]
KIC12.048e-3033.96Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414104.341e-3835.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490479.366e-3231.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478211.523e-3131.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378271.987e-3130.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428457.161e-3131.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022068.22.330e-3439.72serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
ENSORLT00000022064.22.656e-3439.72serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
ENSORLT00000022066.22.656e-3439.72serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
stk24b4.683e-3338.32serine/threonine kinase 24 [Source:NCBI gene;Acc:1... [more]
map3k35.646e-3333.33mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Kinase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053627.10.000e+099.45SMESG000053627.1[more]
SMESG000009500.11.304e-6138.73SMESG000009500.1[more]
SMESG000009500.12.699e-6138.73SMESG000009500.1[more]
SMESG000009500.14.642e-6138.73SMESG000009500.1[more]
SMESG000009500.18.185e-6138.73SMESG000009500.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015243 ID=SMED30015243|Name=Kinase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2414bp
CTGATTAATTGTGCACAAGGACTACAGACAATAGCATGACAATATTTTAA
TCAAATTGAATCACCATTCGATCTGATCCGATCTCAACTGTGATTGGTTG
AGATTTCTAACAGTATTATTGAATTTATAGCGAAAACTACTGTGCTATTA
AGTATTATTTTTAAATGCATAGATATAGATACAAGGAAAAAGAATACCAA
AATCCAGGATATAAAATCCGATTAATCAAAGAAGATCTAGCAAATTCTGT
TAAACTGAGCTCATCTAACCTCATCCTTGTTTACAGGAATATGATTTTGG
AAGACTGTGAAAGGATTATTCATTATGAAATTGATAAGAAAGATTTCATT
TGGTTTGGAACAAAGGATGATTACGATGGAGAATTCGGACAACACTTGAT
CATTACAATAAAAGCTGATGAGTGTTATGAATCAATAGATATTTCCGAAA
AGCTCCTGGTAAAATCGACATATAAAATCGTCCATATCAGAAATATACTG
GGCAGGATATACAAATGGATTACTAAAGTCAAATTCTTGAACGTCAATAG
AAACAAATTATCGGATGATCAATTGATTGAAGAATGTCAATTAATTGAAA
ATCCTTTTATCATAATTGGATCCCCAGAATTTAAGGTCGATCGAGGAAAT
CTTGACGAACTTCAAAGTAATCTTAGATATTTCGGAGGTACCCGATTGAG
ATTGAACCCTTTTGAAATGTCGCCTTTAATGGAAATATTGAAATTAATGA
CTGATAAAACTAATCGTAACAGATCGTTTCTGTCAATATTCATGGATTTG
ATCAAATTAGAAAATCCTGAAGATGTCAATATAAAGCACGATACAGAATT
GTTTCTCTGTGATTGGACAAAATATTATGATAGGGCAGACAGAAATCAAT
TGTCAATTGAAGATAAAACCTCAATTTATAGACAAGATTATTCGGATAAT
CTGAATGATGTTACAGACGAGGTCGAAATTGGCACCGCTGATGAACATTA
TCAAGTTATGCTTAGTTTATATCAAGTTGGAGTTCAGTTTATAGAAAAAT
ATTTTCCGACGCCTTTTGATAATTTGAAAAATTCCTTGGCGCCAATATTT
GAAGCTTATTCAAAAAGTCGAGATCTTAATCTCAACAATGATAAGTTTGC
CGATCTGAGGCTTGGACGCCGATTGACTTTCTTCTTCAAAAGATTCCTTG
ACAATGGCTACCGATTGAATGATAAGGAATTCAATGTCCAATTTATTTTG
ATTCTTCCAGATCTTTTGCAAATATTACAAAAGATTAACTCATTAATCAT
GAATTATTGGACTCAAATAAATTATTCTGGGACCAATAGTTTCAAAAAAT
TATACGTACATCCGAATCTTGAGAAAGATCGACCTTGTATAATATTTACA
CCGGCAGATGTGACAGCTGGTCAAACAAGAAAAATTTTGTCTGATTCAAA
TCCTGAAAAAGAAGTATTTTTAGCGTCAAGTGATTTCACTCAATTTTATA
AAGACAGTGAAATAATGCCGAGTGAGGAGAACATTTGTGCTATTACGGTG
TCAAAATTCAAACAAATCAAAGATTGGAAATTAATTGGAGGCGGCGGGTA
TGCAGAAGTGTATACTAATGAGCTGTACACTAATGAACTCACCGGCAAAC
AGAATGTTCTGAAACAATTAGTCCTACCATCCAATAAAAGCCTTGATGAA
GTGAATGAAGTCCTACGTGAGATTATAACGTTTTCTCAAATAGCGCCACA
CAGGAGGATCATGCAGTTTACTGATTACTTTATTGAAGATGGCAAATTTT
ACATTGAAATGGAATTCATGAAAAATGGTTCGCTAAAATCATTTCTGGAA
CATAATGGTCGACTAAATGAAACACAGATCAAACACTTTTCCTCCCAGAT
ATTAGAAGGACTGGAATATCTTCATAGCAAATCAATCTGCCATCGAGACA
TCAAAGCTGCAAATGTTCTGCTTGATGATGACAACAATGCAAAACTGAGT
GATTTTGGACTGGCCAATTGCTTCCATGAAGCCACTGATGATTTGATTCG
GGGAATCAAACAATCTACAAATGGTACTATGAAATGGATGGCTCCTGAAG
TATTCACTGGAAATTACGGTTCACCAGCGGATATTTGGTCATTTGGAATA
ACAATGATTGAAATGATAACTGGTAAAGATCCGTTTCCAGATATTAATTA
TAAAGAAATTTATAATAGAATCAAAAAATATGGCAATAAATCACTCAAGA
AAGAAGTGAGTGACAATTTATTTACACTTCTTGATAAATGTCTCCAATTC
GATCCGAAAGATAGACCTATGTGTCAAAAACTATTGGAATATGATTTTTT
TAAATAAGTATCTCATTATTTTTTTAACAAACATTTAATAAAATTCATTC
TTATTTCACTGACA
back to top

protein sequence of SMED30015243-orf-1

>SMED30015243-orf-1 ID=SMED30015243-orf-1|Name=SMED30015243-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=731bp
MHRYRYKEKEYQNPGYKIRLIKEDLANSVKLSSSNLILVYRNMILEDCER
IIHYEIDKKDFIWFGTKDDYDGEFGQHLIITIKADECYESIDISEKLLVK
STYKIVHIRNILGRIYKWITKVKFLNVNRNKLSDDQLIEECQLIENPFII
IGSPEFKVDRGNLDELQSNLRYFGGTRLRLNPFEMSPLMEILKLMTDKTN
RNRSFLSIFMDLIKLENPEDVNIKHDTELFLCDWTKYYDRADRNQLSIED
KTSIYRQDYSDNLNDVTDEVEIGTADEHYQVMLSLYQVGVQFIEKYFPTP
FDNLKNSLAPIFEAYSKSRDLNLNNDKFADLRLGRRLTFFFKRFLDNGYR
LNDKEFNVQFILILPDLLQILQKINSLIMNYWTQINYSGTNSFKKLYVHP
NLEKDRPCIIFTPADVTAGQTRKILSDSNPEKEVFLASSDFTQFYKDSEI
MPSEENICAITVSKFKQIKDWKLIGGGGYAEVYTNELYTNELTGKQNVLK
QLVLPSNKSLDEVNEVLREIITFSQIAPHRRIMQFTDYFIEDGKFYIEME
FMKNGSLKSFLEHNGRLNETQIKHFSSQILEGLEYLHSKSICHRDIKAAN
VLLDDDNNAKLSDFGLANCFHEATDDLIRGIKQSTNGTMKWMAPEVFTGN
YGSPADIWSFGITMIEMITGKDPFPDINYKEIYNRIKKYGNKSLKKEVSD
NLFTLLDKCLQFDPKDRPMCQKLLEYDFFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 549..562
score: 46.37
coord: 655..677
score: 31.48
coord: 698..720
score: 26.65
coord: 585..603
score: 46.1
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 468..729
e-value: 4.8E-72
score: 255.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 471..729
e-value: 3.2E-60
score: 203.7
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 468..729
score: 45.898
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 463..730
e-value: 3.6E-74
score: 251.9
NoneNo IPR availablePANTHERPTHR11584:SF369APOPTOTIC SIGNAL-REGULATING KINASE 1, ISOFORM Ccoord: 469..729
NoneNo IPR availablePANTHERPTHR11584SERINE/THREONINE PROTEIN KINASEcoord: 469..729
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 591..603
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 469..729