Actin, cytoplasmic

Overview
NameActin, cytoplasmic
Smed IDSMED30015206
Length (bp)691
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015206

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30015206SMESG000032456.1 SMESG000032323.1 Contig697newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015206SMESG000032456.1 SMESG000032323.1 Contig697uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015206SMESG000046951.1 Contig697newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30015206SMESG000046951.1 Contig697uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30015206 dd_Smed_v4_11953_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30015206 dd_Smed_v6_11953_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 88.1965 bits (217), Expect = 8.568e-21
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 88.1965 bits (217), Expect = 8.568e-21
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 87.8113 bits (216), Expect = 1.748e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   62 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 186          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 87.4261 bits (215), Expect = 1.595e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 87.4261 bits (215), Expect = 1.595e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 87.8113 bits (216), Expect = 3.017e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  G+VL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   28 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 152          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 87.8113 bits (216), Expect = 3.017e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  G+VL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   28 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 152          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 87.8113 bits (216), Expect = 3.017e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  G+VL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   28 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 152          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 87.8113 bits (216), Expect = 3.017e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  G+VL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   28 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 152          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 87.8113 bits (216), Expect = 3.017e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  G+VL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   28 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 152          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act42A (gene:FBgn0000043 transcript:FBtr0086029)

HSP 1 Score: 87.8113 bits (216), Expect = 4.461e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 87.8113 bits (216), Expect = 4.976e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 87.8113 bits (216), Expect = 4.976e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 87.8113 bits (216), Expect = 4.976e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070823)

HSP 1 Score: 87.8113 bits (216), Expect = 4.976e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 87.8113 bits (216), Expect = 9.966e-21
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 87.4261 bits (215), Expect = 4.914e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: acta2 (actin alpha 2, smooth muscle [Source:ZFIN;Acc:ZDB-GENE-030131-1229])

HSP 1 Score: 87.0409 bits (214), Expect = 8.946e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   30 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE 154          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 87.4261 bits (215), Expect = 1.045e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 87.4261 bits (215), Expect = 1.045e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 87.4261 bits (215), Expect = 1.418e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 87.0409 bits (214), Expect = 1.645e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 87.0409 bits (214), Expect = 1.754e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   73 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE 197          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 87.0409 bits (214), Expect = 1.958e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   77 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE 201          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 87.0409 bits (214), Expect = 2.010e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   70 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE 194          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 88.5817 bits (218), Expect = 9.578e-21
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:  128 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 252          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Acta2 (actin, alpha 2, smooth muscle, aorta [Source:MGI Symbol;Acc:MGI:87909])

HSP 1 Score: 87.0409 bits (214), Expect = 1.429e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   73 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE 197          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 87.8113 bits (216), Expect = 2.123e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actg2 (actin, gamma 2, smooth muscle, enteric [Source:MGI Symbol;Acc:MGI:104589])

HSP 1 Score: 86.2705 bits (212), Expect = 2.947e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actg2 (actin, gamma 2, smooth muscle, enteric [Source:MGI Symbol;Acc:MGI:104589])

HSP 1 Score: 85.1149 bits (209), Expect = 4.603e-20
Identity = 54/128 (42.19%), Postives = 69/128 (53.91%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVT 497
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+T
Sbjct:   72 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILT 195          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|P30170|ACT10_SOLTU (Actin-85C (Fragment) OS=Solanum tuberosum OX=4113 GN=AC85C PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.050e-19
Identity = 54/129 (41.86%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   V+N DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTD+L+KI+TE
Sbjct:   53 IEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTE 177          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|P84336|ACTB_CAMDR (Actin, cytoplasmic 1 OS=Camelus dromedarius OX=9838 GN=ACTB PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.593e-19
Identity = 56/129 (43.41%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+R  VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IERGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q00215|ACTC_STYPL (Actin, cytoplasmic OS=Styela plicata OX=7726 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.625e-19
Identity = 55/129 (42.64%), Postives = 72/129 (55.81%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F  + MY+ +  VLSLYA GR  G+V++       TV IYE Y L HAIF +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTRAMYVNIQAVLSLYASGRTTGLVMDSGDGVSHTVPIYEGYALPHAIFRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|P02578|ACT1_ACACA (Actin-1 OS=Acanthamoeba castellanii OX=5755 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.190e-19
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|P18602|ACT3_ARTSX (Actin, clone 302 (Fragment) OS=Artemia sp. OX=6662 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.400e-19
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   23 IEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 147          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A443QLF2 (Putative beta-actin-like protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_11349 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 8.704e-19
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   28 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 152          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: B5SUT6 (Actin (Fragment) OS=Heterodera sp. SAS-2008 OX=501551 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.256e-19
Identity = 57/129 (44.19%), Postives = 72/129 (55.81%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R V E             K++R K   I    + + F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:    7 IEHGIVTNWDDMEKIWHHTFYNELRVVPEEHPVLLTEAPLNPKANREKMTQI----MFKTFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 131          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A0V0UI43 (Actin-5C OS=Trichinella murrelli OX=144512 GN=Act5C PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.017e-18
Identity = 59/134 (44.03%), Postives = 74/134 (55.22%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTEFQREI 515
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE +REI
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTEPEREI 201          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A0V1C146 (Actin-5C OS=Trichinella spiralis OX=6334 GN=Act5C PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.017e-18
Identity = 59/134 (44.03%), Postives = 74/134 (55.22%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTEFQREI 515
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE +REI
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTEPEREI 201          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A0V0RK23 (Actin-5C OS=Trichinella nelsoni OX=6336 GN=Act5C PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.017e-18
Identity = 59/134 (44.03%), Postives = 74/134 (55.22%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTEFQREI 515
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE +REI
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTEPEREI 201          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 87.4261 bits (215), Expect = 8.859e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 87.4261 bits (215), Expect = 8.948e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 87.0409 bits (214), Expect = 1.065e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   73 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 197          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: acta2 (actin alpha 2, smooth muscle [Source:NCBI gene;Acc:103040556])

HSP 1 Score: 86.6557 bits (213), Expect = 1.462e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH+S YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   73 IEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE 197          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: acta1b (actin, alpha skeletal muscle 2 [Source:NCBI gene;Acc:103031709])

HSP 1 Score: 85.8853 bits (211), Expect = 2.728e-19
Identity = 54/129 (41.86%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   +TN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL++       V IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   73 IEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI----MFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTE 197          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.758e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.811e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 82.0333 bits (201), Expect = 9.008e-19
Identity = 52/129 (40.31%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLET-------VKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             KS+R K   I    +   F     Y+++  VLSLY+ GR  GIVL++       V IY  + L HAI  IDLA ++LTDYL+KI++E
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQI----MFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 87.8113 bits (216), Expect = 1.950e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 87.4261 bits (215), Expect = 2.626e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 87.4261 bits (215), Expect = 2.981e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 87.0409 bits (214), Expect = 3.426e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 87.0409 bits (214), Expect = 3.608e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 87.4261 bits (215), Expect = 6.802e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000011677.2 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 87.4261 bits (215), Expect = 8.881e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:  106 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 230          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000029375.1 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 87.4261 bits (215), Expect = 8.892e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 87.4261 bits (215), Expect = 9.538e-20
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 87.4261 bits (215), Expect = 1.196e-19
Identity = 55/129 (42.64%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIV++       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   71 IEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000058003.1 (SMESG000058003.1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.311e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000057992.1 (SMESG000057992.1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.311e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000057988.1 (SMESG000057988.1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.311e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000057914.1 (SMESG000057914.1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.357e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000057913.1 (SMESG000057913.1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.357e-20
Identity = 56/129 (43.41%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  174 IKRCYVTNCDDKESIWHYSMYNESRAVDE-------------KSSRMKCR*ISR*CIKRGFK*QVMYLTM*IVLSLYAPGRAMGIVLE-------TVKIYEVYELSHAIFGIDLACKNLTDYLLKIVTE 500
            I+   VTN DD E IWH++ YNE R   E             K++R K   I    +   F    MY+ +  VLSLYA GR  GIVL+       TV IYE Y L HAI  +DLA ++LTDYL+KI+TE
Sbjct:   72 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI----MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 196          
The following BLAST results are available for this feature:
BLAST of Actin, cytoplasmic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTG18.568e-2142.64actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG18.568e-2142.64actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG11.748e-2042.64actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTB1.595e-1942.64actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTB1.595e-1942.64actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-43.017e-2042.64Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-43.017e-2042.64Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-43.017e-2042.64Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-43.017e-2042.64Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-43.017e-2042.64Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Act42A4.461e-2043.41gene:FBgn0000043 transcript:FBtr0086029[more]
Act5C4.976e-2043.41gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C4.976e-2043.41gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C4.976e-2043.41gene:FBgn0000042 transcript:FBtr0345894[more]
Act5C4.976e-2043.41gene:FBgn0000042 transcript:FBtr0070823[more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb19.966e-2142.64actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb14.914e-2042.64actin, beta 1 [Source:NCBI gene;Acc:57934][more]
acta28.946e-2042.64actin alpha 2, smooth muscle [Source:ZFIN;Acc:ZDB-... [more]
actb11.045e-1942.64actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb11.045e-1942.64actin, beta 1 [Source:NCBI gene;Acc:57934][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actg11.418e-1942.64actin gamma 1 [Source:NCBI gene;Acc:394957][more]
actb1.645e-1942.64actin, beta [Source:NCBI gene;Acc:407952][more]
acta21.754e-1942.64actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
acta21.958e-1942.64actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
acta22.010e-1942.64actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actg19.578e-2142.64actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Acta21.429e-2042.64actin, alpha 2, smooth muscle, aorta [Source:MGI S... [more]
Actb2.123e-2042.64actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg22.947e-2042.64actin, gamma 2, smooth muscle, enteric [Source:MGI... [more]
Actg24.603e-2042.19actin, gamma 2, smooth muscle, enteric [Source:MGI... [more]
back to top
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30170|ACT10_SOLTU1.050e-1941.86Actin-85C (Fragment) OS=Solanum tuberosum OX=4113 ... [more]
sp|P84336|ACTB_CAMDR1.593e-1943.41Actin, cytoplasmic 1 OS=Camelus dromedarius OX=983... [more]
sp|Q00215|ACTC_STYPL1.625e-1942.64Actin, cytoplasmic OS=Styela plicata OX=7726 PE=3 ... [more]
sp|P02578|ACT1_ACACA2.190e-1943.41Actin-1 OS=Acanthamoeba castellanii OX=5755 PE=1 S... [more]
sp|P18602|ACT3_ARTSX2.400e-1943.41Actin, clone 302 (Fragment) OS=Artemia sp. OX=6662... [more]
back to top
BLAST of Actin, cytoplasmic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443QLF28.704e-1943.41Putative beta-actin-like protein (Fragment) OS=Lep... [more]
B5SUT69.256e-1944.19Actin (Fragment) OS=Heterodera sp. SAS-2008 OX=501... [more]
A0A0V0UI431.017e-1844.03Actin-5C OS=Trichinella murrelli OX=144512 GN=Act5... [more]
A0A0V1C1461.017e-1844.03Actin-5C OS=Trichinella spiralis OX=6334 GN=Act5C ... [more]
A0A0V0RK231.017e-1844.03Actin-5C OS=Trichinella nelsoni OX=6336 GN=Act5C P... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb18.859e-2042.64actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb28.948e-2042.64actin beta [Source:NCBI gene;Acc:103030443][more]
actb11.065e-1942.64actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
acta21.462e-1942.64actin alpha 2, smooth muscle [Source:NCBI gene;Acc... [more]
acta1b2.728e-1941.86actin, alpha skeletal muscle 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004586.11.758e-2042.64pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011113.11.811e-2042.64pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ACT19.008e-1940.31Actin; structural protein involved in cell polariz... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380061.950e-2042.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450132.626e-2042.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379762.981e-2042.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385203.426e-2042.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426463.608e-2042.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021726.26.802e-2042.64actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
ENSORLT00000011677.28.881e-2042.64actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
ENSORLT00000029375.18.892e-2042.64actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
actb9.538e-2042.64cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb1.196e-1942.64cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
back to top
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058003.12.311e-2043.41SMESG000058003.1[more]
SMESG000057992.12.311e-2043.41SMESG000057992.1[more]
SMESG000057988.12.311e-2043.41SMESG000057988.1[more]
SMESG000057914.12.357e-2043.41SMESG000057914.1[more]
SMESG000057913.12.357e-2043.41SMESG000057913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015206 ID=SMED30015206|Name=Actin, cytoplasmic|organism=Schmidtea mediterranea sexual|type=transcript|length=691bp
TGTTGGAATTTACTCTCTTTTATTTAATTTTTTTGGAATATGATTTTTTC
ATTTTTCAATTATTGGTCAACCGGTAAACCAAGACATTGCTGTGATTGTT
ATGATTGGAACGGTTCAAACGAATAGATTTGATAAAAACGAGGCTCACTG
TAAGCGATGAATCTTACCTTTGAATTAAACGATGTTATGTGACAAATTGT
GATGACAAGGAAAGTATCTGGCATTACTCAATGTACAATGAGTCCAGAGC
AGTTGATGAGAAAAGTAGCAGAATGAAGTGCCGTTGAATCTCAAGGTAAT
GCATAAAAAGAGGATTCAAATAACAAGTAATGTATCTGACTATGTAAATA
GTTCTTTCTTTGTATGCACCTGGGCGTGCAATGGGCATCGTTTTGGAGAC
TGTGAAAATTTATGAAGTTTATGAGTTGAGTCATGCAATTTTTGGAATAG
ATTTAGCTTGCAAAAATTTAACAGATTATTTGTTGAAAATAGTTACAGAA
TTTCAAAGAGAAATCAACATGGGACCAGATGATGGCCTAGATGTTGTAGC
ACATGAAATTATCGTTTTTCCTGAGTTCAATCAAACATGGTATTATTGAG
AGGATGCTGATGTTAAAGAGTAGTTCAATAGAATTCTGCTTTTTACATGG
AATTTTAGGGATTGATATCTTCTCTTATTCGTTGATAGGTC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 25..40
e-value: 1.1E-6
score: 30.2
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 5..24
e-value: 1.1E-6
score: 30.2