Protocadherin

Overview
NameProtocadherin
Smed IDSMED30015204
Length (bp)3429
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin (SMED30015204) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin (SMED30015204) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin (SMED30015204) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin (SMED30015204) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015204

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30015204SMESG000029673.1 SmedASXL_015024SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30015204SMESG000029673.1 SmedASXL_015023SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30015204SMESG000029673.1 dd_Smed_v4_9677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30015204SMESG000029673.1 dd_Smed_v4_9677_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30015204SMESG000029673.1 dd_Smed_v6_9677_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30015204SMESG000029673.1 dd_Smed_v4_9677_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 245.743 bits (626), Expect = 7.956e-66
Identity = 230/812 (28.33%), Postives = 398/812 (49.01%), Query Frame = 3
Query:  210 FIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFVK-ADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSAT--DMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            F + L+ V F    + +    + ++E     +LIG+L     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ T  D D++  +          +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       + K++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y+F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN      P +++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:   42 FAVLLVCVVF---HSGAQEKNYTIREEIPENVLIGNL-----LKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP-----STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 809          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 243.817 bits (621), Expect = 8.685e-66
Identity = 230/812 (28.33%), Postives = 398/812 (49.01%), Query Frame = 3
Query:  210 FIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFVK-ADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSAT--DMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            F + L+ V F    + +    + ++E     +LIG+L     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ T  D D++  +          +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       + K++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y+F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN      P +++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:   42 FAVLLVCVVF---HSGAQEKNYTIREEIPENVLIGNL-----LKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP-----STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 809          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 243.432 bits (620), Expect = 8.796e-66
Identity = 230/812 (28.33%), Postives = 397/812 (48.89%), Query Frame = 3
Query:  210 FIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFVK-ADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            F + L+ V F    + +    + ++E     +LIG+L     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ TD D          +   +  +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       + K++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y+F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN      P +++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:   31 FAVLLVCVVF---HSGAQEKNYTIREEIPENVLIGNL-----LKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP-----STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 798          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 243.432 bits (620), Expect = 8.796e-66
Identity = 230/812 (28.33%), Postives = 397/812 (48.89%), Query Frame = 3
Query:  210 FIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFVK-ADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            F + L+ V F    + +    + ++E     +LIG+L     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ TD D          +   +  +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       + K++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y+F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN      P +++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:   31 FAVLLVCVVF---HSGAQEKNYTIREEIPENVLIGNL-----LKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP-----STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 798          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 243.432 bits (620), Expect = 1.151e-65
Identity = 230/812 (28.33%), Postives = 397/812 (48.89%), Query Frame = 3
Query:  210 FIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFVK-ADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            F + L+ V F    + +    + ++E     +LIG+L     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ TD D          +   +  +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       + K++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y+F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN      P +++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:   42 FAVLLVCVVF---HSGAQEKNYTIREEIPENVLIGNL-----LKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP-----STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 809          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 150.599 bits (379), Expect = 2.929e-36
Identity = 162/590 (27.46%), Postives = 275/590 (46.61%), Query Frame = 3
Query:  789 LRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQ--NENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH-FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            +R+  ++DRE ++K  L + A +   P ++ ST + +++ D+ DNSP+F K      I+E+  I   +  +FA+DLD  +N ++ +S G       ++   IN K+G I     LD +      L  I     T   E+  +V++   + NDNAPV +     + S NV ++ ENI     IA++ ATD D  +      S +    +  +  D S      + L + +D + N    A I+ +D   P   +T  + I V+D ND  P   AA   + ++E V +   V ++ A D D G N  + Y ++ +  F IDE++G+++T  + DRE T  Y L+ T  D        P+   L+++T I V++KDIND AP F K  Y  +I E       + ++ A D+D +   ++I+Y +     E  S        +   G I +    L R+ + +    I A D G +  R  V+V   I+D+N       + +D   S+ I     +G  V  LKA D D G N+ + Y I   +  + F+++  SG + +       D     ++V  SD    PL  +T + +
Sbjct:  222 IRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEG---NGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFA-----SDSYNVTIL-ENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYST---GEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDM-----GTPS---LNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED---QKITYRIEEADREVFS-----ILDIGDQGAILSVSGELKRQDHKVR-VEISATDQGGLQGRCVVNVF--IDDVNSA----PYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEV 772          

HSP 2 Score: 128.642 bits (322), Expect = 1.580e-29
Identity = 167/673 (24.81%), Postives = 298/673 (44.28%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETI-LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILL--TKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEK-VLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEH---ELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTT 2537
            + + + D+ D+SP++ +      I E + IG+      A+DLDS  +  I  Y+L   N   L    +  N+          +++  A +DRE +  I L ++A D G+P    +  + I + D+NDN+PVF      ++I EN  I   +  + A D D   N K+ +S  +S  I       I+   G++ +++ +D      T ++  +       + T+ L + V + ND+AP +       ++  ++ +EEN+     +  + A D D+          +G +K S   ++  ++ + + L+  TK LDRET   +   +  +D G P   T+  I + + D ND  P F      V I E +P  S +  L A D D   + ++ YRI+ A   +     +    +I     +GE K +    D +  V+   T++  L    ++ V I D+N  AP F    +   IPE S     V ++ AED D    N +I Y++           S  +F + P     +    LDRE     S  + A D        S  + V ++D+NDN PQ++ SS    +  I+ +  VG     + A+D+D G N  ++Y + + +     +LF+L++ SG+L +  +       +I L +   D G   L+  +
Sbjct:  256 VVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEI-EYSLGEGNGKNL----LAINA-------KSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGI---GGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLI------AAQKMITLEENVAIGEEVGRVYAIDEDS--------GPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAIL--SVSGELKRQ----DHKVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHD-RGDNARIVYSI----------DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS---YAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS 876          

HSP 3 Score: 117.472 bits (293), Expect = 3.933e-26
Identity = 152/591 (25.72%), Postives = 254/591 (42.98%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYI--NGKNGKIF--VKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGG--LKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH-------FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHS------FSIEAWDSGPITHRVSVDVVVKIEDLNDNFP 2255
            + I++ DINDH+P    ++ +I + E+  IG       A D DS P N I +Y+++   +     F I  +S          L++    +DRE   +  L + A D G+P L  ST + + + DINDN+P F K    ++I E       +  + A D D  ++ K+T+    +    DR  F I   G  G I     ++   D +V    + I  TD        ++    ++ ++AP  +  P        + + E+      + +L A D D         S       ++     D+SV        +  LDRE    F   +   D   PP  T+  I + + D ND +P F ++     I E +PV +   +++A D D+G N  + Y ++ +        F +D  +G LR +S  DRE+     L     DR       P+   LS+ + I + + D+ND AP F++L Y+  I E S     VG+++A D+D E  N  IS+ +           +KL F +  D         L R  +D  +      F ++A  SG ++   +V V + + D+NDN P
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGP-NGIIKYSMEGSED-----FIIDEDS---------GLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEA----DREVFSILDIGDQGAILSVSGELKRQDHKVR---VEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPF------SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISV--------SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDR-----GTPS---LSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD-EGDNADISFRIF------GGADAKL-FDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA-SSGQLSS--TVPVRIHVSDVNDNKP 998          

HSP 4 Score: 116.316 bits (290), Expect = 8.572e-26
Identity = 163/636 (25.63%), Postives = 276/636 (43.40%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD----STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHF-SIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKS 2432
            ++I++ D+ND++PV+      + I E+  I +      A D D   +  +  Y++   ++S +   +I Y+     T    L  R+DA         I  ++ A+D   P L+ +  LTIN+ DIND++P  +     I+++EN  I + + +++A D D   N  + +S      +E    F I+  +G I   ++LD +     Y L +   D    S   + TI +V +++ NDNAP            NV + EE +   + I +L A D D    I      +       V + L +  +  IL      +  +   +  I   D G        ++N+ + D N   P+F     +V I E  P+   V  L A D D G N+++VY ID + F  ID ++G +  +S  DRE    + +  T         SD     L+++T I VI+ DIND +P F    Y  +I E          V A D+DI   N  + Y +     E+ S  S   F +            LDRE + +    I A D G  +   + ++ + + D+NDN P +     L   + I     VG  V  + A D+D G N+ +++ I  G + +LF + + +
Sbjct:  361 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKV-HYSM--ASSSGIGGLTIDYS-----TGEVTLRERIDAK-----NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYS------MEGSEDFIIDEDSGLIKTTKLLDRETTAR-YSLKVTARDMGTPSLNTSTTIAVV-LKDINDNAPTFD-----KKEYNVTISEE-MPRGSQIITLKAVDNDEDQKITYRIEEAD----REVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRC--VVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTA--------SDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADI-GPNGIVDYFL----NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQ---LSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDA 946          

HSP 5 Score: 92.4337 bits (228), Expect = 1.840e-18
Identity = 82/339 (24.19%), Postives = 161/339 (47.49%), Query Frame = 3
Query:  276 QVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNF-VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSN-----YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFS-FGNS----MNIEDRSKFYINGKNG--KIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVI 1253
            ++ EHS IG  +  L    + +D D      + + +     F +   +G + V +D+DRE   T          F ++      ++       +I++ ++DIND+SP +T S     I E   +G+ +    A D D  P+  +  +  +  ++  ++LF +      D+T      LRV + +DRE+   I L + A D G+P L+ ++ +T+ ++D+NDN+P F +   ++ I EN+ +   +  + A+D D  DN  ++F  FG +     +IE+ ++     +NG  +I  +   DY+ + N +   +Q +     +   + + V + NDN P +
Sbjct:  690 KIPEHSPIGYPVITL----KAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRAT----------FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRL------DRT---SGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAE-----QNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 1000          

HSP 6 Score: 92.0485 bits (227), Expect = 2.411e-18
Identity = 106/429 (24.71%), Postives = 185/429 (43.12%), Query Frame = 3
Query: 1086 FYINGKNGKIFVKQILDYDQEVNTYLLPI---QVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTK-PLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRN------LVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKA 2342
            F ++  +G+I + + +D  + ++ ++L +   +  D T  A T ++V V +  DN+P+     +         + E+    T + S+ A D+D+        S   G   +     L++  K  ++ T  PLDRET    +  +   D G P + +T ++ I V+D ND  P F +    V I E + + + +  + A+D D G N ++       H+S+  ++G+     +     TGE  L   + D +N      +   D  +  LSST  + + + DIND AP         ++ E  +    VG V A D D    N  I Y+M               F +  D  +  T + LDRET   +S  + A D G  +   S  + V ++D+NDN P +        ++ I+ E   G  +  LKA
Sbjct:  213 FTLDTMSGEIRLAKSMDR-EVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGE------IREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNL----LAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKV-------HYSMASSSGI---GGLTIDYSTGEVTLRERI-DAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIKYSME----------GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKE---YNVTISEEMPRGSQIITLKA 605          

HSP 7 Score: 78.9518 bits (193), Expect = 2.116e-14
Identity = 121/481 (25.16%), Postives = 204/481 (42.41%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFY-INGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD---NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENT---GVLR--TNSIFDREKTGE---YKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFK 1925
            I + ++DIND++P + + +  + I E    GS+  +   K +D+  D  I+      +  +  ++FSI+   + D+      +L V   + R+  +    +   +  G   L G   + + I D+N ++P F      + I E++ I   +  + A+D D  DN ++ +S        D S+F+ I+  +G I V   LD +    T+ + +  +D         T + V + + NDN+P         SS+    + E+I   T+   +SA D D   N         SS    +     D    T  T+ ++  LDRE        I  +D G P       I + + D ND  P F      +YI E  PV S V  + A D D G N+ + +RI    D   F I+E+    GV+R  T + FD E       ++L+A             +   LSST  +R+ + D+ND  P  K
Sbjct:  567 IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQ--IITLKAVDNDEDQKITYR----IEEADREVFSIL--DIGDQG----AILSVSGELKRQDHKVRVEISATDQGG---LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-------DSSQFFRIDPSSGDISVSSDLDREDRA-TFSVIVTASDHASPPLNTSTQIEVILDDINDNSP------QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR---TSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA-------------SSGQLSSTVPVRIHVSDVNDNKPALK 1001          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 116.316 bits (290), Expect = 7.380e-26
Identity = 152/591 (25.72%), Postives = 254/591 (42.98%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYIN--GKNGKIFV--KQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGG--LKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH-------FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHS------FSIEAWDSGPITHRVSVDVVVKIEDLNDNFP 2255
            + I++ DINDH+P    ++ +I + E+  IG       A D DS P N I +Y+++   +     F I  +S          L++    +DRE   +  L + A D G+P L  ST + + + DINDN+P F K    ++I E       +  + A D D  ++ K+T+    +    DR  F I   G  G I     ++   D +V    + I  TD        ++    ++ ++AP  +  P        + + E+      + +L A D D         S       ++     D+SV        +  LDRE    F   +   D   PP  T+  I + + D ND +P F ++     I E +PV +   +++A D D+G N  + Y ++ +        F +D  +G LR +S  DRE+     L     DR       P+   LS+ + I + + D+ND AP F++L Y+  I E S     VG+++A D+D E  N  IS+ +           +KL F +  D         L R  +D  +      F ++A  SG ++   +V V + + D+NDN P
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGP-NGIIKYSMEGSED-----FIIDEDSG---------LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEA----DREVFSILDIGDQGAILSVSGELKRQDHKVR---VEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFS------VKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISV--------SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDR-----GTPS---LSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD-EGDNADISFRIF------GGADAKL-FDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA-SSGQLSS--TVPVRIHVSDVNDNKP 639          

HSP 2 Score: 114.775 bits (286), Expect = 2.220e-25
Identity = 165/637 (25.90%), Postives = 281/637 (44.11%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD----STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTIL-LTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH-FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKS 2432
            ++I++ D+ND++PV+      + I E+  I +      A D D   +  +  Y++   ++S +   +I Y+     T    L  R+DA         I  ++ A+D   P L+ +  LTIN+ DIND++P  +     I+++EN  I + + +++A D D   N  + +S      +E    F I+  +G I   ++LD +     Y L +   D    S   + TI +V +++ NDNAP            NV + EE +   + I +L A D D    I      +       V + L +  +  IL ++  L R+ ++  +  I   D G        ++N+ + D N   P+F     +V I E  P+   V  L A D D G N+++VY ID +  F ID ++G +  +S  DRE    + +  T         SD     L+++T I VI+ DIND +P F    Y  +I E          V A D+DI   N  + Y +     E+ S  S   F +            LDRE + +    I A D G  +   + ++ + + D+NDN P +     L   + I     VG  V  + A D+D G N+ +++ I  G + +LF + + +
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKV-HYSM--ASSSGIGGLTIDYS-----TGEVTLRERIDAK-----NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYS------MEGSEDFIIDEDSGLIKTTKLLDRETTAR-YSLKVTARDMGTPSLNTSTTIAVV-LKDINDNAPTFD-----KKEYNVTISEE-MPRGSQIITLKAVDNDEDQKITYRIEEAD----REVFSILDIGDQGAILSVSGELKRQDHK-VRVEISATDQGGLQGRC--VVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTA--------SDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADI-GPNGIVDYFL----NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQ---LSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDA 587          

HSP 3 Score: 92.0485 bits (227), Expect = 2.170e-18
Identity = 82/339 (24.19%), Postives = 161/339 (47.49%), Query Frame = 3
Query:  276 QVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNF-VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSN-----YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFS-FGNS----MNIEDRSKFYINGKNG--KIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVI 1253
            ++ EHS IG  +  L    + +D D      + + +     F +   +G + V +D+DRE   T          F ++      ++       +I++ ++DIND+SP +T S     I E   +G+ +    A D D  P+  +  +  +  ++  ++LF +      D+T      LRV + +DRE+   I L + A D G+P L+ ++ +T+ ++D+NDN+P F +   ++ I EN+ +   +  + A+D D  DN  ++F  FG +     +IE+ ++     +NG  +I  +   DY+ + N +   +Q +     +   + + V + NDN P +
Sbjct:  331 KIPEHSPIGYPVITL----KAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRAT----------FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRL------DRT---SGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAE-----QNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 641          

HSP 4 Score: 77.7962 bits (190), Expect = 4.096e-14
Identity = 121/481 (25.16%), Postives = 204/481 (42.41%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFY-INGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD---NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENT---GVLR--TNSIFDREKTGE---YKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFK 1925
            I + ++DIND++P + + +  + I E    GS+  +   K +D+  D  I+      +  +  ++FSI+   + D+      +L V   + R+  +    +   +  G   L G   + + I D+N ++P F      + I E++ I   +  + A+D D  DN ++ +S        D S+F+ I+  +G I V   LD +    T+ + +  +D         T + V + + NDN+P         SS+    + E+I   T+   +SA D D   N         SS    +     D    T  T+ ++  LDRE        I  +D G P       I + + D ND  P F      +YI E  PV S V  + A D D G N+ + +RI    D   F I+E+    GV+R  T + FD E       ++L+A             +   LSST  +R+ + D+ND  P  K
Sbjct:  208 IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQ--IITLKAVDNDEDQKITYR----IEEADREVFSIL--DIGDQ----GAILSVSGELKRQDHKVRVEISATDQGG---LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-------DSSQFFRIDPSSGDISVSSDLDREDRA-TFSVIVTASDHASPPLNTSTQIEVILDDINDNSP------QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR---TSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA-------------SSGQLSSTVPVRIHVSDVNDNKPALK 642          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 115.931 bits (289), Expect = 1.127e-25
Identity = 196/770 (25.45%), Postives = 344/770 (44.68%), Query Frame = 3
Query:  264 SLQFQVKE----HSEIG--LLIGDLVEN--YRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPL------AKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPA---AITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGE---YKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG 2513
            + +F + E     +E+G  +++G  +E   +RIQD D       NF        +S  +G +F  + +D E I T +            +N+    +  ++ I + D ND +P +    +V N+    ++ +  Y PL      A+DLD    N +  Y++   N S   LF++      + T  + L L     +DRE+    ELL+ A+D+G P L+ ++ + I++ DINDN+P F      I I EN+ I   + ++ A D D   + +L +S     N E    F IN   G I V   ++  +E   +   ++VTD  K ++ I+ + V++ NDN P+I      N  N+ + V +  +    I  ++  D+D S            LK S   ++L++     I L  PL  +T    + T+   D G+       +  ++ L       HFP     + TV + E    E  V K N       + S+        H  ++++TG+L+T S  D E+  E   + +  T +D           K LS+ T   + I DIND +P F +  Y F++ E S P++ +G V+A   DI+  +R          YE     +   F V+  G+I + ++ LDRET   +   +EA D G    R +  V+V + D +DN P++S        + +  +  +G  V  L A  SD+  +S+  +E+  G E   F++++ +G +++         +  R+ VK++D  
Sbjct: 1559 TFEFNISETADRFTEVGKIVILGAGLEGSVFRIQDNDY------NFT-------ISPFDGTIFTNSPLDFENIKTYR------------FNITAGKSTSQVIIHVTDENDEAPRFITGDVV-NLKVLEELDTVSY-PLIIGSSIAEDLDEG-QNGLVTYSILSGNTS---LFAV------NSTTGDILSL---IPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKD--KDAELQYSL--ESNDEITIPFRINVATGWITVAGKVNR-EENEEFRFFVKVTDGEKSSKVIVEIHVEDFNDNHPMI------NDRNSDIFVPDPTRSVEIIHVINVHDLDKSDH----------LKFSLNNSNLNLSENGEITLKSPL--QTAVPVRVTV-SDDAGH-------VAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGDSIRYSIVSRC-----SDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDN----------KPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKL-IGHVIAR--DIDRSSRVF--------YEIVGGDANHEFMVTESGQIESVRD-LDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRI----FHVEVPEDVRIGEPVIQLSA--SDADEHSNHRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGA 2224          

HSP 2 Score: 79.337 bits (194), Expect = 1.547e-14
Identity = 65/203 (32.02%), Postives = 100/203 (49.26%), Query Frame = 3
Query: 1461 KPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPY 2057
            + LDRET   +   ++  DDG P +     + + VLD++D  P F + I  V + E V +   V +L+ASD D   N +  + +D       F +DENTG++  N   D EK   Y+++  + D   L++           T + V +KD+ND AP+F+K  Y F   E S+    +G   A D D E  N +I Y+ V  PY
Sbjct: 2102 RDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF-SRIFHVEVPEDVRIGEPVIQLSASDADEHSNHR--FELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIE-----------TSLFVNVKDVNDNAPIFEKPEYLFISEENSAE---IGQFHASDMDSEN-NGKIRYS-VTSPY 2285          

HSP 3 Score: 72.7886 bits (177), Expect = 1.587e-12
Identity = 80/317 (25.24%), Postives = 140/317 (44.16%), Query Frame = 3
Query:  417 GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSK---IGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDN 1358
            G L  K+ +D E    + ++C    +    ++ K  S   +  I I DIND+SP + Q     N+ E+S    IG      +A+D+D S     SR   + V       F +  +   +             ++DRE   +  L++ A D G P   G+T + + + D +DN+P F + +  + + E+  I + + Q+ A D D   N +     G      +   F ++   G +FV   LD++++  +Y + +++TD     ET L V V++ NDNAP+            + + EEN      I    A+DMD+
Sbjct: 1994 GILKTKSSLDAE----EYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGH----VIARDIDRS-----SRVFYEIVGGDANHEFMVTESGQIESV----------RDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSR-IFHVEVPEDVRIGEPVIQLSASDADEHSNHRFELDGGG-----EGIPFRVDENTGMVFVNDSLDFEKK-QSYRIKVKLTDGAWLIETSLFVNVKDVNDNAPIFE------KPEYLFISEEN---SAEIGQFHASDMDS 2271          

HSP 4 Score: 72.4034 bits (176), Expect = 2.420e-12
Identity = 84/299 (28.09%), Postives = 138/299 (46.15%), Query Frame = 3
Query:  870 PLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT-YLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVL 1754
            PL+  T  TI I DINDNSP F + L   ++ EN+   + +  + A+D+D S         G      D +  ++  ++G+I  + + D D+E  + Y L ++  D  K      T ++V V +E+DNAP  S + HV    +V + E  IQ       LSA+D D  S         G     RV  +  +V      +   LD E  + ++  +K  D  +  + T+  +N++  D ND  P F      ++I E    E  + + +ASD D   N ++ Y +   +F I+ +TGVL
Sbjct: 2024 PLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSG-PKLIGHVIARDIDRSSRVFYEIVGG------DANHEFMVTESGQI--ESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRIGEPVIQ-------LSASDADEHSNHRFELDGGGEGIPFRVDENTGMV-----FVNDSLDFEKKQSYRIKVKLTDGAWLIE-TSLFVNVK--DVNDNAPIFEKP-EYLFISEENSAE--IGQFHASDMDSENNGKIRYSVTSPYFKIEPSTGVL 2295          

HSP 5 Score: 67.781 bits (164), Expect = 5.037e-11
Identity = 55/171 (32.16%), Postives = 81/171 (47.37%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTL--KYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTF 1046
            I I + D+ND+SP++      + IPE + IG R  +  A D D   + +I +Y L         +  F IV +          L L V   +DRE  +   + L A D G P L+ S HL I I DINDN P F   +  +++  N   +  L  + A DLD ++N  LT+
Sbjct:  103 ILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSD-------GFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNF--GIRSLTLNWNGLPNTKLFSLNATDLDSNENSLLTY 264          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 115.161 bits (287), Expect = 2.233e-25
Identity = 170/724 (23.48%), Postives = 290/724 (40.06%), Query Frame = 3
Query:  456 ICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPL-----AKDLDSSPDNSISRYTLKYVNNSQLKLFSI-----VYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSK----FY--INGKNGKI-FVKQILDYDQEVNTYLLPIQVTDSTKFAETI-----LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSA-TDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT-------ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNA----------SDCDVGVNSQLVYRI-------DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTI-IRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVG---RLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDP 2474
            +  + +  CC      VY  K  ++Y  + I IED+N++ P +       +I +  +   +   P      A D DSS +  I  Y+L Y  +   K F I     V    P   +  +   R D  +             A D G  PL G    ++ + DINDNSP F +P  E S+     +   +  +FA D D + N ++T+S        +  +    F+  +N ++G+I  +K I     +   ++  + + D     E +     + + V ++   AP     P        + V+EN++    I    A +  D+ ++ +    ++ G   ++  +      K+        +++ + LD E    +  T+   D       +TK   ++V D ND  P F   + T  IDE +     + K N           +D D G  +++ YRI       +  HF IDE TG +  N  FDREK   Y L     DR   V + P     +   + ++++I D+ND AP F++  Y   + E       V ++ A D D  +    + Y ++       +   ++ F V  D      KE LD E  D +   + A D     H  + +V + IED+NDN PQ+         I    EE V     L  V          +S + Y +      E+F++ + SG++ L+K  L  DP
Sbjct:  829 VIVQDDGSCC------VYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIV-YSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTV------------KATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI---PMKTQKFIFNV-IADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPG---ITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD-MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSD-GPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRS--VSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHS---NLRYHLI------GAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVI----EEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVK-ALDRDP 1505          

HSP 2 Score: 98.5969 bits (244), Expect = 2.204e-20
Identity = 134/526 (25.48%), Postives = 218/526 (41.44%), Query Frame = 3
Query:  891 LTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLL------------PIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQA------TIKCQDDG----YPPQVTTKIIN--IQVLDKNDCTPHFPAAITTVYIDEGVPVES-------FVTKLNASDCDVGVNSQLVYRIDHAH------FSIDENTGVLRTNS--IFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFS--VSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKA 2342
            LTI I D+NDN P F +PL    ++E+  ++Q + ++ A D D  DN ++T+S        D   F IN  NG+I  K  LD DQ    + +            P+ ++ S      ++ ++ +N ND + V   LP   +S     V E+ Q  T +  + A D D      S    +G    S    +L  + ++T L+         +  +A      T+  QDDG    YP +  T      I + D N+  P FP      Y D    +E         + K+ A+D D   N  +VY + +        F ID  TGVL  +   +FDRE      +     DR         ++ L       V + DIND +P F++  YE S+    +    V +V A D+D  A N +I+Y++ I     + H + L F   V+      T  + +  +T     F++ A D+G P   + S  V + + D     P+W  S D    I +     + +++   +A
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV-------DNHNFSIN-SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSS-----AMIHIRTENTNDESAV--FLP---TSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNG---RSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAK--YSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDR--------GDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA-AHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKF-IFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRA 1120          

HSP 3 Score: 93.2041 bits (230), Expect = 9.626e-19
Identity = 150/629 (23.85%), Postives = 250/629 (39.75%), Query Frame = 3
Query:  546 ISIEDINDHSPVWTQSKIVINIPEH-------SKIGSRYYLPL-AKDLDS-SPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKY--TILLTKPLDRETNEF---FQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGV-PVES---FVTKLNASDCD--VGVNSQLVYRI-------DHAHFSIDENTGVLRTNSIFDREKTGE--YKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGR-----IFTTKESLDRE---TYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGR 2321
            + + D+ND  P +T       I E         K   +  + + A D DS  P N +    +   N  + K F I  + L  + + N+   R   ++    +E  +  + A    + P   +  + I I D+NDN+P F +      +KE+      +  + A DLD   N +          I     F +   +G IFVK+ LD++   + Y L +  +D    A T + + +++ NDNAP      +  +     ++EE++     + ++ ATD D             G     V      + KY  TI L K LDR+       +   ++  DD     V    + + V D ND +P FP  +   YI+E   P+ S   +   + A D D     N+ + Y I         + F ID+NTG +      DRE + E  + +E    DR       P+ +  ++ TI    + D+ND AP F+K  YE S+ E +     V S  A D+D EA +   +Y +              Y +   D +     +   K+ LD E     D     I   D     H     V V + D ND+ P    +++  +  ++ R  ++GR
Sbjct: 1199 VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI--DELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRI----PFGVRTDSGTIFVKEPLDFEAS-DQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATT-----VIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFR----IGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFG-YIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDR-----GVPSREGFANVTIK---VTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQL-------SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGR 1792          

HSP 4 Score: 89.3521 bits (220), Expect = 1.412e-17
Identity = 169/713 (23.70%), Postives = 286/713 (40.11%), Query Frame = 3
Query:  336 IQDFDLSRRENLNFQMMKENNF-----VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVIN-IPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKEN----NFIDQYLCQMFAKDLDISDNDKLTFSFGNSMN--IEDRSKFYINGKNGKIFVKQILDYDQEVNT---YLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSR------VLTDL-SVVTKYTILLTK-PLDRE---TNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA-----HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIP-----EGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGR----IFTTKESLDRET---YDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINI----TREETVGRL 2324
            I+  DL +  NL + ++          V   +G +FVK  +D E      +Q    +L +I  + +  +    + I IED+ND++P + Q K     I E   I    +   A D D   D   SR   +       ++F I   S        +L+  +D +          ++   +D G+  L G   + +N+ DINDNSP+F + L    I+EN    +    Y   + A+D D    +     +G   N  I   S F I+   GKIF  + L  D+E+++   +++ ++  D    ++     + +KV + NDNAP      +  S      VEE      A+ S SA D D  +            +LS       V TD  S  +   +L  K PLD E     + F   I+  D  +  +     +++ ++D+ND  PH   A T   + E VP  + + +  A+D D G  ++  +RI+        F+ID++ G LR     DRE    Y L    YD  N +             ++ V ++D+ND  P        +++P       ++P   +G+     +D +       + M + P    S    + F+ + DG       T  +  DRE      +    +   D     +  SV V+  I DLNDN     H   + + +N      +E  +GR+
Sbjct: 1357 IKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFE----ASDQ---YHLVLIASDGRHNATT-NVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQ--DEKSSRIVYRLEGQGADEVFRIGKYS-----GTIELVKALDRDPPAGVPSWNFVVQAIDDDGN-GLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSL--DREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGS------VEETAPIGAAVMSFSAFDADEEAKDNVFT-----YQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAA---VHVALVDRNDHAPHIHGA-TEHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSNNI----------GRQMVAVYLQDVNDNGP------EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVI--IGDLNDNT---MHDGRMTIHVNSYLGRLKETVIGRV 2011          

HSP 5 Score: 60.8474 bits (146), Expect = 7.569e-9
Identity = 144/604 (23.84%), Postives = 255/604 (42.22%), Query Frame = 3
Query:  915 NDNSPVFLKPLTEISIKENNFIDQYL----CQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVT--DSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLD----RETNEFFQATIKCQDDGYPPQV-TTKIINIQVLDKNDCTPHF-PAAITTVYIDEGVPVESFVTKLNASDCD--------VGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYK--LEATVYDRRNLVDSDPT-----EKVLSSTTIIRVIIKDINDCAPVF---KKLFYEFSIPEG---SSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESL--DRETYDMHSFSIEAWDSG--PITH--RVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI----IQGNEHE----LFKL-NQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVSKLP 2579
            ++  P F K   E+++ E+N +D  +     Q F    D      +T+S       ++   F I+   G I + ++LD+D      L  ++VT  +  + +   L +++ + NDN P  +  P   +      V E+I     I  ++A D D              +  S    + S+ +   I     LD     E +  ++  +  +D G P  + ++ +I+I+  + ND +  F P +  T ++ E     + V ++ A D D        +  N +   +++   FSIDE+TG+++           E +  +  TV     +V  D +      K  +S   + + I+D+N+  P F    K      I EG   + P   V  V A D D  A N  I Y++    Y T+S  S+  F +     + T    +  DRET      +++A D G  P+    + SV+VV    D+NDN PQ+   S      +++R E VG  V  + A D+D+  N+ + Y +      G EH+     F+L N++SG + L+K P+    +     V   D+G P  L ++  V +    +  K P
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFT-RPLYTAQ-----VREDIPLNQTILKVTAVDKDTGDNSR--------ITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMN--LFSIDEHTGLVKLRHGVSAADLAEAENPINLTV-----IVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV-KVEATDDDSSA-NGDIVYSL----YYTQSE-SRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVV----DINDNSPQFERPS---YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIK-PIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAP 1091          

HSP 6 Score: 60.4622 bits (145), Expect = 9.189e-9
Identity = 166/730 (22.74%), Postives = 309/730 (42.33%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSP-PLTGSTHLTINITDINDNSPVFLKPLTEIS--IKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQ---ILDYDQEVNTYLLPIQVTD---------STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENI--QDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKP----LDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF--PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRN------LVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSH--ISKLYFSVSPDGRI------------------FTTKESLDRETYDMHSFSIEAWDSGPITHRVSV--DVVVKIEDLNDNFPQ-----WSHSSDLGLSINITREETVGRLVTVLKAXXXXXXX-XXXXXYEII---QGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPL 2525
            + ++ ++ I I+D+ND+ P +T+      + E   +        A D D+  DNS   Y++   N      FSI  N            +R+DA+   E+       + A D G P  L+ S  + I   + ND S VFL P ++ +  + E+      + Q+ A+D   +D D++T+SF   N  + +  + F I+   G + ++      D  +  N   L + V D          T  +   LL+ +++ N+N P     P     +++  + E     D   I  + ATD D+S+      S       SR      V+ + T +LT       DRET      T+K  D G  P +     +++V+D ND +P F  P+  T+V   E V     V  + A D D   N+++ Y ++    + +E+   L    + +R ++GE  L   +  +        + D +   + L S+  + + + D    AP ++           +SP    G  +  D ++E +N+ I     +   ++++   I KL  S  P  +                       E LD E  + ++ ++ A D   +T RV+     VV++ D+ND  PQ     ++ + D  ++ N   E+T G+ +  +KA+D+DS    + ++Y I+    G E + F++++ +G ++  ++      ++  L V+ SD   S L
Sbjct:  622 RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTG-DNSRITYSVDNHN------FSINSNGEISAK------VRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFL-PTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPE---FPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESR---KAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTS--VITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNR-RSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQ-----------TSPDCKPG--ITVDENVE-LNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD---MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL 1308          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 115.161 bits (287), Expect = 2.233e-25
Identity = 170/724 (23.48%), Postives = 290/724 (40.06%), Query Frame = 3
Query:  456 ICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPL-----AKDLDSSPDNSISRYTLKYVNNSQLKLFSI-----VYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSK----FY--INGKNGKI-FVKQILDYDQEVNTYLLPIQVTDSTKFAETI-----LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSA-TDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT-------ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNA----------SDCDVGVNSQLVYRI-------DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTI-IRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVG---RLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDP 2474
            +  + +  CC      VY  K  ++Y  + I IED+N++ P +       +I +  +   +   P      A D DSS +  I  Y+L Y  +   K F I     V    P   +  +   R D  +             A D G  PL G    ++ + DINDNSP F +P  E S+     +   +  +FA D D + N ++T+S        +  +    F+  +N ++G+I  +K I     +   ++  + + D     E +     + + V ++   AP     P        + V+EN++    I    A +  D+ ++ +    ++ G   ++  +      K+        +++ + LD E    +  T+   D       +TK   ++V D ND  P F   + T  IDE +     + K N           +D D G  +++ YRI       +  HF IDE TG +  N  FDREK   Y L     DR   V + P     +   + ++++I D+ND AP F++  Y   + E       V ++ A D D  +    + Y ++       +   ++ F V  D      KE LD E  D +   + A D     H  + +V + IED+NDN PQ+         I    EE V     L  V          +S + Y +      E+F++ + SG++ L+K  L  DP
Sbjct:  829 VIVQDDGSCC------VYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIV-YSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTV------------KATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI---PMKTQKFIFNV-IADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPG---ITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD-MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSD-GPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRS--VSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHS---NLRYHLI------GAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVI----EEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVK-ALDRDP 1505          

HSP 2 Score: 98.5969 bits (244), Expect = 2.204e-20
Identity = 134/526 (25.48%), Postives = 218/526 (41.44%), Query Frame = 3
Query:  891 LTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLL------------PIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQA------TIKCQDDG----YPPQVTTKIIN--IQVLDKNDCTPHFPAAITTVYIDEGVPVES-------FVTKLNASDCDVGVNSQLVYRIDHAH------FSIDENTGVLRTNS--IFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFS--VSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKA 2342
            LTI I D+NDN P F +PL    ++E+  ++Q + ++ A D D  DN ++T+S        D   F IN  NG+I  K  LD DQ    + +            P+ ++ S      ++ ++ +N ND + V   LP   +S     V E+ Q  T +  + A D D      S    +G    S    +L  + ++T L+         +  +A      T+  QDDG    YP +  T      I + D N+  P FP      Y D    +E         + K+ A+D D   N  +VY + +        F ID  TGVL  +   +FDRE      +     DR         ++ L       V + DIND +P F++  YE S+    +    V +V A D+D  A N +I+Y++ I     + H + L F   V+      T  + +  +T     F++ A D+G P   + S  V + + D     P+W  S D    I +     + +++   +A
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV-------DNHNFSIN-SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSS-----AMIHIRTENTNDESAV--FLP---TSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNG---RSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAK--YSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDR--------GDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA-AHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKF-IFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRA 1120          

HSP 3 Score: 93.2041 bits (230), Expect = 9.626e-19
Identity = 150/629 (23.85%), Postives = 250/629 (39.75%), Query Frame = 3
Query:  546 ISIEDINDHSPVWTQSKIVINIPEH-------SKIGSRYYLPL-AKDLDS-SPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKY--TILLTKPLDRETNEF---FQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGV-PVES---FVTKLNASDCD--VGVNSQLVYRI-------DHAHFSIDENTGVLRTNSIFDREKTGE--YKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGR-----IFTTKESLDRE---TYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGR 2321
            + + D+ND  P +T       I E         K   +  + + A D DS  P N +    +   N  + K F I  + L  + + N+   R   ++    +E  +  + A    + P   +  + I I D+NDN+P F +      +KE+      +  + A DLD   N +          I     F +   +G IFVK+ LD++   + Y L +  +D    A T + + +++ NDNAP      +  +     ++EE++     + ++ ATD D             G     V      + KY  TI L K LDR+       +   ++  DD     V    + + V D ND +P FP  +   YI+E   P+ S   +   + A D D     N+ + Y I         + F ID+NTG +      DRE + E  + +E    DR       P+ +  ++ TI    + D+ND AP F+K  YE S+ E +     V S  A D+D EA +   +Y +              Y +   D +     +   K+ LD E     D     I   D     H     V V + D ND+ P    +++  +  ++ R  ++GR
Sbjct: 1199 VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI--DELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRI----PFGVRTDSGTIFVKEPLDFEAS-DQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATT-----VIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFR----IGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFG-YIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDR-----GVPSREGFANVTIK---VTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQL-------SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG---RHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGR 1792          

HSP 4 Score: 89.3521 bits (220), Expect = 1.412e-17
Identity = 169/713 (23.70%), Postives = 286/713 (40.11%), Query Frame = 3
Query:  336 IQDFDLSRRENLNFQMMKENNF-----VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVIN-IPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKEN----NFIDQYLCQMFAKDLDISDNDKLTFSFGNSMN--IEDRSKFYINGKNGKIFVKQILDYDQEVNT---YLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSR------VLTDL-SVVTKYTILLTK-PLDRE---TNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA-----HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIP-----EGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGR----IFTTKESLDRET---YDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINI----TREETVGRL 2324
            I+  DL +  NL + ++          V   +G +FVK  +D E      +Q    +L +I  + +  +    + I IED+ND++P + Q K     I E   I    +   A D D   D   SR   +       ++F I   S        +L+  +D +          ++   +D G+  L G   + +N+ DINDNSP+F + L    I+EN    +    Y   + A+D D    +     +G   N  I   S F I+   GKIF  + L  D+E+++   +++ ++  D    ++     + +KV + NDNAP      +  S      VEE      A+ S SA D D  +            +LS       V TD  S  +   +L  K PLD E     + F   I+  D  +  +     +++ ++D+ND  PH   A T   + E VP  + + +  A+D D G  ++  +RI+        F+ID++ G LR     DRE    Y L    YD  N +             ++ V ++D+ND  P        +++P       ++P   +G+     +D +       + M + P    S    + F+ + DG       T  +  DRE      +    +   D     +  SV V+  I DLNDN     H   + + +N      +E  +GR+
Sbjct: 1357 IKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFE----ASDQ---YHLVLIASDGRHNATT-NVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQ--DEKSSRIVYRLEGQGADEVFRIGKYS-----GTIELVKALDRDPPAGVPSWNFVVQAIDDDGN-GLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSL--DREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGS------VEETAPIGAAVMSFSAFDADEEAKDNVFT-----YQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAA---VHVALVDRNDHAPHIHGA-TEHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSNNI----------GRQMVAVYLQDVNDNGP------EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVI--IGDLNDNT---MHDGRMTIHVNSYLGRLKETVIGRV 2011          

HSP 5 Score: 60.8474 bits (146), Expect = 7.569e-9
Identity = 144/604 (23.84%), Postives = 255/604 (42.22%), Query Frame = 3
Query:  915 NDNSPVFLKPLTEISIKENNFIDQYL----CQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVT--DSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLD----RETNEFFQATIKCQDDGYPPQV-TTKIINIQVLDKNDCTPHF-PAAITTVYIDEGVPVESFVTKLNASDCD--------VGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYK--LEATVYDRRNLVDSDPT-----EKVLSSTTIIRVIIKDINDCAPVF---KKLFYEFSIPEG---SSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESL--DRETYDMHSFSIEAWDSG--PITH--RVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI----IQGNEHE----LFKL-NQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVSKLP 2579
            ++  P F K   E+++ E+N +D  +     Q F    D      +T+S       ++   F I+   G I + ++LD+D      L  ++VT  +  + +   L +++ + NDN P  +  P   +      V E+I     I  ++A D D              +  S    + S+ +   I     LD     E +  ++  +  +D G P  + ++ +I+I+  + ND +  F P +  T ++ E     + V ++ A D D        +  N +   +++   FSIDE+TG+++           E +  +  TV     +V  D +      K  +S   + + I+D+N+  P F    K      I EG   + P   V  V A D D  A N  I Y++    Y T+S  S+  F +     + T    +  DRET      +++A D G  P+    + SV+VV    D+NDN PQ+   S      +++R E VG  V  + A D+D+  N+ + Y +      G EH+     F+L N++SG + L+K P+    +     V   D+G P  L ++  V +    +  K P
Sbjct:  524 DERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFT-RPLYTAQ-----VREDIPLNQTILKVTAVDKDTGDNSR--------ITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMN--LFSIDEHTGLVKLRHGVSAADLAEAENPINLTV-----IVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV-KVEATDDDSSA-NGDIVYSL----YYTQSE-SRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVV----DINDNSPQFERPS---YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIK-PIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAP 1091          

HSP 6 Score: 60.4622 bits (145), Expect = 9.189e-9
Identity = 166/730 (22.74%), Postives = 309/730 (42.33%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSP-PLTGSTHLTINITDINDNSPVFLKPLTEIS--IKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQ---ILDYDQEVNTYLLPIQVTD---------STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENI--QDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKP----LDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF--PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRN------LVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSH--ISKLYFSVSPDGRI------------------FTTKESLDRETYDMHSFSIEAWDSGPITHRVSV--DVVVKIEDLNDNFPQ-----WSHSSDLGLSINITREETVGRLVTVLKAXXXXXXX-XXXXXYEII---QGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPL 2525
            + ++ ++ I I+D+ND+ P +T+      + E   +        A D D+  DNS   Y++   N      FSI  N            +R+DA+   E+       + A D G P  L+ S  + I   + ND S VFL P ++ +  + E+      + Q+ A+D   +D D++T+SF   N  + +  + F I+   G + ++      D  +  N   L + V D          T  +   LL+ +++ N+N P     P     +++  + E     D   I  + ATD D+S+      S       SR      V+ + T +LT       DRET      T+K  D G  P +     +++V+D ND +P F  P+  T+V   E V     V  + A D D   N+++ Y ++    + +E+   L    + +R ++GE  L   +  +        + D +   + L S+  + + + D    AP ++           +SP    G  +  D ++E +N+ I     +   ++++   I KL  S  P  +                       E LD E  + ++ ++ A D   +T RV+     VV++ D+ND  PQ     ++ + D  ++ N   E+T G+ +  +KA+D+DS    + ++Y I+    G E + F++++ +G ++  ++      ++  L V+ SD   S L
Sbjct:  622 RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTG-DNSRITYSVDNHN------FSINSNGEISAK------VRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFL-PTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPE---FPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESR---KAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTS--VITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNR-RSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQ-----------TSPDCKPG--ITVDENVE-LNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD---MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL 1308          
BLAST of Protocadherin vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 186.037 bits (471), Expect = 4.671e-47
Identity = 193/715 (26.99%), Postives = 317/715 (44.34%), Query Frame = 3
Query:  513 LKIQSNY-FEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVN-NSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS-TKFAE----------TILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVDVVVKIEDLNDNFPQWSHS------SDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSN---DPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKL 2576
            L  Q  Y  E++I + D+ND+SP + +  I I+  E +  G+R  L  A D D   +    +Y +   N +++ +L +   N   D +YL+   L    N+DRE     +L + A D GSPP  G   + + I D+NDN P+F      +S+ E       +  + A D D+ DN K+T+        E   +F +N + G I   + ++  Q+ N      Q +   T FA           T + V + + ND+ P+IS          V  V+EN  + T +A+++  D D+     +      G +L     +      + + +   LDRE    +  T+   D G P + TT  + I V D ND  P F  +  +  + E  P  SFV  + A+D D GVN+Q+ Y I   +    FS+D  TG++ T    DRE     +L  +        D  P  K   + T ++VII D ND AP F +     ++ E + P+  V  + A D D +  N  +++A+      +   +  L F++       TT+  LDRE    +  S+ A D G P     +  V + + D+NDN PQ+         +D    I + +E    R++  + A D D G N+ + Y +  G E  LF+L+ +SG++ L     ++    P   +L+V   D+G        IV I   S++  L
Sbjct:  132 LSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTA-NPSGDTSYLH---LETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA-----ETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFR-FFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLE-EAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISAR------DGGPNPKF--AYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHD-QGTNGSVTFALA----PSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEG-LFQLDARSGAISLRGDAPASMHWKPH-YKLLVSARDAGQRRSQQDAIVEIVLKSKLEML 820          

HSP 2 Score: 167.933 bits (424), Expect = 1.907e-41
Identity = 185/687 (26.93%), Postives = 304/687 (44.25%), Query Frame = 3
Query:  552 IEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEV-----------------------NTYLLPIQVTDST--KFAETI-LLVKVQNENDNAPVISILP-HVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYP-PQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVD--VVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSD 2507
            I D+NDH+PV+  +    ++PE +K+ +R++   A D+D   DN   R + + +  +  ++F +     PD        L V A +DRE+ +   L +   D+G P  +    + I++ D NDN+P F       SI EN   D ++ ++ A D DI  N +L+F+   S   +D   F I+ +NG  F+K +  +D+E                        N  LL   V+D+   +  + + + V V + NDNAP     P HV        + E   + T I  +   D D         S + G +  +   D +      + L + LDRE+ E     +  +D     P  +   I I VLD+ND  P F  + + V + E  P  + + +  ASD D GVNSQ+V+ I   +    F ID  TG L  +   D E    Y L        N+  SD     LS+T +  V++ D ND  P+F        I EG   +  + +V A+D D   +N ++SYA+  +  +        +F ++ +  +  T   +DRE+ D    ++ A D   P   ++S +  V V +ED+NDN P +   +   L    +  +     V  + A D+DS  N  + YEI+ G + ELFKL + +G +     P        +L +K +D
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLG-DN--GRISYEIIEGNTERMFGV----FPDG------YLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTL--SSQTQD---FTIDTRNG--FIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVT-------ISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSAT---GQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTL--------NITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPD-SGLNGKVSYAISKQEPQLP---QGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQ-ELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTD 1682          

HSP 3 Score: 159.073 bits (401), Expect = 1.166e-38
Identity = 158/589 (26.83%), Postives = 267/589 (45.33%), Query Frame = 3
Query:  879 GSTHLTINITDINDNSPVF-LKPLTE--ISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQE--VNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH--AHFSIDENTGVLRTNSIFDREK---------------------TGEYK-LEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG---PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            G   + I I D+NDN+PVF L   +E  IS+ EN  + Q +     +D D   N ++++S  N+ N     +F I    G +++++ +  +    ++  L+          ++  L V + + ND+ PV     +  S      + E  +  T   +L+ATD+D             G    R+     V     + +  PLDRE  +++  T+ C+D G P + +   + I V+D+ND  P F  +  T  I E  P ++FV KL A D D+G N++L + +      F+ID   G ++T   FDRE                       G Y  LEATV        SD     L     ++VI+ D+ND AP F +  Y  +I EG+S   ++  V  +D+D E +N  + Y++       K + +  +   S  G++ +    LDRE+ ++H   + A D+    P++   S+ +VV   D NDN P+++ SS     +++      G  +   +A D+D G+NS + + I  GN  + F ++  +GSLYL K     D     L +  SD G   L+ T +  +
Sbjct:  924 GQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPN----QQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETS------LPETTKVNTRFFALAATDIDLGDNGRISYEIIEG-NTERMF---GVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATV--------SDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDAD-EGLNGDVYYSLA------KGNEAGQFNLDSATGQL-SLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVL--DENDNAPEFTQSSS---EVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNV 1477          

HSP 4 Score: 154.836 bits (390), Expect = 2.301e-37
Identity = 159/605 (26.28%), Postives = 272/605 (44.96%), Query Frame = 3
Query:  342 DFDLSRRENLNFQMMKENN---FVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKT---YLNQLLLRVDANIDRXXXXXXXXXXXX----------XDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKF---AETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA--------HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFY-----EFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYE 2060
            D DL     +++++++ N    F    +G LFV+A +DRE          C +          +S+   + I + D ND++P +T S    +IPE++   +      A D D   +  +S +TL    +SQ + F+I   +   KT   +  + L++V  N +    +      +A           D+G P L     + + +TD+NDN+P FL+    ++I E      ++  +F +D D   N  + +S        +  +F ++   G++ + + LD + +   +L+ +    + K    +   + + V +ENDNAP  +      SS+ V ++E +    T +    A+D D         S S G +      D    + Y   L KPLD E    +   I   D G P   TT + N+ V+D ND  P FP+      I EG+P+++ +  + A D D G+N ++ Y I           HF I+  TGV+ T    DRE    ++L     DR     + P+E+ LS+  ++ VI++DIND APVF  +       +FS  +GSS    V  V A+D+D  + N  ++Y +V  P E
Sbjct: 1075 DIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDA-----GQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELS-FTL----SSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKG---NEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFT-----QSSSEVSVLETSPTG-TELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLY---LHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDR-----AQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSS--TAVMQVHAKDAD-SSSNGLVTYEIVSGPQE 1649          

HSP 5 Score: 130.568 bits (327), Expect = 5.011e-30
Identity = 187/773 (24.19%), Postives = 324/773 (41.91%), Query Frame = 3
Query:  417 GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLF------SIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSK--FYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK--FAETILL-VKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQD--DGYPP--------------------------------QVTTKIINIQVL--DKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH-----------FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG---PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEI-IRLVVKVSDSGPSPLTNTTIVRI 2549
            G L   A++DRE    +      + ++ I    + +++  ++++++ D ND  P +  +  V N+ E  +IG       A D D+     +   T   ++    K         ++ N   D+   ++  LR+  +   +                       + TI ++D NDN P+F   +    I EN      + Q+ A+D D+  N +L++       + D +   F +N + G + +   LDY +EV  Y+L +Q  D+ +   + TI +   V + NDNAP+   + + +       V EN+   T + ++SA D+D+ +  +   S + G     V ++  + +  TI   + LDRE    +  T+  +D  D +                                  Q  +  + + +L  D ND  P F +A  T  I E V + + V  + A D D G N  + Y +  A            FS++   G LR     DRE    Y L  T  DR      +P +    S  +IR++  D ND +PVF    Y  S+ E +S    V  V A D D E  N +I Y++V+     ++H     FS+S D  +    ++L+ E    +S ++ A D     P     + ++ + I D+NDN P +  S  L   +  T     G ++TV         LNS + Y + +G+  +LF++N  SG + L+K PL  + +    L +   D+G  PLT T IVR+
Sbjct: 1772 GILSTAAELDREAGPEEYE----VEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT-----LGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYT-------------------EAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGV-----VSDWANDVFSLNPQTGMLTLTARLDY-EEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSE------VFENVPIATEVVTVSAKDIDSGNNGLIEYSITAG----DVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDR-----GEPPQST-ESQLLIRIL--DENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVD-EGANGRIRYSIVLG---DQNHD----FSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGD--TAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDS-DLFRINASSGDIALLK-PLDREQQSEYTLTLVAMDTGSPPLTGTGIVRV 2479          

HSP 6 Score: 128.257 bits (321), Expect = 3.091e-29
Identity = 185/707 (26.17%), Postives = 306/707 (43.28%), Query Frame = 3
Query:  303 LLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLV---NGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQ--------SNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLN--QLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEIS-IKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD-STKFA------ETILLVKV-------------------QNENDNAPVISILPHVNS------SNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTD---LSV-VTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI---DHAH-FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSP--RMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFP 2255
            L IG  +   R  D D     ++ F +M  ++   L+    GKL +   +DRE   TK             Y L+I+          Y  IQ+S  D ND+ P++  +    +IPE+++ G +    +A+D D                N+QL  + +V +   D   LN    +L + A +D E+++   L++ A+D+G P L+ +  +  N+ D+NDN+P+F  P++  S + EN  I   +  + AKD+D  +N  + +S   + +++  S+F I+  NG I  ++ LD +   +TY L +   D + +FA      ET L +K                    Q  +    V  ++  VN       S N   + EN+   T + ++ A D D                     +D    S+  T   + +   LDRE    +   I  +D G PPQ T   + I++LD+ND +P F     +  + E   + + V +++A+D D G N ++ Y I   D  H FSI E+TGV+R     + E+   Y L     D          E     T  + + I DIND  P F    Y   + E + P    YV +V A D+D   +N Q+ Y +       K   S L+   +  G I   K  LDRE    ++ ++ A D+G      +  V V+++D+NDN P
Sbjct: 1836 LQIGHTISTLRAHDPDT--LGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRE---TKSK-----------YELRIRVSDGVQYTEAYATIQVS--DTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLG-------------QNAQLS-YGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIF-DPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSI-TAGDVD--SEFGID-SNGTIRTRRNLDREHR-STYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDC-------ALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFL-------KEGDSDLFRINASSGDIALLK-PLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDP 2489          

HSP 7 Score: 124.405 bits (311), Expect = 4.047e-28
Identity = 154/612 (25.16%), Postives = 263/612 (42.97%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWT---QSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLF---SIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETI---LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT-KPLDRE-----------TNE-------------FFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFP 2255
            + I+I D+ND++PV+    +S+  I++PE++ +G   YL   +D D+  ++ IS Y+L    N Q ++     ++Y   P +     L+                + L+A D+GSPPL+    L++ I D+ND++PVF     E S+ E   ++     + A D+D+ DN ++++    GN+       + +    +G +FV+  LD  +E + Y L +   D+ + + +    +++ V +ENDNA      P   +S     + EN   +T +  L+A D D                LS    D ++ T+   + T +P DRE           + E               +AT+   D+G P       + + V D ND  P F  A   V I EG    + +T +   D D G+N  + Y +    +   F++D  TG L      DRE    + L     D          +  LSS   I +++ D ND AP F +   E S+ E S     +    A D+D + +N Q+ +++         HI  +       G ++  K  LD E    ++ +I A D G  +   +V   V + D NDN P
Sbjct:  928 VNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRIS-YSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLI---------------HVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNT------ERMFGVFPDGYLFVRAPLDR-EERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNA------PQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELS------FTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVS--DNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDA-------ALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDAD-QGVNSQVVFSISAGNRRDTFHIDSIT------GSLYLHK-PLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPP 1487          

HSP 8 Score: 123.635 bits (309), Expect = 6.443e-28
Identity = 179/656 (27.29%), Postives = 289/656 (44.05%), Query Frame = 3
Query:  537 EIQISIEDINDHSPVWTQSKIVINIPEHS-KIGSRYYLPL-AKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFS-FGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST----KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXG--------GLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFP-AAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA----HFSIDENTGVLRTNS-IFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSL 2441
            E+ I+I DIND+ P +  S  +  + E++      Y L + A D D+ P NS  RY LK  ++    LF I  +S  D   L  L        DRE+  +  L L+A D+GSPPLTG+  + + + DINDN PVF       +++EN     ++    A D D   N KL F+  G  M+     +F+I+ + G+I     LD  +E + Y L +   DS+    + +   L + V + NDN      +P  +S+   + V E I     +    A D+D+    +   + SG          K   V T L + TK     TK  D  T   +   I   D G    +++K     +L   +  P F   A +   + E V     +TK++A+    G+  ++ Y I          +D N+G+L       D E T  Y++         +  +D     L S T+I + + D ND APV ++L Y   + E  SP   +  V A D D    N  + Y +      T        F ++  G I+ T+  LDRE    ++F +EA D G      +  V++ + D NDN P+++       S+N+T    +G  V  + + D D G N++ +Y   + N  E F++  +SG++
Sbjct: 2369 ELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDS---DLFRINASS-GDIALLKPL--------DREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMH-----RFHIDSETGEISTATTLDR-EETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDN------IPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTK-----TKSHDDLT---YTIVISAMDQG-EQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIW--------IEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRD-SGDNGNVIYRLQNDFDGT--------FEITESGEIY-TRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRL----FSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSE-NPGEKFRIEPQSGNI 2968          

HSP 9 Score: 118.627 bits (296), Expect = 2.486e-26
Identity = 175/779 (22.46%), Postives = 317/779 (40.69%), Query Frame = 3
Query:  333 RIQDFDLSRRENLNFQMMKENNF---VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKI---QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFL-KPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFS-----FGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT----ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH---AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSP-DGRIFTTK------ESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEI-IRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLP 2579
            R  D D      L F ++ E+     +    G++     +DRE       +    +L ++  +  I   +++   + IS+ D+ND+ P +  +   + +PE    G   +   A DLD   +N++  YT+   +          Y  +  KT +    L +             +++ A D G   L+    LT+ I    +  P F     +  ++ E+    + + ++ A         K+ ++      G+S+ ++  S     G++G       LDY+   + Y + I+  D    +  + T++ + V + NDNAPV+  L +     N  ++EE    +  IA + A+D D+            G  + R+  D     + T    I     LDRE    +   ++  D G P    T  + + +LDKND  P F   + ++ + E   + SFV ++ +SD D+G N+   Y         F I+  +G +      DRE+  EY L+    D               + T I + I+D ND AP F+  FY FS PE       VG ++A D D +  N  ISY++               FS+ P  G +F+ K          R   +M++ ++ A D+G         V + I D ++N P++  +  L     + ++   G+ +  + A D      + ++Y ++  N   +F + +  G + L+K P+   P     LVV+ +D G  P ++ T V I    E    P
Sbjct: 2514 RATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDRE-------ETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDG-ENAVVHYTISGRDQH--------YFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDG-------LDYEL-THLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIY-----NAEVLEEESPPQL-IAVVKASDRDSGDN---------GNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-TRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASD-----------GAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSL---------QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLA---PLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVK-PIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTP 3227          

HSP 10 Score: 117.087 bits (292), Expect = 7.213e-26
Identity = 193/806 (23.95%), Postives = 338/806 (41.94%), Query Frame = 3
Query:  234 DFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMK---ENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVF-----LKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFA---------------ETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT-ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVS--VDVVVKIEDLND--NFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXX-XYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            D P K  +  SL   V E++EIG  +  +  +    D DL    N ++   +   E   +   +G + V   +DRE    ++++     +  +V +         I I+I+D ND++P +  S    + PE  +  +     +A D D    NS+  Y+L+  +     +FSI  +    + +  + +    +   R       L +LA D+G PPL     + INI D ++N P F     L PL + +++      Q + ++ A D      +++ +S    M     S F +   +G I             T + PIQV  +T++                ET +++ V  EN + P  S    VNS    ++V EN    + I ++ ATD D     +   S SGG +      D SV  +   I++ + LD +  + +   I  QD GY P  +  ++ I + D ND  P F       YI E  PV +FV + +A+D D   N+ + Y       D   F ++++ G + +   FD E+   Y L+         + +   +  + S   + V +  +N+  P F +  + F + E S+    VG+V A D D     R   Y +++     K       F +  +  +      LDRET +    ++ A + G I    +    V++ I+D ND   F +  ++S       I+    VG  VT +KA+D D    ++  +Y II GN  + FK++ ++G +    +    +     LV+   D+G  P T +  V I
Sbjct: 2908 DNPPKFTRLFSLN--VTENAEIGSFVIRVTSS----DLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDRE----QQDEY----ILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS----PMFSI--DPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVR-----GQRIVRVHANDKQDLGTNEMDYSL---MTFNLSSIFSVGRHDGWI-------------TLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFS----VNSYQ--VIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQ----DFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQ---------IKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGR--VYYLLVGSSNDKG------FRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTS------TISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHI 3639          

HSP 11 Score: 113.62 bits (283), Expect = 8.800e-25
Identity = 196/765 (25.62%), Postives = 317/765 (41.44%), Query Frame = 3
Query:  339 QDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSG-SPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFI--DQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGY-PPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI---DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLF-YEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPD-GRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRFF 2597
            +D D+ + + L F +       +  +G+L V   +DRE           LN+         QS   ++ I I D ND+SPV+   +   ++ E++ IG+      A D+D   +  I RY++  V   Q   FSI  ++          ++RV  N++ E++ +  L + AED     P   +  LTINI DINDN P FL       + EN       Y+  + A D D    +     F   +   D   F IN  +G I + + LD +Q+ + Y L +   D+         I+ V+VQ+ NDN PV  +  +  +      V EN+   T + +  ATD D         +   G  + R   D        I     LDRE    +  T+  QD     P+ ++  + I V D ND  P F +    V + E +    FV    A D D G N+ + Y I   D  +F I+  TGV+ T      +      L  T+     +   D  E+ LSS   + VI++   +  P F  +    F++ E   P   +  V A  S  + +  +I YA+          I      V P+ G +   ++ LD E   ++   IEA D    + R    + + + D NDN P       L  +  +  EE+  +L+ V+KA D DSG N ++ Y  +Q +    F++ + SG +Y   +    +      VV+  D G   +T T  V ++   +    P  +R F
Sbjct: 2209 RDEDMGQSDPLPFSL-------NPTDGQLRVVDALDREL-----RSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRI-RYSI--VLGDQNHDFSISEDTG---------VVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYF---LKEGDSDLFRINASSGDIALLKPLDREQQ-SEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHAT------VRENLPSGTHVLTPRATDKDEGLNAKLRFNLL-GEHMHRFHIDSET---GEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIV----ISAMDQGEQSLSSKAELTVILRP-PELFPTFAYMANSHFAMSEDVRPGKMITKVSAT-SPKKGLVGKIRYAIA-------GGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQ---LIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYR-LQNDFDGTFEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLF 2917          

HSP 12 Score: 107.457 bits (267), Expect = 6.112e-23
Identity = 158/609 (25.94%), Postives = 247/609 (40.56%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQ-----LKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVT--DSTKFAETILLVKVQNENDNAP-VISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTK----IINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGV-NSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSI 2291
            QS+   + I +   N  +P ++ +   + +PE+  +GS      A D D+ P N + RY++   N  Q      +   IV     D   + +  L +                  +D G  PL+    LTI +TD+NDN PVF        I EN  +  ++ Q  A D D   N  + ++F  S    DR  F +N  NG I      DY +E   Y L I+    DS+  +   L V V   N+  P  +  + H +       V E     T + ++ ATD D+           G    K  R+ T+  +     I + + LDRET      T+  ++ G      T     II+IQ  D ND  P F     T  I E  PV + VT + A D DV   N+Q  Y I + +    F ID  TG + T S  DRE+T  Y L          +D+    +  S+T  + + ++D+ND  P F        I E       + +++A D D+       +Y ++   +       K + SV  +  +  +  S DRE   +    IE  DSG    +    + + + D NDN P  + S  + +S+
Sbjct: 3209 QSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGP-NGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNI----------------TVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSG--PDRHFFIMNQSNGTISSAVSFDY-EERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFD-------VSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGL-----IYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQ--DGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVI------GAIDTGLPPQTGSAT--VHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKH-------KSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN-PSTTRSLHIAVSL 3766          

HSP 13 Score: 92.8189 bits (229), Expect = 1.891e-18
Identity = 96/389 (24.68%), Postives = 171/389 (43.96%), Query Frame = 3
Query: 1458 TKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA--HFSIDENTGVLRTNSIFDREKTGEYKLEA-------TVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYE-----FSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSND-PEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLP 2579
            T  LDRE+   +Q  I  +D G PP+     +N+ +LD ND  P F  +   V ++E     + V  + ASD D+G NS++ Y +      F+++  TGV+ T    +  +    K  A       TV+ R      D         T + V + D ND  P+    F+       ++ E +     V +V  +DSD   +N + S  +V     + + +       + D  I      LDRE    ++ ++ A D G      +  +++ + D+ND+ P +  S     S  ++     G  V  + A D D+G+N+ ++Y+I+ GNE + F ++  +G L +   PL  +  + + L +   D GP+P    T +++    E  + P
Sbjct:  225 TGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFAR------DHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSD-SGLNGRTSVRIV-----SGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSE---YSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTG-LIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAP 597          

HSP 14 Score: 87.0409 bits (214), Expect = 9.555e-17
Identity = 122/495 (24.65%), Postives = 210/495 (42.42%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTY--LNQ----LLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFA-----ETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD--NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNS-----QLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSD-PTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSP 1967
            + I + D+ND+ PV+   +    IPE+  +G+  +   A D DS P N+I  Y                  S PD+ +  +NQ    +   V  + +  +I  +++     DS    +    +L +++  +N+  P FL+P+    + E + +   +  + A D D  ++ ++ +    S N  D+  F I+   G I+V + LD + + N  +L +   +          E  +++ +Q+ ND    I    H  +S     + E     T + ++ A D D    +   S +  +G LK S  +     V    I     LDRE    +   I   D G PPQ  +  ++I++ D ND  P F       YI E  P  + +  L ASD D+  N      QL+     +  S+D N+GV+R+ + FDRE T    LEA +     + DS  P +K   S  ++ + + D ND     + L    S+  G  P
Sbjct: 3320 LTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDS-PKNAIIHYAF--------------LPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSS---MESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSN--DKG-FRIDTNTGLIYVARHLDRETQ-NRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIK---HYYTST----ISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKID----VQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTP--ILEAII----EVEDSGKPKQK---SQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLP 3772          

HSP 15 Score: 80.4925 bits (197), Expect = 9.462e-15
Identity = 169/740 (22.84%), Postives = 311/740 (42.03%), Query Frame = 3
Query:  429 VKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD----STKFAETILLVKVQNENDNAPVISILPHVNS---SNNVLLVEENIQDETAIASLSATDMDNXXXXXXX-XXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNAS-DCDVGV----------NSQLVYRI---DHAH-FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVF---KKLFYEFSIPEGSS--PRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDP-EIIRLVVKVSDSG-PSPLTNTTIVRIYFH 2558
            V   +DRE I  K N    L +  +      ++    + I + D+NDH PV+ +S+    + E +  GS      A D D+   N+   Y +  ++ ++LK FS+          L  L++     +DRE  + +EL + A D G  P    T L + I D ND +P F +    +++ E+      +  M A D D   N  +TF+   S+      +F ++   G++  ++ LD  ++++ Y + +   D    + + A   + + V + NDN P      ++ S    ++ + +++ ++ E  +  ++A+D D+    +      SGG  L ++      ++   +    P        ++  +  +D G        I+ I +  K +      A        E   VE    + N+  + +VG+          NS + Y I   D A  F ID  +G + T    DRE+   Y+L  T+    +   S     V     I+ + I D+ND APVF   ++     S+PE ++    +Y+  V   D+    +N +ISY++   P +         F + P   +   +  +  E   +    + A D+G       + + V I D+ND+ P + H+S      ++     V      L A D D G N  ++YEII+GN   +F +    G L++ + PL  +  +   L V   D+G PS    +++V +  H
Sbjct:  448 VNGVLDREEIG-KYN----LTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGV-NAQVHYDI--LSGNELKWFSM--------DPLTGLIVTT-GPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDR-EKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAIS---LRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGY---EFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRL--TILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDA---GVNSRISYSLTNNPNQQ--------FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTS---YETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVF-PDGYLFV-RAPLDREERDYYALTVSCRDAGQPS---RSSVVPVVIH 1142          

HSP 16 Score: 77.411 bits (189), Expect = 9.692e-14
Identity = 133/550 (24.18%), Postives = 225/550 (40.91%), Query Frame = 3
Query: 1074 DRSK-FYINGKNGKIFVKQILDYDQEVNTYLLPI---------QVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTD-------LSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENT---------GVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAM-----------------VIKPYETKS--HISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAW--DSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVSKLP 2579
            DR++ F I+ ++G+I   + LD +++ N Y L I             S  + + I+ + + + NDNAPV ++      S   + + EN      I      D D               ++S  LT+       +  VT   + L +P+  E        +   D G PP  +   +++ + D ND TP F        + E   V +    L A+D D+G N ++ Y I      I+ NT         G L   +  DRE+   Y L  TV  R      D  +   SS   + + + D ND AP F    + FSIPE +    +VG + A D DI   N ++S+ +                  ++P++ ++   +S+   +   DG +        R +   +   +EA   D+G    +  V V V + D+NDN P++  +      + I+   + G  +T +   D+D GLN  + Y + +GNE   F L+  +G L L ++      EI  L+V   D+    PL++   + I    E    P
Sbjct:  874 DRAQNFRIDTRSGRITTARPLDREEQAN-YRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFAL---DRESEPTISLPENAAVGQEIYLSRVRDRDAGVNS----------RISYSLTNNPNQQFRIGPVTG-VLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEI------IEGNTERMFGVFPDGYLFVRAPLDREERDYYAL--TVSCR------DAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDI-GRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSL--------RGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAP---YHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAP 1382          

HSP 17 Score: 52.373 bits (124), Expect = 3.037e-6
Identity = 54/196 (27.55%), Postives = 89/196 (45.41%), Query Frame = 3
Query: 1725 FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRI----FTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINIT 2300
            F++D  TG ++TN + DRE   ++      YD   ++ S PT  +      +R+ + D+ND +P F +     S  E ++    +    A D+D+        Y +V    + K    +L  + +P G        T  +LDRE+   +  +I A D G       + V V I D+NDN P + H SD  +S+N T
Sbjct:  103 FTLDPVTGEVKTNVVLDREGMRDH------YDLV-VLSSQPTYPIE-----VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNK---FRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDH-SDYNVSLNET 282          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 174.096 bits (440), Expect = 2.460e-43
Identity = 183/686 (26.68%), Postives = 314/686 (45.77%), Query Frame = 3
Query:  528 NYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTF--------SFGNSMNIEDRSK-FYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD---NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFP-AAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-------DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAM-------VIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIE--DLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEII----QGNEHE-----LFKLNQKSGSLYLMKQPL 2462
             + ++ I +ED+ND++P +  S + I++PE +++G+  Y   A D DS    S  + T   V  S   LF+I   S         L+L    ++D E  ++  L++ A D G P L+ +  + +++ D+NDN PVF K    +++ E+  I+  + Q+ A DLD  +N ++T+        +  NS++  D S+ F I   +G I+++  LD +   + Y L +  TD+      A+T ++V+V + NDN       P    S     +EEN++  + +  ++A+D+D   N++   S    +   ++  V  ++S          +PLDRE  E +   ++ +D G P +     + I V D ND  P         V + E  P  + V ++ A D D G N+ + Y I        H  FSID  +GV+RT  + D E+   Y+L     D  N     P E V     ++RV + D+ND  P F      F + E ++    VGS+   +   + +   +  +         + P  TK  I   +      G +   +  LDRE        I A D+    +  S  + VKIE  D+NDN P+W       + + ++    VG ++    A D+D+G N  L Y +I    Q NE +     LF+++  +G+L L + PL
Sbjct:  913 GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDS---GSSGQVTYSLVKESGKGLFAIDARS-------GHLIL--SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDND------PKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEIST--------REPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGN----PPRETV----RMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPL-TKDLIEAAFDIDRHSGNLVVAR-LLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDP---IDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL-QAPL 1557          

HSP 2 Score: 169.859 bits (429), Expect = 4.592e-42
Identity = 183/694 (26.37%), Postives = 320/694 (46.11%), Query Frame = 3
Query:  417 GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVN-NSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLV--KVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLT--DLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-----DHAH-FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSV-SPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW---SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMK 2453
            G++  K  +DRE   T+ +             + +      + ++++D ND++P + Q+ + I  PE++    +  L  A+DLD  P N+  RY +   N N   +L S  +       YL+   L++   +DRE      LL+ A D G+PPL G   + I I D+NDN P+F +     ++ EN  +   + Q++A D D  +N  + ++  N    +    F I+ + G I++ + LD++ +    L+ +      +  ET   V  +V + NDN P I+++    S +    + E+ Q    +A +S  D D+ +   +   +  G      LT  D S+   Y +++  PLDRE    +  ++   D G PP   +K I +++ D ND  P F   +    + E     + V ++ A D D G+NS L Y +      HA  F ID  TG++ T S  D E     +L         +V  D     LSST  + V I D+ND  P+F + FY  S+ E       +  V A D D   +N  ++Y +     E   H+++  F V S  G I    E LD E    + F + A D G ++   +  + +++ D+NDN P +    +   L  S   + + +   +V V+ A D D G    ++Y I+ GNE  +F++++ +G +++++
Sbjct:  130 GEIRTKVKLDRE---TRASYSLVA--------IPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNT-QRYNIVSGNVNDAFRLSS--HRERDGVLYLD---LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI-NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVI--FLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI---YLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQL--------TVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDC-GVNAMVNYTI----GEGFKHLTE--FEVRSASGEICIAGE-LDFERRSSYEFPVLATDRGGLS--TTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVR 781          

HSP 3 Score: 141.739 bits (356), Expect = 2.026e-33
Identity = 136/504 (26.98%), Postives = 224/504 (44.44%), Query Frame = 3
Query:  861 GSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD--NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTIL-------LTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI--DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYE-FSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLV 2327
            G PP+ G T + I + D+NDN+P F   +  IS+ E+  +   L    A D D   + ++T+S    +    +  F I+ ++G + + Q LDY+     + L +  TD    +      +LV VQ+ NDN PV             + V E+      I  ++A+D+D  N++ I      +G   ++  ++   V   + I        L  PLDRET + +Q T+   D+G P       + ++VLD ND  P F  +     I+E +   S V  + ASD D+G N+ + Y +   ++ F +   TG + T    DRE    Y L   V + R     D    V S+   +R+ + D+ND AP       +  S+ E   P   V  V A D D    N  I+Y+ ++K  ++  H     FS+ P   +  T+  LD E   ++   + A D G         + V++ DLNDN P ++ SS   L   +  +  +G +V
Sbjct:  907 GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL---VKESGKGLFAIDARSGHLILSQHLDYESS-QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF------EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDL---VVEAR-----DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRD-HGQNASITYS-IVKGRDSDGH---GLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSS---LVFRVREDAALGHVV 1384          

HSP 4 Score: 125.176 bits (313), Expect = 2.597e-28
Identity = 178/724 (24.59%), Postives = 307/724 (42.40%), Query Frame = 3
Query:  528 NYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSP----VFLKPLTEISIKENNFIDQYLCQMFAKDLDISD---NDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQI-LDYDQE-VNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISI-LPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT--KPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA-----HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMY-------VGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTK-ESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSS-DLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRFFEKDLV 2612
             +  + I+I+D+ND+ P++ QS+    +PE++ +G+      A D D+  +N +  Y +    + + ++F I  +      Y+N+ L       D E  E  EL+++A+D G  PL  +  ++I +TD+NDN P    +FL       I E+    +++ ++   D D      N  +T + G+         F +  ++  I++  + L  D+E V+ Y L +  TD       A   + +++ + NDN P     L H N       V E     T++  + A D D         S +   +          +   T L+T    +D ET    Q T+  +D G PP  +T  + + + D ND  P F  +   V + E  PV   + K++ASD D GVN+ + Y I         F +   +G +      D E+   Y+      DR            LS+T +I++ + D+ND  PVF    Y+ S+ E  SP+         + +V+A D D      Q+SY +V      ++ I ++  S    G IF  + + L   T  MH  +I A D G +       V + I D     P +  +  +  +  +I R   VG ++    A   D    S + Y I  G+    F +   SG++ + K PL ++ +   L+   +  G  P+   T V I    EV  +   +  FE  +V
Sbjct:  268 GFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDAD-ENGLVEYAINRRQSDKEQMFRI--DPRTGAIYINKAL-------DFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDG-------HFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN-------VMEVADPGTSVLQVLAHDRDEGLNSALTYSLA---ETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG----------LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRE--SPKASSQASSTPIVAVVATDPDYGNFG-QVSYRIVAG---NEAGIFRIDRST---GEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVI----AASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAK-PLDHEAKSQVLLNIQATLGEPPVYGHTQVNI----EVEDVNDNAPEFEASMV 936          

HSP 5 Score: 122.479 bits (306), Expect = 1.411e-27
Identity = 167/705 (23.69%), Postives = 288/705 (40.85%), Query Frame = 3
Query:  267 LQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMK--------ENNFVSL-----VNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFE-------IQISIEDINDHSPVWTQ------SKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVN-------NSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSP-PLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK--------------------------FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKI-INIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA---HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG 2189
            +  QV E + +G +I     N+   D D     +L +++++        +   +SL     + G L ++A +D E               +IV  L   SN  E       +++ I D NDH+P +            + I + ++IG      +A D DS  DN    Y +   N       NSQ  +  +V  SLP  T   +   R +  I             A+D G P P   S +L + +   ++N P FL+ +   +I EN     ++ Q+ AK L  ++N  L++     +       F+++ + G I  +   D + +  +Y+LP+ V D+ +                          F    + + V + NDN+P     P    S   L V EN  +   I ++ A+D+D         S +GG     +    S+ +    L  +PLDRE +  +   I+  D G P        I I V D+ND  P F  +  T  + E  P+ + V +++A D D+GVN++LVY + +     F+ID  +G++ T    DRE    Y       D           +V S+T  +++ + DIND  P+F++  Y   +P    P   +  V A D+D+ A N +I Y++       ++      F ++P     +  +SL  E+  +    + A D G
Sbjct: 1490 IDLQVSEATPVGTII----HNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFE---------AVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG-DNGQLTYEITGGNGEGRFRINSQTGIIELV-KSLPPATEDVEKGGRFNLIIG------------AKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVA---NDLFHVDWQRGIITTRGQFDRESQA-SYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP--EFRP---GSCYGLSVPEN-SEPGVIHTVVASDLDEGPNADLIYSITGG----NLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRY-------EVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGA-NAEIVYSL-----NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG 2140          

HSP 6 Score: 118.242 bits (295), Expect = 3.370e-26
Identity = 149/626 (23.80%), Postives = 271/626 (43.29%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGS--RYYLPLAKDLD---SSPDNSISRYTLKYVNNSQLK-LFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSP--PLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF------GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS----TKFAETILLVKVQ--NENDNAPVISILPHVNSSNNV-LLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSR--VLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYP-PQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA----HFSIDENTGVLRTNSIFDREKTGEYKLEATVYD--RRNLVDSDPTEKVLSSTTI-------------IRVIIKDINDCAPVFK-KLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVDVVVKIEDLNDNFPQWSHSSDLG 2282
            +++ + D+ND+ P +T S +V  + E + +G       P+ +  D   +S + S     + Y  N   K L    ++   D+   N ++ R+   +DRE   +  L + A D+ +   P + +  + I + D+NDN+P + +   ++ + E   +   +    A D D   N  L +         N    +  S F ++   G + ++  LD+ + V  YLL +Q  D     T+  +T + V+++  + ND+AP   + P+ +      L + +  +    +A + A D D+          +GG    R  + +   ++     L     D E    F   I  +D G P P+ ++  +++ V   ++  P F  A+    I E VP  SFV ++ A       N+ L Y I        F +D   G++ T   FDRE    Y L   V D  R++ + S    K  SS +I             I + + D+ND +P F+    Y  S+PE S P + + +V+A D D E  N  + Y++      T  ++   +   S  G +  +   LDRE +  ++  I+A D G P + +   ++ + +ED NDN P++  S   G
Sbjct: 1351 LRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDI--DRHSGNLVVARL---LDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDF-EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF-VSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLD-EGPNADLIYSI------TGGNLGNKFSIDSSSGEL--SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG 1959          

HSP 7 Score: 108.612 bits (270), Expect = 2.446e-23
Identity = 119/508 (23.43%), Postives = 227/508 (44.69%), Query Frame = 3
Query:  525 SNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFG--NSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPV---------ISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVF-KKLFYEFSIPEGSSPRMYVGSVLAEDSDIE 2012
            ++Y E+ I +ED ND+SP ++Q + V  + E +  G+      A D D+   N+  RY +   N+    +    ++ +          +R +  +DRE  +  +L ++A D G P +TG+  + + I D+NDN P F  P   +++ E   +   +  + A D+D      LT+  G  ++++IE+ S F ++  +GK+ +K+ LDY+ +   Y L +  +D+   A T+L V+V +ENDNAPV          +ILP ++       + E++  +  + +++ATD D+              +    +   + V    +   +P    + ++F   I  +D G P   ++ ++ +Q  D       F        I E  P+ S V +L     D  +   ++   + + F + ++  ++    + DRE+   YKL   +                  + II ++  D ND  P+F +   YE  I E +  R  +  + A D+D E
Sbjct: 2303 ASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAG-SNARLRYHIVDGNHDNAFVIEPAFSGI----------VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDTY--PALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISE------ISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYF-VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSL--AIIAGNEESAFELLQSKAIVLVKPL-DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITIL--DANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQE 2783          

HSP 8 Score: 99.7525 bits (247), Expect = 1.187e-20
Identity = 151/595 (25.38%), Postives = 251/595 (42.18%), Query Frame = 3
Query:  807 IDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK--FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT-ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESF-----VTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTG---VLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIV 2543
            +DRE +    L ++A D G+PPL  S  + + ITD+NDN P F + L   ++ E       + Q+ A D D   N  LT+S   +     +  F I+ + G I  +  +D + E    L  +          +   +LV + + NDN P+       + S   + V EN      I  +SA+D D     +   +   G K    LT+  V +    I +   LD E    ++  +   D G     TT +I +Q+ D ND  P F      V + E     S      +  + A+D D G   Q+ YRI    +   F ID +TG   V+R + +  R +   + L  +  D  NL  +        +  ++ + I D     P+F+K  Y + + E       VGSV+A   D+ A    + Y++        S     YFS+  +       + LD E       +I+A    P  +     V +++ED+NDN P++  S    + I++     +G  +    A D DSG +  + Y +++ +   LF ++ +SG L L +       +   L+V  +D G PS  TN TI+
Sbjct:  462 LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQ-WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF------DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKH---LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQP-MHMLNISATDGGNLRSN--------ADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDV-AHRSPVRYSIY-------SGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYG-HTQVNIEVEDVNDNAPEFEASM---VRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTIL 1023          

HSP 9 Score: 96.6709 bits (239), Expect = 1.132e-19
Identity = 187/834 (22.42%), Postives = 336/834 (40.29%), Query Frame = 3
Query:  270 QFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNF--VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLK-----IQSNYFEIQISIEDINDHSP-VWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQM--FAKDLDISDND--------KLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT-YLLPIQVTDST-----KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD-----------------------NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF------PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLR-----TNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDS--------------------GPITHRVSVDVV---VKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEI-IRLVVKVSDSG 2513
            +F+++E+   G ++G +  +    D DL     + + ++  N+   V  V G++  +  +DRE             L+ +V   +     ++S    ++I + D+ND++P +    + V+++ E    G+      A D D   + SI+   +K  ++    LFSI      D T     ++R    +D E+     L + A D G+PP      L + + D+NDN P F        ++E+  +   +  +    +  D+  N         ++T++          + F I+  +G + V ++LD  +EV + + L I+  D+T     + +   + ++V + NDNAP     P        L V E     T I + +ATD D                        + ++    S +G L L   L D   V +Y +L+ + LD+ +N     T + Q        T+  + +++LD ND  PHF           +++I +   +   V  + A D D G N QL Y I        F I+  TG++        +  D EK G + L   +   ++    +P +  L+    + +I++  ++  P F +  Y  +I E      +V  V A+ S   A N  +SY       E  + ++   F V     I TT+   DRE+   +   +   D+                    G  ++    DV    + + D+NDN P++   S  GLS+    E  V   +  + A D D G N+ L Y I  GN    F ++  SG   L  +PL  +      L ++ SD G
Sbjct: 1159 EFRIEENLRRGSVVGVVTAS----DLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRE----------LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSI------DPT---SGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLD--REVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPID------LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPL-DFEAVQEY-LLIVQALDQSSN----VTERLQ--------TSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNL---IIGAKDHGQPEPKKSSLN----LHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAK-SLHGAENANLSY-------EIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV---IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE--LSARPLDREQHSRYTLQIQASDRG 1927          

HSP 10 Score: 92.8189 bits (229), Expect = 1.899e-18
Identity = 148/656 (22.56%), Postives = 271/656 (41.31%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIV-INIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDAN-IDRXXXXXXXXXXXXXDSGSP-PLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQ----NENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTI-------LLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTP--HFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTN---------------SIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTI---------IRVII--------------------KDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW--------SHSSDLGLSI 2291
            I I++ D+ND+SP +       +++PE+S+ G  + + +A DLD  P+  +              ++SI   +L +K  ++     + A  +DRE+  +  L + A D G P    G  ++TI + D NDN+P F       S++E+  +   + Q+ A D D+  N +L +S  N    E + +F I+G++G I     LD + +  +Y   +  TD  ++      V VQ    + NDN P+    P++        V   IQ    +  + A D D          ++  +  S    + +V  K+ I         ++ L  E+ +     +  +D G PPQ +  +I + + +    TP   F      V + E  P  + + ++ A   D G   ++ +     +     S+D  +G +R N               S   R +   Y+ E       +  +S  +++ L+S++          IRV++                    +D ND +P F +  +  ++ EG++   +V  V A DSD  + N ++ Y +V   ++    I   +        I  T   LDRE  D++   I A D G      +  + V+I D+NDN P +        S +++LG  I
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV-VASDLDEGPNADL--------------IYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN----ETQWQFAIDGQSGLITTVGKLDRELQA-SYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQ------VPALIQPGQTLLKVQALDAD--------LGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGS-NARLRYHIVDGNHDNAFVIEPAFSG------IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVI 2446          

HSP 11 Score: 84.7297 bits (208), Expect = 4.432e-16
Identity = 88/284 (30.99%), Postives = 127/284 (44.72%), Query Frame = 3
Query: 1725 FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVL-AEDSDIEAINRQ---ISYAMVIKPYETKSHISK---LYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI--IQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
             +ID  TG +RT    DRE    Y L A     RN+       +VL       V +KD ND AP F +       PE ++PR    ++L A D D+E  N Q   I    V   +   SH  +   LY  +   G        LDRET   +S  IEA D G    R  + V + I+D+NDN P ++ S        +    TVG  V  + A D+D+  N  + Y I   Q ++ ++F+++ ++G++Y+ K       E+  LVV   D G  PL  T  V I
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNI-------RVL-------VTVKDENDNAPTFPQTSMHIEFPE-NTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISG-------FLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFA---TVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSI 381          

HSP 12 Score: 79.337 bits (194), Expect = 2.025e-14
Identity = 142/604 (23.51%), Postives = 255/604 (42.22%), Query Frame = 3
Query:  864 SPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEV-NTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT--ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVY---------IDEGVPVESFVTKLNASDCDV-GVNSQLVYRIDHAH--FSIDENTGVLRTNSIFDR-----EKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHI--SKLYFSVSPDGRIFTTKESLDRETYDMHSFS-IEAWDSGP-----ITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXX--XXXXYEIIQGNEHELFKLNQKSGSLYLMKQ-PLSNDPEIIRLVVKVSDS-GPSPLTNTTIVRIYFHSE 2564
            +P L     L I + D NDNSP F +     ++ E N    ++ Q+ A D D   N +L +    GN  N      F I      I    I+  D+E+ + Y L I  TD           + V++ + NDN P           NN++ V E  +    I S+SA D+D    +     +   + +  +   +  + +Y+  ++L + LD E  + ++  +   D  +  +    ++ ++V D+ND  P F A     Y         I E + V+  +  +NA+D D  G NS+++Y I+ A   FS+  + GV+  N    R       +G+Y +         ++  D  +  L S+T++RV   D       F +  Y   I E +     +GSV+ +    +A+++  S A++    E+   +  SK    V P          LDRE  D++    + +   GP     +     + V++ I D NDNFP +  S+       I+    +   +  L+A+D+D      S + Y+I  GN+  +F ++  +G L++  +    +  +   L+++  DS    PL +    R+  H E
Sbjct: 2299 APFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN-----AFVIEPAFSGIVRTNIV-LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-------PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENM--SIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVN--MSRLQPAVSSSGDYFVR--------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAP----LGSVVLQLGQ-DALDQ--SLAIIAGNEESAFELLQSKAIVLVKP----------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKY--EAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDE 2855          

HSP 13 Score: 65.855 bits (159), Expect = 2.603e-10
Identity = 102/408 (25.00%), Postives = 164/408 (40.20%), Query Frame = 3
Query:  855 DSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT-YLL---------PIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD--NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETN-EFFQATIK-CQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA--------HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSS-PRMY-VGSVLAEDSD 2006
            D+G P L  ST L +   D       FL+      I E   +   + Q+    LD S    L    GN     + S F +      + VK +   D+E N  Y L         P  ++     +   +++ + + NDN P+        S+     + E      +IA L A D D  N+         + G        DL  VT   + +   LD ++  + ++  I+ C      P  + +   +++ D+ND  P FP      ++ E  PV S V + +ASD D G   QL Y I  A         F +D  +G++ +  +FD E+   Y +E        L+ SD   K   ++  +RV I+  ++  P F +  Y F +P   + P+ Y VG V A DSD
Sbjct: 2622 DAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS----LAIIAGN-----EESAFELLQSKAIVLVKPL---DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFD-----RSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDL--VTG-VLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDME--------LLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSD 2999          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 174.096 bits (440), Expect = 2.460e-43
Identity = 183/686 (26.68%), Postives = 314/686 (45.77%), Query Frame = 3
Query:  528 NYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTF--------SFGNSMNIEDRSK-FYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD---NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFP-AAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-------DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAM-------VIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIE--DLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEII----QGNEHE-----LFKLNQKSGSLYLMKQPL 2462
             + ++ I +ED+ND++P +  S + I++PE +++G+  Y   A D DS    S  + T   V  S   LF+I   S         L+L    ++D E  ++  L++ A D G P L+ +  + +++ D+NDN PVF K    +++ E+  I+  + Q+ A DLD  +N ++T+        +  NS++  D S+ F I   +G I+++  LD +   + Y L +  TD+      A+T ++V+V + NDN       P    S     +EEN++  + +  ++A+D+D   N++   S    +   ++  V  ++S          +PLDRE  E +   ++ +D G P +     + I V D ND  P         V + E  P  + V ++ A D D G N+ + Y I        H  FSID  +GV+RT  + D E+   Y+L     D  N     P E V     ++RV + D+ND  P F      F + E ++    VGS+   +   + +   +  +         + P  TK  I   +      G +   +  LDRE        I A D+    +  S  + VKIE  D+NDN P+W       + + ++    VG ++    A D+D+G N  L Y +I    Q NE +     LF+++  +G+L L + PL
Sbjct:  913 GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDS---GSSGQVTYSLVKESGKGLFAIDARS-------GHLIL--SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDND------PKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEIST--------REPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGN----PPRETV----RMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPL-TKDLIEAAFDIDRHSGNLVVAR-LLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDP---IDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL-QAPL 1557          

HSP 2 Score: 169.859 bits (429), Expect = 4.592e-42
Identity = 183/694 (26.37%), Postives = 320/694 (46.11%), Query Frame = 3
Query:  417 GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVN-NSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLV--KVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLT--DLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-----DHAH-FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSV-SPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW---SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMK 2453
            G++  K  +DRE   T+ +             + +      + ++++D ND++P + Q+ + I  PE++    +  L  A+DLD  P N+  RY +   N N   +L S  +       YL+   L++   +DRE      LL+ A D G+PPL G   + I I D+NDN P+F +     ++ EN  +   + Q++A D D  +N  + ++  N    +    F I+ + G I++ + LD++ +    L+ +      +  ET   V  +V + NDN P I+++    S +    + E+ Q    +A +S  D D+ +   +   +  G      LT  D S+   Y +++  PLDRE    +  ++   D G PP   +K I +++ D ND  P F   +    + E     + V ++ A D D G+NS L Y +      HA  F ID  TG++ T S  D E     +L         +V  D     LSST  + V I D+ND  P+F + FY  S+ E       +  V A D D   +N  ++Y +     E   H+++  F V S  G I    E LD E    + F + A D G ++   +  + +++ D+NDN P +    +   L  S   + + +   +V V+ A D D G    ++Y I+ GNE  +F++++ +G +++++
Sbjct:  130 GEIRTKVKLDRE---TRASYSLVA--------IPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNT-QRYNIVSGNVNDAFRLSS--HRERDGVLYLD---LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI-NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVI--FLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI---YLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQL--------TVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDC-GVNAMVNYTI----GEGFKHLTE--FEVRSASGEICIAGE-LDFERRSSYEFPVLATDRGGLS--TTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVR 781          

HSP 3 Score: 141.739 bits (356), Expect = 2.026e-33
Identity = 136/504 (26.98%), Postives = 224/504 (44.44%), Query Frame = 3
Query:  861 GSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD--NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTIL-------LTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI--DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYE-FSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLV 2327
            G PP+ G T + I + D+NDN+P F   +  IS+ E+  +   L    A D D   + ++T+S    +    +  F I+ ++G + + Q LDY+     + L +  TD    +      +LV VQ+ NDN PV             + V E+      I  ++A+D+D  N++ I      +G   ++  ++   V   + I        L  PLDRET + +Q T+   D+G P       + ++VLD ND  P F  +     I+E +   S V  + ASD D+G N+ + Y +   ++ F +   TG + T    DRE    Y L   V + R     D    V S+   +R+ + D+ND AP       +  S+ E   P   V  V A D D    N  I+Y+ ++K  ++  H     FS+ P   +  T+  LD E   ++   + A D G         + V++ DLNDN P ++ SS   L   +  +  +G +V
Sbjct:  907 GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL---VKESGKGLFAIDARSGHLILSQHLDYESS-QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF------EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDL---VVEAR-----DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRD-HGQNASITYS-IVKGRDSDGH---GLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSS---LVFRVREDAALGHVV 1384          

HSP 4 Score: 125.176 bits (313), Expect = 2.597e-28
Identity = 178/724 (24.59%), Postives = 307/724 (42.40%), Query Frame = 3
Query:  528 NYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSP----VFLKPLTEISIKENNFIDQYLCQMFAKDLDISD---NDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQI-LDYDQE-VNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISI-LPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT--KPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA-----HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMY-------VGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTK-ESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSS-DLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRFFEKDLV 2612
             +  + I+I+D+ND+ P++ QS+    +PE++ +G+      A D D+  +N +  Y +    + + ++F I  +      Y+N+ L       D E  E  EL+++A+D G  PL  +  ++I +TD+NDN P    +FL       I E+    +++ ++   D D      N  +T + G+         F +  ++  I++  + L  D+E V+ Y L +  TD       A   + +++ + NDN P     L H N       V E     T++  + A D D         S +   +          +   T L+T    +D ET    Q T+  +D G PP  +T  + + + D ND  P F  +   V + E  PV   + K++ASD D GVN+ + Y I         F +   +G +      D E+   Y+      DR            LS+T +I++ + D+ND  PVF    Y+ S+ E  SP+         + +V+A D D      Q+SY +V      ++ I ++  S    G IF  + + L   T  MH  +I A D G +       V + I D     P +  +  +  +  +I R   VG ++    A   D    S + Y I  G+    F +   SG++ + K PL ++ +   L+   +  G  P+   T V I    EV  +   +  FE  +V
Sbjct:  268 GFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDAD-ENGLVEYAINRRQSDKEQMFRI--DPRTGAIYINKAL-------DFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDG-------HFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN-------VMEVADPGTSVLQVLAHDRDEGLNSALTYSLA---ETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG----------LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRE--SPKASSQASSTPIVAVVATDPDYGNFG-QVSYRIVAG---NEAGIFRIDRST---GEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVI----AASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAK-PLDHEAKSQVLLNIQATLGEPPVYGHTQVNI----EVEDVNDNAPEFEASMV 936          

HSP 5 Score: 122.479 bits (306), Expect = 1.411e-27
Identity = 167/705 (23.69%), Postives = 288/705 (40.85%), Query Frame = 3
Query:  267 LQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMK--------ENNFVSL-----VNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFE-------IQISIEDINDHSPVWTQ------SKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVN-------NSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSP-PLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK--------------------------FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKI-INIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA---HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG 2189
            +  QV E + +G +I     N+   D D     +L +++++        +   +SL     + G L ++A +D E               +IV  L   SN  E       +++ I D NDH+P +            + I + ++IG      +A D DS  DN    Y +   N       NSQ  +  +V  SLP  T   +   R +  I             A+D G P P   S +L + +   ++N P FL+ +   +I EN     ++ Q+ AK L  ++N  L++     +       F+++ + G I  +   D + +  +Y+LP+ V D+ +                          F    + + V + NDN+P     P    S   L V EN  +   I ++ A+D+D         S +GG     +    S+ +    L  +PLDRE +  +   I+  D G P        I I V D+ND  P F  +  T  + E  P+ + V +++A D D+GVN++LVY + +     F+ID  +G++ T    DRE    Y       D           +V S+T  +++ + DIND  P+F++  Y   +P    P   +  V A D+D+ A N +I Y++       ++      F ++P     +  +SL  E+  +    + A D G
Sbjct: 1490 IDLQVSEATPVGTII----HNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFE---------AVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG-DNGQLTYEITGGNGEGRFRINSQTGIIELV-KSLPPATEDVEKGGRFNLIIG------------AKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVA---NDLFHVDWQRGIITTRGQFDRESQA-SYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP--EFRP---GSCYGLSVPEN-SEPGVIHTVVASDLDEGPNADLIYSITGG----NLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRY-------EVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGA-NAEIVYSL-----NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG 2140          

HSP 6 Score: 118.242 bits (295), Expect = 3.370e-26
Identity = 149/626 (23.80%), Postives = 271/626 (43.29%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGS--RYYLPLAKDLD---SSPDNSISRYTLKYVNNSQLK-LFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSP--PLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF------GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS----TKFAETILLVKVQ--NENDNAPVISILPHVNSSNNV-LLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSR--VLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYP-PQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA----HFSIDENTGVLRTNSIFDREKTGEYKLEATVYD--RRNLVDSDPTEKVLSSTTI-------------IRVIIKDINDCAPVFK-KLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVDVVVKIEDLNDNFPQWSHSSDLG 2282
            +++ + D+ND+ P +T S +V  + E + +G       P+ +  D   +S + S     + Y  N   K L    ++   D+   N ++ R+   +DRE   +  L + A D+ +   P + +  + I + D+NDN+P + +   ++ + E   +   +    A D D   N  L +         N    +  S F ++   G + ++  LD+ + V  YLL +Q  D     T+  +T + V+++  + ND+AP   + P+ +      L + +  +    +A + A D D+          +GG    R  + +   ++     L     D E    F   I  +D G P P+ ++  +++ V   ++  P F  A+    I E VP  SFV ++ A       N+ L Y I        F +D   G++ T   FDRE    Y L   V D  R++ + S    K  SS +I             I + + D+ND +P F+    Y  S+PE S P + + +V+A D D E  N  + Y++      T  ++   +   S  G +  +   LDRE +  ++  I+A D G P + +   ++ + +ED NDN P++  S   G
Sbjct: 1351 LRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDI--DRHSGNLVVARL---LDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDF-EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF-VSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLD-EGPNADLIYSI------TGGNLGNKFSIDSSSGEL--SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG 1959          

HSP 7 Score: 108.612 bits (270), Expect = 2.446e-23
Identity = 119/508 (23.43%), Postives = 227/508 (44.69%), Query Frame = 3
Query:  525 SNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFG--NSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPV---------ISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVF-KKLFYEFSIPEGSSPRMYVGSVLAEDSDIE 2012
            ++Y E+ I +ED ND+SP ++Q + V  + E +  G+      A D D+   N+  RY +   N+    +    ++ +          +R +  +DRE  +  +L ++A D G P +TG+  + + I D+NDN P F  P   +++ E   +   +  + A D+D      LT+  G  ++++IE+ S F ++  +GK+ +K+ LDY+ +   Y L +  +D+   A T+L V+V +ENDNAPV          +ILP ++       + E++  +  + +++ATD D+              +    +   + V    +   +P    + ++F   I  +D G P   ++ ++ +Q  D       F        I E  P+ S V +L     D  +   ++   + + F + ++  ++    + DRE+   YKL   +                  + II ++  D ND  P+F +   YE  I E +  R  +  + A D+D E
Sbjct: 2303 ASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAG-SNARLRYHIVDGNHDNAFVIEPAFSGI----------VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDTY--PALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISE------ISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYF-VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSL--AIIAGNEESAFELLQSKAIVLVKPL-DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITIL--DANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQE 2783          

HSP 8 Score: 99.7525 bits (247), Expect = 1.187e-20
Identity = 151/595 (25.38%), Postives = 251/595 (42.18%), Query Frame = 3
Query:  807 IDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK--FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT-ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESF-----VTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTG---VLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIV 2543
            +DRE +    L ++A D G+PPL  S  + + ITD+NDN P F + L   ++ E       + Q+ A D D   N  LT+S   +     +  F I+ + G I  +  +D + E    L  +          +   +LV + + NDN P+       + S   + V EN      I  +SA+D D     +   +   G K    LT+  V +    I +   LD E    ++  +   D G     TT +I +Q+ D ND  P F      V + E     S      +  + A+D D G   Q+ YRI    +   F ID +TG   V+R + +  R +   + L  +  D  NL  +        +  ++ + I D     P+F+K  Y + + E       VGSV+A   D+ A    + Y++        S     YFS+  +       + LD E       +I+A    P  +     V +++ED+NDN P++  S    + I++     +G  +    A D DSG +  + Y +++ +   LF ++ +SG L L +       +   L+V  +D G PS  TN TI+
Sbjct:  462 LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQ-WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF------DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKH---LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQP-MHMLNISATDGGNLRSN--------ADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDV-AHRSPVRYSIY-------SGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYG-HTQVNIEVEDVNDNAPEFEASM---VRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTIL 1023          

HSP 9 Score: 96.6709 bits (239), Expect = 1.132e-19
Identity = 187/834 (22.42%), Postives = 336/834 (40.29%), Query Frame = 3
Query:  270 QFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNF--VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLK-----IQSNYFEIQISIEDINDHSP-VWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQM--FAKDLDISDND--------KLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT-YLLPIQVTDST-----KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD-----------------------NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF------PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLR-----TNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDS--------------------GPITHRVSVDVV---VKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEI-IRLVVKVSDSG 2513
            +F+++E+   G ++G +  +    D DL     + + ++  N+   V  V G++  +  +DRE             L+ +V   +     ++S    ++I + D+ND++P +    + V+++ E    G+      A D D   + SI+   +K  ++    LFSI      D T     ++R    +D E+     L + A D G+PP      L + + D+NDN P F        ++E+  +   +  +    +  D+  N         ++T++          + F I+  +G + V ++LD  +EV + + L I+  D+T     + +   + ++V + NDNAP     P        L V E     T I + +ATD D                        + ++    S +G L L   L D   V +Y +L+ + LD+ +N     T + Q        T+  + +++LD ND  PHF           +++I +   +   V  + A D D G N QL Y I        F I+  TG++        +  D EK G + L   +   ++    +P +  L+    + +I++  ++  P F +  Y  +I E      +V  V A+ S   A N  +SY       E  + ++   F V     I TT+   DRE+   +   +   D+                    G  ++    DV    + + D+NDN P++   S  GLS+    E  V   +  + A D D G N+ L Y I  GN    F ++  SG   L  +PL  +      L ++ SD G
Sbjct: 1159 EFRIEENLRRGSVVGVVTAS----DLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRE----------LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSI------DPT---SGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLD--REVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPID------LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPL-DFEAVQEY-LLIVQALDQSSN----VTERLQ--------TSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNL---IIGAKDHGQPEPKKSSLN----LHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAK-SLHGAENANLSY-------EIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV---IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE--LSARPLDREQHSRYTLQIQASDRG 1927          

HSP 10 Score: 92.8189 bits (229), Expect = 1.899e-18
Identity = 148/656 (22.56%), Postives = 271/656 (41.31%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIV-INIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDAN-IDRXXXXXXXXXXXXXDSGSP-PLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQ----NENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTI-------LLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTP--HFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTN---------------SIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTI---------IRVII--------------------KDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW--------SHSSDLGLSI 2291
            I I++ D+ND+SP +       +++PE+S+ G  + + +A DLD  P+  +              ++SI   +L +K  ++     + A  +DRE+  +  L + A D G P    G  ++TI + D NDN+P F       S++E+  +   + Q+ A D D+  N +L +S  N    E + +F I+G++G I     LD + +  +Y   +  TD  ++      V VQ    + NDN P+    P++        V   IQ    +  + A D D          ++  +  S    + +V  K+ I         ++ L  E+ +     +  +D G PPQ +  +I + + +    TP   F      V + E  P  + + ++ A   D G   ++ +     +     S+D  +G +R N               S   R +   Y+ E       +  +S  +++ L+S++          IRV++                    +D ND +P F +  +  ++ EG++   +V  V A DSD  + N ++ Y +V   ++    I   +        I  T   LDRE  D++   I A D G      +  + V+I D+NDN P +        S +++LG  I
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTV-VASDLDEGPNADL--------------IYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN----ETQWQFAIDGQSGLITTVGKLDRELQA-SYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQ------VPALIQPGQTLLKVQALDAD--------LGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGS-NARLRYHIVDGNHDNAFVIEPAFSG------IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVI 2446          

HSP 11 Score: 84.7297 bits (208), Expect = 4.432e-16
Identity = 88/284 (30.99%), Postives = 127/284 (44.72%), Query Frame = 3
Query: 1725 FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVL-AEDSDIEAINRQ---ISYAMVIKPYETKSHISK---LYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI--IQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
             +ID  TG +RT    DRE    Y L A     RN+       +VL       V +KD ND AP F +       PE ++PR    ++L A D D+E  N Q   I    V   +   SH  +   LY  +   G        LDRET   +S  IEA D G    R  + V + I+D+NDN P ++ S        +    TVG  V  + A D+D+  N  + Y I   Q ++ ++F+++ ++G++Y+ K       E+  LVV   D G  PL  T  V I
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNI-------RVL-------VTVKDENDNAPTFPQTSMHIEFPE-NTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISG-------FLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFA---TVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSI 381          

HSP 12 Score: 79.337 bits (194), Expect = 2.025e-14
Identity = 142/604 (23.51%), Postives = 255/604 (42.22%), Query Frame = 3
Query:  864 SPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEV-NTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT--ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVY---------IDEGVPVESFVTKLNASDCDV-GVNSQLVYRIDHAH--FSIDENTGVLRTNSIFDR-----EKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHI--SKLYFSVSPDGRIFTTKESLDRETYDMHSFS-IEAWDSGP-----ITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXX--XXXXYEIIQGNEHELFKLNQKSGSLYLMKQ-PLSNDPEIIRLVVKVSDS-GPSPLTNTTIVRIYFHSE 2564
            +P L     L I + D NDNSP F +     ++ E N    ++ Q+ A D D   N +L +    GN  N      F I      I    I+  D+E+ + Y L I  TD           + V++ + NDN P           NN++ V E  +    I S+SA D+D    +     +   + +  +   +  + +Y+  ++L + LD E  + ++  +   D  +  +    ++ ++V D+ND  P F A     Y         I E + V+  +  +NA+D D  G NS+++Y I+ A   FS+  + GV+  N    R       +G+Y +         ++  D  +  L S+T++RV   D       F +  Y   I E +     +GSV+ +    +A+++  S A++    E+   +  SK    V P          LDRE  D++    + +   GP     +     + V++ I D NDNFP +  S+       I+    +   +  L+A+D+D      S + Y+I  GN+  +F ++  +G L++  +    +  +   L+++  DS    PL +    R+  H E
Sbjct: 2299 APFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN-----AFVIEPAFSGIVRTNIV-LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-------PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENM--SIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVN--MSRLQPAVSSSGDYFVR--------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAP----LGSVVLQLGQ-DALDQ--SLAIIAGNEESAFELLQSKAIVLVKP----------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKY--EAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDE 2855          

HSP 13 Score: 65.855 bits (159), Expect = 2.603e-10
Identity = 102/408 (25.00%), Postives = 164/408 (40.20%), Query Frame = 3
Query:  855 DSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT-YLL---------PIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD--NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETN-EFFQATIK-CQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA--------HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSS-PRMY-VGSVLAEDSD 2006
            D+G P L  ST L +   D       FL+      I E   +   + Q+    LD S    L    GN     + S F +      + VK +   D+E N  Y L         P  ++     +   +++ + + NDN P+        S+     + E      +IA L A D D  N+         + G        DL  VT   + +   LD ++  + ++  I+ C      P  + +   +++ D+ND  P FP      ++ E  PV S V + +ASD D G   QL Y I  A         F +D  +G++ +  +FD E+   Y +E        L+ SD   K   ++  +RV I+  ++  P F +  Y F +P   + P+ Y VG V A DSD
Sbjct: 2622 DAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS----LAIIAGN-----EESAFELLQSKAIVLVKPL---DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFD-----RSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDL--VTG-VLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDME--------LLASDMGGK--KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSD 2999          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 157.918 bits (398), Expect = 1.908e-38
Identity = 182/679 (26.80%), Postives = 305/679 (44.92%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGK--IFVKQILDYDQEVNTYLLPIQVTDSTKFAETILL-VKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD----NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVY-----RIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREE----TVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDS 2510
            +SN  ++ +++ D ND++P +  S+   ++ E+  +G       A D D   +  I+ Y++   +++    F +  +  P   ++  +       +DRE+  +    ++A+D G PP + S+ + I + D+NDN P F     E ++ E+      +  + A D D         + GN+     R +F I  +NG+  I + Q LDY QE   +LL +  TDS   ++T  + + + + N+ AP+    P+  S      V E+    T +  +SATD D       T      S  GL      + ++  T   I+   PLDRET   +  T+  +D G P    T  + I V D ND  P F + +    I E   V + V ++ ASD DVG+N ++ Y      I+   F ID  +G +RTN   DRE    + L A   D+     S P    LSST  +++ ++D+ND  P F        +PE S     VG + A D D E +N  + Y+++    +  +  S +    S   ++ T  E LD E+       +    S P+ +   ++++V   D+NDN P      D  +  N  R+      +GR+         D+ ++  L+Y I+ GN   L +LN  SG L L  Q  +N P+   + V VSD 
Sbjct:  669 RSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEIT-YSISERDDN----FPLAVD--PRTGWVQTI-----KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNT-----RGRFAITSQNGRGLITIAQSLDYKQE-KRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSAS------VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFS-INPQTG-AIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDK----GSPP----LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGG--DDSNAFSLVTRPGSERAQLLTMTE-LDYESTRKRFELVVRAASPPLRNDAHIEILVT--DVNDNAPVLR---DFQVIFNNFRDHFPSGEIGRIPAF------DADVSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDG 1298          

HSP 2 Score: 149.443 bits (376), Expect = 9.845e-36
Identity = 174/698 (24.93%), Postives = 306/698 (43.84%), Query Frame = 3
Query:  558 DINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVD---------ANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF------GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD------STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQ--DETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGR-IFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXY----EIIQG-NEHELFKLNQKSGSLYLMKQPLSND-PEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            ++ + SP + Q+  V ++ E    G+      A+D + SP                     +VY+ +      +Q L +VD         A++DRE ++     ++A D   PP +G+T L +N+ D ND+SP F     E SI+E   +   +  + A D DI  N ++ +              ++   F I+ ++G I  +  LD +   ++Y L +   D        + A   + VKV ++NDN P  S       +  V + E+     ++  +A + ATD D  +      +  GG   S+   D        + L KPLD E+   ++  I+ QD G P +  T  + + V+D ND  P F  +     + E VPV   + ++ A D D G N+++ Y I    D+   ++D  TG ++T    DRE+ G +  +        +V  D      S+++ + + ++D+ND  P F   +YE ++ E   P   V +V A D D ++   ++ Y +      T  +    +   S +GR + T  +SLD +       ++ A DSG  +   +V   + I D N+  P + ++     S ++  +  VG  V V+ A DSD G+N+ + Y    E I G    + F +N ++G++ +   PL  +      L V   D G   L++TT V I
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP---------------------VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETS-DSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-----ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSID---SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQ--------VVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS---RLHYEI------TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--INITDANNFAPIFENAP---YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEI 995          

HSP 3 Score: 129.028 bits (323), Expect = 1.733e-29
Identity = 186/714 (26.05%), Postives = 311/714 (43.56%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNS-------QLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXD---SGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFI---DQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVI-------SILPHVNSSNNVLLVEENIQDETAIASL--SATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT-KPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKV-LSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLY----FSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGN-EHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            +S    +Q+++ D NDHSP +   +   +I E + +GS      A D D   +  I  Y ++ V +        ++ +F I   S          ++   +++DRE  +   LL+ A D   + S   T +  + + + D NDN P F +    + + E+ +    D  +  + A D D  +N  + ++   GN+     +S+F I+  +G + + + LDY + V +Y L I+  D    ++   T LLV V + NDNAP         S+L +V    N++ V+    DE A A +  S ++ D++                     L+V  +   + T KPLDRE    F   +  +D G PP+  +  + I V D ND  P F        + E  P  + VT + A+D D   +S+L Y I        F+I    G      +    ++ +YK E     +R L+    T+    S T  + + I D N+ AP+F+   Y  S+ E +     V  V A DSD+  +N QI+Y++       +  I+ L     FS++P      T   LDRET   +  ++ A D G  +   + DV + + D+NDN P +   S L    +I  +  VG  V  + A D D GLN  + Y +   + E   F ++  SG++   K        +  L     D G  PL++T  V+I
Sbjct:  444 RSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEI-EYGIEAVTDGAGLAQDQEMPIFRIDSRSG---------VISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT-----QSQFSIDSMSGDVSLVKPLDY-ESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP-------------------LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNG----RGLITIAQSLDYKQE-----KRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDV-GVNAQITYSL------NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF--KSPL-YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQI 1101          

HSP 4 Score: 67.0106 bits (162), Expect = 1.284e-10
Identity = 62/239 (25.94%), Postives = 113/239 (47.28%), Query Frame = 3
Query:  525 SNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQY----LCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYL-LPIQVTDSTKFAETILLVKVQ 1226
            S+  E+QI +ED+ND  P +   KI + +PE+S +GS      A D D    N++  Y++  +       FS+V     ++    QLL   + + +  +     ++     + SPPL    H+ I +TD+NDN+PV    L +  +  NNF D +    + ++ A D D+SD        GN+ N+       +N  +G + +   L+ +  V  +  + + V+D    A+ I+ + V+
Sbjct: 1094 SSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGV-NAVVHYSI--IGGDDSNAFSLVTRPGSERA---QLLTMTELDYESTRKRFELVVR----AASPPLRNDAHIEILVTDVNDNAPV----LRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSGNNANL-----LRLNSSSGGLVLSPQLNTN--VPKFATMEVSVSDGINEAKAIMQLSVR 1311          

HSP 5 Score: 58.5362 bits (140), Expect = 4.529e-8
Identity = 61/221 (27.60%), Postives = 98/221 (44.34%), Query Frame = 3
Query: 1818 DRRNLVDSDPTEKVL------SSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI---------IQGNEHELFKLNQKSG 2435
            DRR++VDSD   K++      + T I R + +++ + +P F++  Y  S+ E       V +V A D +    +  + Y+MV          S+  F V     + TT  SLDRE  D+H F + A D        +  + V + D ND+ P +          +I    TVG  V  L+A D D G N+ + Y I          Q  E  +F+++ +SG
Sbjct:  319 DRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE----DSPVVYSMV----SLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQ---FEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSG 528          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 157.918 bits (398), Expect = 2.174e-38
Identity = 182/679 (26.80%), Postives = 305/679 (44.92%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGK--IFVKQILDYDQEVNTYLLPIQVTDSTKFAETILL-VKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD----NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVY-----RIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREE----TVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDS 2510
            +SN  ++ +++ D ND++P +  S+   ++ E+  +G       A D D   +  I+ Y++   +++    F +  +  P   ++  +       +DRE+  +    ++A+D G PP + S+ + I + D+NDN P F     E ++ E+      +  + A D D         + GN+     R +F I  +NG+  I + Q LDY QE   +LL +  TDS   ++T  + + + + N+ AP+    P+  S      V E+    T +  +SATD D       T      S  GL      + ++  T   I+   PLDRET   +  T+  +D G P    T  + I V D ND  P F + +    I E   V + V ++ ASD DVG+N ++ Y      I+   F ID  +G +RTN   DRE    + L A   D+     S P    LSST  +++ ++D+ND  P F        +PE S     VG + A D D E +N  + Y+++    +  +  S +    S   ++ T  E LD E+       +    S P+ +   ++++V   D+NDN P      D  +  N  R+      +GR+         D+ ++  L+Y I+ GN   L +LN  SG L L  Q  +N P+   + V VSD 
Sbjct:  669 RSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEIT-YSISERDDN----FPLAVD--PRTGWVQTI-----KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNT-----RGRFAITSQNGRGLITIAQSLDYKQE-KRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSAS------VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFS-INPQTG-AIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDK----GSPP----LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGG--DDSNAFSLVTRPGSERAQLLTMTE-LDYESTRKRFELVVRAASPPLRNDAHIEILVT--DVNDNAPVLR---DFQVIFNNFRDHFPSGEIGRIPAF------DADVSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDG 1298          

HSP 2 Score: 149.058 bits (375), Expect = 1.180e-35
Identity = 174/698 (24.93%), Postives = 306/698 (43.84%), Query Frame = 3
Query:  558 DINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVD---------ANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF------GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD------STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQ--DETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGR-IFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXY----EIIQG-NEHELFKLNQKSGSLYLMKQPLSND-PEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            ++ + SP + Q+  V ++ E    G+      A+D + SP                     +VY+ +      +Q L +VD         A++DRE ++     ++A D   PP +G+T L +N+ D ND+SP F     E SI+E   +   +  + A D DI  N ++ +              ++   F I+ ++G I  +  LD +   ++Y L +   D        + A   + VKV ++NDN P  S       +  V + E+     ++  +A + ATD D  +      +  GG   S+   D        + L KPLD E+   ++  I+ QD G P +  T  + + V+D ND  P F  +     + E VPV   + ++ A D D G N+++ Y I    D+   ++D  TG ++T    DRE+ G +  +        +V  D      S+++ + + ++D+ND  P F   +YE ++ E   P   V +V A D D ++   ++ Y +      T  +    +   S +GR + T  +SLD +       ++ A DSG  +   +V   + I D N+  P + ++     S ++  +  VG  V V+ A DSD G+N+ + Y    E I G    + F +N ++G++ +   PL  +      L V   D G   L++TT V I
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP---------------------VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETS-DSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS-----ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSID---SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQ--------VVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS---RLHYEI------TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--INITDANNFAPIFENAP---YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEI 995          

HSP 3 Score: 128.642 bits (322), Expect = 1.891e-29
Identity = 186/714 (26.05%), Postives = 311/714 (43.56%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNS-------QLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXD---SGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFI---DQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVI-------SILPHVNSSNNVLLVEENIQDETAIASL--SATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT-KPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKV-LSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLY----FSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGN-EHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            +S    +Q+++ D NDHSP +   +   +I E + +GS      A D D   +  I  Y ++ V +        ++ +F I   S          ++   +++DRE  +   LL+ A D   + S   T +  + + + D NDN P F +    + + E+ +    D  +  + A D D  +N  + ++   GN+     +S+F I+  +G + + + LDY + V +Y L I+  D    ++   T LLV V + NDNAP         S+L +V    N++ V+    DE A A +  S ++ D++                     L+V  +   + T KPLDRE    F   +  +D G PP+  +  + I V D ND  P F        + E  P  + VT + A+D D   +S+L Y I        F+I    G      +    ++ +YK E     +R L+    T+    S T  + + I D N+ AP+F+   Y  S+ E +     V  V A DSD+  +N QI+Y++       +  I+ L     FS++P      T   LDRET   +  ++ A D G  +   + DV + + D+NDN P +   S L    +I  +  VG  V  + A D D GLN  + Y +   + E   F ++  SG++   K        +  L     D G  PL++T  V+I
Sbjct:  444 RSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEI-EYGIEAVTDGAGLAQDQEMPIFRIDSRSG---------VISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNT-----QSQFSIDSMSGDVSLVKPLDY-ESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP-------------------LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNG----RGLITIAQSLDYKQE-----KRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDV-GVNAQITYSL------NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF--KSPL-YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQI 1101          

HSP 4 Score: 67.0106 bits (162), Expect = 1.329e-10
Identity = 62/239 (25.94%), Postives = 113/239 (47.28%), Query Frame = 3
Query:  525 SNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQY----LCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYL-LPIQVTDSTKFAETILLVKVQ 1226
            S+  E+QI +ED+ND  P +   KI + +PE+S +GS      A D D    N++  Y++  +       FS+V     ++    QLL   + + +  +     ++     + SPPL    H+ I +TD+NDN+PV    L +  +  NNF D +    + ++ A D D+SD        GN+ N+       +N  +G + +   L+ +  V  +  + + V+D    A+ I+ + V+
Sbjct: 1094 SSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGV-NAVVHYSI--IGGDDSNAFSLVTRPGSERA---QLLTMTELDYESTRKRFELVVR----AASPPLRNDAHIEILVTDVNDNAPV----LRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSGNNANL-----LRLNSSSGGLVLSPQLNTN--VPKFATMEVSVSDGINEAKAIMQLSVR 1311          

HSP 5 Score: 58.5362 bits (140), Expect = 4.458e-8
Identity = 61/221 (27.60%), Postives = 98/221 (44.34%), Query Frame = 3
Query: 1818 DRRNLVDSDPTEKVL------SSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI---------IQGNEHELFKLNQKSG 2435
            DRR++VDSD   K++      + T I R + +++ + +P F++  Y  S+ E       V +V A D +    +  + Y+MV          S+  F V     + TT  SLDRE  D+H F + A D        +  + V + D ND+ P +          +I    TVG  V  L+A D D G N+ + Y I          Q  E  +F+++ +SG
Sbjct:  319 DRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE----DSPVVYSMV----SLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQ---FEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSG 528          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 245.743 bits (626), Expect = 9.434e-67
Identity = 253/903 (28.02%), Postives = 428/903 (47.40%), Query Frame = 3
Query:  192 LANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQ-DFDLSRRENLNFQMMKENNFVSLVN-----GKLFVKAD-IDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTL-KYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTY--LLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH---FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS-------------KLPAESRFFEKD--------LVVMICMITVTLIVSGILVVAI-VLLKCKHCYRN-LPGITYQSKEYRHGHPDGQ 2762
            LA+ +  ++ L    F M  A+     + VKE     + IG+L ++  +  D D+     L F+ + +   V LV      G++   A+ IDRE++C+     + C   + V V   +I     +I+  IEDIND++P++  + I I+IPE++ I SRY +P A D D    N I  Y L K V+   L +        P+     QL+  V  ++DRE  +   + +  ED G+PP + +  L + ++D+NDN PVF     E+++ EN  +   +  + A D D+  N ++ FSF N ++   +  F I+   G I VKQ L  D+EVN    L+ +    S+  +   ++V V + NDN P I     +N  N  +L+ EN    T IA ++ TD D+         +   +  +L  V  D     ++ +    PLD ET   +   I   D G PP  T+ ++ I++ D+ND  P FP     + I E     + + K++A+D D G N+ ++Y +       F+ID  +G+L      DREK  +Y    TV  R N   + P    L S   +++I++D ND +P F    Y F +PE       VG +   D+D  A +  +    +I          K  F + P   +     + DRE    ++F ++A D+G +       V + + D+NDN      P  ++S DL     +    + G +VT + A+D+D+G+N+ L Y II G+   LF +++ +G++ L ++ ++ D  + RLVVKV D G P  L    +V ++ +  VS             + P E    + D        ++V+I +I  T+ V  ILV+ +  L++C+   R+ +   + QS E+   + DG+
Sbjct:    3 LASEAHVLVVLFTCLFLMCRAQE--KDYTVKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEI-FRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIG-INGIQHYELVKSVSEFGLDIIET-----PEGDKWPQLI--VQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPL--DREVNPVHKLIVLASDGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPVFND-----QFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSF--TVIARDN--GTTP----LQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDAD--AGDNAVVTLSIIN--------GKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL-----VPSNTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQPESLHAIALVHLFVNDTVSNATFIQEQLRKSLETPLERNIGDNDVTPQTNGYVIVVIAIIAGTMTV--ILVIFVTALVRCRQTPRHKVVQKSKQSGEWVSPNQDGR 862          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 246.128 bits (627), Expect = 1.300e-66
Identity = 252/903 (27.91%), Postives = 428/903 (47.40%), Query Frame = 3
Query:  192 LANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQ-DFDLSRRENLNFQMMKENNFVSLVN-----GKLFVKAD-IDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTL-KYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTY--LLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS-------------KLPAESRFFEKD--------LVVMICMITVTLIVSGILVVAI-VLLKCKHCYRN-LPGITYQSKEYRHGHPDGQ 2762
            LA+ +  ++ L    F   M ++    + VKE     + IG+L ++  +  D D+     L F+ + +   V LV      G++   A+ IDRE++C+     + C   + V V   +I     +I+  IEDIND++P++  + I I+IPE++ I SRY +P A D D    N I  Y L K V+   L +        P+     QL+  V  ++DRE  +   + +  ED G+PP + +  L + ++D+NDN PVF     E+++ EN  +   +  + A D D+  N ++ FSF N ++   +  F I+   G I VKQ L  D+EVN    L+ +    S+  +   ++V V + NDN P I     +N  N  +L+ EN    T IA ++ TD D+         +   +  +L  V  D     ++ +    PLD ET   +   I   D G PP  T+ ++ I++ D+ND  P FP     + I E     + + K++A+D D G N+ ++Y +       F+ID  +G+L      DREK  +Y    TV  R N   + P    L S   +++I++D ND +P F    Y F +PE       VG +   D+D  A +  +    +I          K  F + P   +     + DRE    ++F ++A D+G +       V + + D+NDN      P  ++S DL     +    + G +VT + A+D+D+G+N+ L Y II G+   LF +++ +G++ L ++ ++ D  + RLVVKV D G P  L    +V ++ +  VS             + P E    + D        ++V+I +I  T+ V  ILV+ +  L++C+   R+ +   + QS E+   + DG+
Sbjct:    3 LASEAHVLVVLFTCLF--LMCRAQEKDYTVKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEI-FRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIG-INGIQHYELVKSVSEFGLDIIET-----PEGDKWPQLI--VQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPL--DREVNPVHKLIVLASDGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPVFND-----QFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSF--TVIARDN--GTTP----LQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDAD--AGDNAVVTLSIIN--------GKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL-----VPSNTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQPESLHAIALVHLFVNDTVSNATFIQEQLRKSLETPLERNIGDNDVTPQTNGYVIVVIAIIAGTMTV--ILVIFVTALVRCRQTPRHKVVQKSKQSGEWVSPNQDGR 862          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 231.106 bits (588), Expect = 5.918e-62
Identity = 231/789 (29.28%), Postives = 374/789 (47.40%), Query Frame = 3
Query:  273 FQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFV-KADIDRERI--CTKKNQCCCLNLFVIVYNLKIQSN---YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSI-VYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT---YLLPIQVTDSTKFAETILLVKVQNENDNAPVISI--LPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLS-RVLTDLSV--VTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF-PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKL 2576
            ++V E      LIG L  +  + D     +  +    ++    V    G +F  +  IDRE +  C  K + C L   V V +L IQ+      E +I ++DIND++P +    + +++PE++ +G+ + +PLA D D+   N ++ YTL       + LF + V     +K  L QL+  V  ++DRE  +  +L + A D G+PP   S  L + I D NDN+P F K   E  + EN+ I   + Q+ A D D+  N ++ ++   +++   +    I+  +G I+VK  LD  +E+N    Y++      S K ++T + + V ++NDNAP + I  +  V  S+ V  + E++   TA+A +  +D D     +     +G +    R  +D SV    KY +  T PLD E    ++  I   D G P   +T  + +QV D ND +P F P      + +E  P E  V ++ ASD D G N++LVY I         F ID N+G +R  S  DRE    Y+   T  D+       P+ +  ++T +I+V+  D ND  P F    Y FS+ E   P   VG V  +D D E  N Q+   + ++P   K       F +        +  S DRE    ++F ++A D G       V V + + D NDN P  +  S+    I ++       +V V++A D DSG N+ L Y I  GN H+LF ++  +G + L K+       + RLV+KVSD G        +V IY +  ++ +
Sbjct:   27 YRVHEEQPPSTLIGSLAADQGLPDTGHLYKLEVGAPYLR----VDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDL-IQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTE-RNGVADYTLT-AGPEAVALFGLQVAEDRGEK--LPQLI--VLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPK-LLRIDRSSGIIYVKGPLDR-EEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVV-EVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADK-----GVPSHRG-TATVVIKVL--DRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMD-EGENAQVQ--LSVEPDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSF-IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANV 782          

HSP 2 Score: 60.8474 bits (146), Expect = 1.031e-8
Identity = 71/242 (29.34%), Postives = 105/242 (43.39%), Query Frame = 3
Query: 1881 RVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGR----IFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEH--ELFKLNQKSGSLYLMKQPLSNDPEI--IRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPA 2582
            R+ ++DIND  P F       S+PE +         LA D D E  N    Y +   P      ++     V+ D            SLDRE  D +  +I+A D G      S  + V I D NDN P++  SS       +     +G  V  +KA DSD G N  + Y + Q  +   +L ++++ SG +Y+ K PL  + EI  ++  V   D GPSP ++ T V I    +    PA
Sbjct:  118 RIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTER-NGVADYTLTAGP----EAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSS---YEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYV-KGPLDRE-EINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPA 349          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 232.261 bits (591), Expect = 5.986e-62
Identity = 231/789 (29.28%), Postives = 374/789 (47.40%), Query Frame = 3
Query:  273 FQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFV-KADIDRERI--CTKKNQCCCLNLFVIVYNLKIQSN---YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSI-VYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT---YLLPIQVTDSTKFAETILLVKVQNENDNAPVISI--LPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLS-RVLTDLSV--VTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF-PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKL 2576
            ++V E      LIG L  +  + D     +  +    ++    V    G +F  +  IDRE +  C  K + C L   V V +L IQ+      E +I ++DIND++P +    + +++PE++ +G+ + +PLA D D+   N ++ YTL       + LF + V     +K  L QL+  V  ++DRE  +  +L + A D G+PP   S  L + I D NDN+P F K   E  + EN+ I   + Q+ A D D+  N ++ ++   +++   +    I+  +G I+VK  LD  +E+N    Y++      S K ++T + + V ++NDNAP + I  +  V  S+ V  + E++   TA+A +  +D D     +     +G +    R  +D SV    KY +  T PLD E    ++  I   D G P   +T  + +QV D ND +P F P      + +E  P E  V ++ ASD D G N++LVY I         F ID N+G +R  S  DRE    Y+   T  D+       P+ +  ++T +I+V+  D ND  P F    Y FS+ E   P   VG V  +D D E  N Q+   + ++P   K       F +        +  S DRE    ++F ++A D G       V V + + D NDN P  +  S+    I ++       +V V++A D DSG N+ L Y I  GN H+LF ++  +G + L K+       + RLV+KVSD G        +V IY +  ++ +
Sbjct:   27 YRVHEEQPPSTLIGSLAADQGLPDTGHLYKLEVGAPYLR----VDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDL-IQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTE-RNGVADYTLT-AGPEAVALFGLQVAEDRGEK--LPQLI--VLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPK-LLRIDRSSGIIYVKGPLDR-EEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVV-EVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADK-----GVPSHRG-TATVVIKVL--DRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMD-EGENAQVQ--LSVEPDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSF-IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANV 782          

HSP 2 Score: 60.8474 bits (146), Expect = 1.154e-8
Identity = 96/345 (27.83%), Postives = 142/345 (41.16%), Query Frame = 3
Query: 1605 ITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSI-FDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTII----------RVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPD-GRIFT---TKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEH--ELFKLNQKSGSLYLMKQPLSNDPEI--IRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPA 2582
            I ++  D+G+P    + KL     +VG            +  +D  TG + T  I  DRE         T+ D RN       E  +S T +I          R+ ++DIND  P F       S+PE +         LA D D E  N    Y +   P      ++     V+ D G          SLDRE  D +  +I+A D G      S  + V I D NDN P++  SS       +     +G  V  +KA DSD G N  + Y + Q  +   +L ++++ SG +Y+ K PL  + EI  ++  V   D GPSP ++ T V I    +    PA
Sbjct:   39 IGSLAADQGLPDTGHLYKL-----EVGA----------PYLRVDGKTGDIFTTEIPIDRE---------TLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTER-NGVADYTLTAGP----EAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSS---YEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYV-KGPLDRE-EINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPA 349          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1a4 (protocadherin 1 alpha 4 [Source:ZFIN;Acc:ZDB-GENE-050202-4])

HSP 1 Score: 229.565 bits (584), Expect = 1.001e-61
Identity = 206/707 (29.14%), Postives = 347/707 (49.08%), Query Frame = 3
Query:  198 NLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNF----VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSI---------FDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYE------FSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG--PITHRVSVDVVVKIEDLND 2246
            NLS+ + F I++   +         + V E +  G +IG++ ++ +I   +L  R    FQ+M   N     V++  G LFVK  IDRE +C   NQ C LNL  +  N       + ++I I D+ND++PV+  S  ++++ E++  G R+ LP+AKDLD    N++  Y L     S  + FS+  +S     Y   +L +    +DREK   I L+L A D G PP +G+  + +N+ DINDN PVF K L ++ +KEN  +   +  + A+DLD   N ++ +SF    N ++ ++F IN  +G+I V+  +D++++ +   L +Q +D    +K     +L++V +ENDNAP I   P + S      V+E+ +  TA+A ++ +D D     I   +  G         + S    Y++++  PLDRE+   +  TI   D+G PP  ++ +I + + D ND  PHF A +   ++ E       VTK+ A D D G N++L Y +  +  S    T ++  NS+         F+ E+T  ++ +        ++ +D     LSS   + V I D ND +PV    + E       +IP  +    +V  + A D+D    N  +SY +      T+   + L+   S  G I T +   D +    H   I   ++G   ++   S+DVVV +E L+D
Sbjct:    2 NLSESVGFFILLLLSLLKFSIGQTSYSVSEEANKGTVIGNIAKDLKISAQELESRM---FQIMPGLNAKYFDVNVKTGSLFVKDRIDREELC-GVNQKCALNLEALAQN---PHRLYRLEIVIVDVNDNAPVFPNSTYILSVTENAIEGDRFPLPVAKDLDVG-SNALKDYKL-----SSNEHFSLDVHSGQRSIYAELILQKA---LDREKQAVIHLILTAIDGGKPPKSGTLSIVVNVKDINDNKPVFSKSLYKVKVKENTPVGTKIISVSARDLDEGINSEIQYSFLGHGNNDELNRFTINTNSGEITVQGQIDHEED-SAIELRVQASDKGSPSKSTHCKVLIEVVDENDNAPEIVTTPLMES------VKEDAKSGTAVALVTVSDKDMGKNGILHCALKGSFPFK---LETSYNNHYSLVVDGPLDRESVSQYNITITAADEGTPPLSSSTVITVHISDVNDNAPHFSAPVINAFLSENSQAGGLVTKVTADDSDTGENAELSYSLLDSSSSSIPVTTLININSLSGEIFSLQSFNHEETKRFQFQ--------VMATDTGVPPLSSNATVNVFILDENDNSPVILAPYSEPGSVNTENIPYSAEAGYFVAKIRAVDAD-SGYNALLSYHL------TEPKGTNLFRIGSSTGEIRTKRRMSDND-LKTHPQIITVSENGEPSLSATTSMDVVV-LESLDD 665          

HSP 2 Score: 118.242 bits (295), Expect = 1.902e-26
Identity = 171/682 (25.07%), Postives = 291/682 (42.67%), Query Frame = 3
Query:  888 HLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDND----KLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLL--PIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXG---GLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH-FSID---ENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDI----EAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG--PITHRVSVDVVVKIEDLNDNFP----QWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIY-------FHSEVSKLPA-ESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRNLPGITYQSKEYRHGHPDGQSSPTAS----DMFSSAVKLSSDVPLY 2828
             L I I D+NDN+PVF      +S+ EN           AKDLD+  N     KL+ +   S+++    +        ++ +++ LD +++   +L+   I      K     ++V V++ NDN PV S       S   + V+EN    T I S+SA D+D         S  G     +L+R   +        I +   +D E +   +  ++  D G P + T   + I+V+D+ND  P          + E     + V  +  SD D+G N  L   +  +  F ++    N   L  +   DRE   +Y +  T  D             LSS+T+I V I D+ND AP F        + E S     V  V A+DSD     E     +  +    P  T  +I+ L       G IF+  +S + E      F + A D+G  P++   +V+V   I D NDN P     +S    +    NI      G  V  ++A+D+DSG N+ L+Y + +     LF++   +G +   ++   ND +    ++ VS++G   L+ TT + +          +   ++P  E  F + +L ++I +++V++    I ++++V L    CYR     +       + HPDG  S + S    D+  S+  + SDV ++
Sbjct:  112 RLEIVIVDVNDNAPVFPNSTYILSVTENAIEGDRFPLPVAKDLDVGSNALKDYKLSSNEHFSLDVHSGQRSIY----AELILQKALDREKQAVIHLILTAIDGGKPPKSGTLSIVVNVKDINDNKPVFS------KSLYKVKVKENTPVGTKIISVSARDLDEGINSEIQYSFLGHGNNDELNRFTIN---TNSGEITVQGQIDHEEDSAIELRVQASDKGSPSKSTHCKVLIEVVDENDNAPEIVTTPLMESVKEDAKSGTAVALVTVSDKDMGKNGILHCALKGSFPFKLETSYNNHYSLVVDGPLDRESVSQYNITITAADEGT--------PPLSSSTVITVHISDVNDNAPHFSAPVINAFLSENSQAGGLVTKVTADDSDTGENAELSYSLLDSSSSSIPVTTLININSL------SGEIFSL-QSFNHEETKRFQFQVMATDTGVPPLSSNATVNVF--ILDENDNSPVILAPYSEPGSVNTE-NIPYSAEAGYFVAKIRAVDADSGYNALLSYHLTEPKGTNLFRIGSSTGEIRTKRRMSDNDLKTHPQIITVSENGEPSLSATTSMDVVVLESLDDIKTSFREVPVKEESFSDLNLYLLIAIVSVSV----IFLLSLVGLIAAKCYRTDSSFSRYGAPVINTHPDGSWSFSKSTQQYDVCFSSDTIKSDVVVF 758          

HSP 3 Score: 86.6557 bits (213), Expect = 1.002e-16
Identity = 137/541 (25.32%), Postives = 229/541 (42.33%), Query Frame = 3
Query: 1005 AKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYD------QEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYR-IDHAH------FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIK--DINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIK-PYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHE-----LFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSE 2564
            AKDL IS  +  +  F   M   +   F +N K G +FVK  +D +      Q+    L  +       +   I++V V   NDNAPV        +S  +L V EN  +        A D+D  S  +     S     S  +          ++L K LDRE        +   D G PP+  T  I + V D ND  P F  ++  V + E  PV + +  ++A D D G+NS++ Y  + H +      F+I+ N+G +      D E+    +L     D+ +           S +T  +V+I+  D ND AP         S+ E +     V  V   D D+   N  +  A+    P++ ++  +  ++S+  DG        LDRE+   ++ +I A D G      S  + V I D+NDN P +S      ++  ++     G LVT + A DSD+G N+ L+Y ++  +        L  +N  SG ++ ++     + +  +  V  +D+G  PL++   V ++   E
Sbjct:   43 AKDLKISAQELESRMF-QIMPGLNAKYFDVNVKTGSLFVKDRIDREELCGVNQKCALNLEALAQNPHRLYRLEIVIVDV---NDNAPVFP------NSTYILSVTENAIEGDRFPLPVAKDLDVGSNALKDYKLSSNEHFSLDVHSGQRSIYAELILQKALDREKQAVIHLILTAIDGGKPPKSGTLSIVVNVKDINDNKPVFSKSLYKVKVKENTPVGTKIISVSARDLDEGINSEIQYSFLGHGNNDELNRFTINTNSGEITVQGQIDHEEDSAIELRVQASDKGSP----------SKSTHCKVLIEVVDENDNAPEIVTTPLMESVKEDAKSGTAVALVTVSDKDM-GKNGILHCALKGSFPFKLETSYNN-HYSLVVDG-------PLDRESVSQYNITITAADEGTPPLSSSTVITVHISDVNDNAPHFSAPV---INAFLSENSQAGGLVTKVTADDSDTGENAELSYSLLDSSSSSIPVTTLININSLSGEIFSLQSFNHEETKRFQFQVMATDTGVPPLSSNATVNVFILDE 551          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 233.032 bits (593), Expect = 2.190e-62
Identity = 230/854 (26.93%), Postives = 398/854 (46.60%), Query Frame = 3
Query:  279 VKEHSEIGLLIGDLVENYRIQ-DFDLSRRENLNFQMMKENNFVSLV-----NGKLFVKAD-IDRERICTK---KNQCCCLNLFVIVYNLKIQSNYF---EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH---FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-----SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEII-RLVVKVSDSG-PSP---------LTNTTIVRIYFHSEVSKLPAESRFFE-----------KDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRN 2705
            V+E     +LIG+L+++  +  D DLS    L F+++ +   V L+      G++F  ++ IDRE++C+    +N+C     F  V    +    F   +I+  IEDIND+SP++  + I I+IPE++ + SRY +P A D D    N I  Y L    N    +F +     P+     QL+  V  ++DRE+ +   + +  ED G+P  + +  L + +TD+NDN PVF +   E++I E+  +   + Q+ A D D+  N K+ F FGN +    +  F I+   G I VK+ LD ++     L  +    S+  +   + + + + NDN P I     +N  N  + + E     T IA ++ TD D          +   +  +L  V  +     ++ +    PLD E+   +   I   D G PP   + ++ I++ D+ND  P F   +  +   E  P  + +TK++A+D D G N++L Y +       F++D  TG+L      DREK   Y       D  N     P+   L + T + + + D ND +P F    Y F +PE       VG +   D+D    N  ++ ++V          ++  F + P   +     + DRE    ++F ++A D G      +V V + +ED+NDN P +     ++S DL     +    + G +V  + A+D+D+G+N+ L Y II GN   LF + ++SG++ L ++ L+ D  ++ +LV+KV+DSG P P           N TI    +  E+ +   E+   E            D V +I  I    +   +++    L++C+   R+
Sbjct:   30 VREELPENVLIGNLLKDLNLTLDPDLSTP--LQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKC-----FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGV-NGIQHYELLKGQN----VFGLDVIETPEGDKWPQLI--VQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDN-----QFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGN-----PS---LQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDAD-SGENAVVTLSLV---------NARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDL-----VQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPRH 841          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 232.646 bits (592), Expect = 2.636e-62
Identity = 230/854 (26.93%), Postives = 398/854 (46.60%), Query Frame = 3
Query:  279 VKEHSEIGLLIGDLVENYRIQ-DFDLSRRENLNFQMMKENNFVSLV-----NGKLFVKAD-IDRERICTK---KNQCCCLNLFVIVYNLKIQSNYF---EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH---FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-----SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEII-RLVVKVSDSG-PSP---------LTNTTIVRIYFHSEVSKLPAESRFFE-----------KDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRN 2705
            V+E     +LIG+L+++  +  D DLS    L F+++ +   V L+      G++F  ++ IDRE++C+    +N+C     F  V    +    F   +I+  IEDIND+SP++  + I I+IPE++ + SRY +P A D D    N I  Y L    N    +F +     P+     QL+  V  ++DRE+ +   + +  ED G+P  + +  L + +TD+NDN PVF +   E++I E+  +   + Q+ A D D+  N K+ F FGN +    +  F I+   G I VK+ LD ++     L  +    S+  +   + + + + NDN P I     +N  N  + + E     T IA ++ TD D          +   +  +L  V  +     ++ +    PLD E+   +   I   D G PP   + ++ I++ D+ND  P F   +  +   E  P  + +TK++A+D D G N++L Y +       F++D  TG+L      DREK   Y       D  N     P+   L + T + + + D ND +P F    Y F +PE       VG +   D+D    N  ++ ++V          ++  F + P   +     + DRE    ++F ++A D G      +V V + +ED+NDN P +     ++S DL     +    + G +V  + A+D+D+G+N+ L Y II GN   LF + ++SG++ L ++ L+ D  ++ +LV+KV+DSG P P           N TI    +  E+ +   E+   E            D V +I  I    +   +++    L++C+   R+
Sbjct:   50 VREELPENVLIGNLLKDLNLTLDPDLSTP--LQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKC-----FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGV-NGIQHYELLKGQN----VFGLDVIETPEGDKWPQLI--VQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDN-----QFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGN-----PS---LQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDAD-SGENAVVTLSLV---------NARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDL-----VQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPRH 861          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 233.032 bits (593), Expect = 2.797e-62
Identity = 230/854 (26.93%), Postives = 398/854 (46.60%), Query Frame = 3
Query:  279 VKEHSEIGLLIGDLVENYRIQ-DFDLSRRENLNFQMMKENNFVSLV-----NGKLFVKAD-IDRERICTK---KNQCCCLNLFVIVYNLKIQSNYF---EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH---FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-----SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEII-RLVVKVSDSG-PSP---------LTNTTIVRIYFHSEVSKLPAESRFFE-----------KDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRN 2705
            V+E     +LIG+L+++  +  D DLS    L F+++ +   V L+      G++F  ++ IDRE++C+    +N+C     F  V    +    F   +I+  IEDIND+SP++  + I I+IPE++ + SRY +P A D D    N I  Y L    N    +F +     P+     QL+  V  ++DRE+ +   + +  ED G+P  + +  L + +TD+NDN PVF +   E++I E+  +   + Q+ A D D+  N K+ F FGN +    +  F I+   G I VK+ LD ++     L  +    S+  +   + + + + NDN P I     +N  N  + + E     T IA ++ TD D          +   +  +L  V  +     ++ +    PLD E+   +   I   D G PP   + ++ I++ D+ND  P F   +  +   E  P  + +TK++A+D D G N++L Y +       F++D  TG+L      DREK   Y       D  N     P+   L + T + + + D ND +P F    Y F +PE       VG +   D+D    N  ++ ++V          ++  F + P   +     + DRE    ++F ++A D G      +V V + +ED+NDN P +     ++S DL     +    + G +V  + A+D+D+G+N+ L Y II GN   LF + ++SG++ L ++ L+ D  ++ +LV+KV+DSG P P           N TI    +  E+ +   E+   E            D V +I  I    +   +++    L++C+   R+
Sbjct:   50 VREELPENVLIGNLLKDLNLTLDPDLSTP--LQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKC-----FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGV-NGIQHYELLKGQN----VFGLDVIETPEGDKWPQLI--VQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDN-----QFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGN-----PS---LQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDAD-SGENAVVTLSLV---------NARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDL-----VQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPRH 861          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.942 bits (572), Expect = 3.847e-60
Identity = 234/836 (27.99%), Postives = 393/836 (47.01%), Query Frame = 3
Query:  267 LQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRE-NLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETI-LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI---------DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSIN----ITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAE-------------SRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCK 2690
            LQ+ + E   +G +IG++  +  +   +LS R+ ++  +  K+   V L NG L+V   IDRE +C  + Q C LN+  +   ++   +++ I + I+D+ND+SP +++S   I+I E + +G+ + L  AKD D   +NSI  Y L     S    F ++     D     +L+L  +  +DREK     L+L A D G+P  TG++ + I +TDINDN P+F K    +++ EN  I   +  + A D D   N ++T+ F N +    +  F IN +NG + +   LDY+   N Y + ++  D         LL++V + NDNAP I I    +      ++ E+ +  T IA ++  D+D+          S  L    +    S    Y ++ +  LDRE    +  TIK +D G P    +K I + + D ND  P F       YI E  P  +   +++A+D D+  N ++VY I           ++ SI+  +GVL     FD EK  E+ ++A           D     L++   IR+I+ D+ND APVF+K+ Y   I E +        V A DSDI   N ++ Y ++    E     S  Y S++    +   + S D E+       + A DSG  +   +  V + I D NDN P+  + S    + +    I    T G LVT + A+D+DSG N+ L+Y ++Q  +     + Q +G + + +     D    R+VV V D+G   L++T  + +       ++  E             + F+   LV+ I +I++  I +   V+  V+ KC+
Sbjct:   34 LQYSIYEEQRLGYVIGNIANDLGVSAEELSSRKFHIVSRSKKQYLNVHLENGDLYVADRIDREALCGMQ-QNCFLNIEAV---MESPLHFYTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLG-NNSIQSYKL-----SANDYFGMLEKVNTDGRKYPELVL--EKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITYLF-NDIPENAQEVFAINPENGSVQITGKLDYEVATN-YEMTVEAKDGGGLVSYCKLLIQVSDVNDNAPDILITSFSD------IIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLIS---SSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLREFYIQA----------EDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSDINE-NGKVVYMILTDIIEDMPLSS--YISINTVSGVLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQETDALRQRIVVMVKDNGYPMLSSTVTLNLVVAENFQQVLPEITNQHIDTESSSNATFY---LVISIALISILFIFT---VLVAVISKCR 827          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 214.542 bits (545), Expect = 2.541e-56
Identity = 205/732 (28.01%), Postives = 350/732 (47.81%), Query Frame = 3
Query:  402 VSLVNGKLFVKAD-IDRERICTKKNQC----CCLNLFVIVYNLKIQSNYF---EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD-STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVV--TKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI--DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFP-QWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIY 2552
            VS   G++F  +  IDRE++C   +      C   L V++    + +++F   +I+I ++D ND++P++  + I I+IPE++ I SR+ +P A D D+   N +  Y L    N Q  +F +     P+     QL+  V  N+DRE+ +   + +  ED G+P  + +  L + ++D+NDN PVF +   E+ I EN  I   + Q+ A D DI  N ++ + FG  +    +  F +N   G I V++ LD  +E   + L +  TD S+  A   + + V + NDN P I +   ++  N  + + E     T IA ++ +D D                   V   L  V   +Y +  +  LD E  + F   I   D G P    T ++ +++ D+ND  P F   +  + + E      ++T ++ASD D G NS +VY++  + + F +D  TGVL  + +FDRE+   +    T  D     +  P    L S   + V + D ND +P F    ++F + E       VG + A DSD    N+ ++ + ++   E         F + P   +  +  S DRE    ++F ++A D G      +  V + I D NDN P   S  S+    + +      G +V  + A+D+D+G+N+ L Y I+ GN   LF+++  +G++ L ++P + D  + RLVV +SD G P PL    +V +Y
Sbjct:   78 VSSSTGEIFTTSTRIDREKLCAGSSNSDENECFFELEVVI----LPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTG-FNGVQHYELL---NGQ-SVFGLDIVETPEGEKWPQLI--VQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDR-EETAVHKLTVLATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARD-----NGTPP---LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSD-AGENKAVTLS-ILNDNEN--------FVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHTLVLVFLY 773          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 243.817 bits (621), Expect = 6.032e-66
Identity = 226/798 (28.32%), Postives = 366/798 (45.86%), Query Frame = 3
Query:  273 FQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFV-KADIDRERICTKKNQC----CCLNLFVIVYNLKIQSN---YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD---STKFAETILLVKVQNENDNAPVISI--LPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL-----KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID-----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKE---------SLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVS 2570
            ++V E      LIG L  +Y + D     +  +    ++    V    G +F  +  IDRE +   +NQ     C L   V + +L +Q+      E QI ++DIND++P +    I + IPE++ IGS + +PLA D D+ P N ++ Y L+    +Q +LF +    + +     Q  L V  N+DRE+ +  +L +  +D G+PP   S  L + + D NDN+P F +P  E  + EN+ I   + Q+ A D D   N ++ ++F  +  +  R    ++   G I V+  +D  ++++T    +   D   + K A   ++V V++ NDNAP I I  +  V   + +  + E++ +ETA+A +  +D D           +G +     + S   +D     KY +  T PLD E  + +   I   D G PP  +T  + +QV+D ND  P F  +IT V   E       V ++ ASD D G N++LVY ++        F+I    G +R  +  DRE+   Y+L+    DR       P+   L  T  + V + D ND  P F    Y FS+ E       VG V   D D                   K   +++  SV  D   F  +          S DRE    ++F ++A D G       V V + + D NDN P  +  S+    + +T +  +G  V+ + A D DSG+N+ L Y I  GN + LF++   SG++ L K+       + RLVVKVSD G  P   T +V +Y +  ++
Sbjct:   40 YKVPEEQPPNTLIGSLAADYGLPDVGHLYKLEVGAPYLR----VDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDL-VQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGP-NGVASYELQAGPEAQ-ELFGL---QVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVV-RRLLRLDRNTGLITVQGPVDR-EDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSK--KKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADR-----GSPS---LQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGD-------------------KGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLA 795          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 243.817 bits (621), Expect = 6.032e-66
Identity = 226/798 (28.32%), Postives = 366/798 (45.86%), Query Frame = 3
Query:  273 FQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFV-KADIDRERICTKKNQC----CCLNLFVIVYNLKIQSN---YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD---STKFAETILLVKVQNENDNAPVISI--LPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL-----KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID-----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKE---------SLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVS 2570
            ++V E      LIG L  +Y + D     +  +    ++    V    G +F  +  IDRE +   +NQ     C L   V + +L +Q+      E QI ++DIND++P +    I + IPE++ IGS + +PLA D D+ P N ++ Y L+    +Q +LF +    + +     Q  L V  N+DRE+ +  +L +  +D G+PP   S  L + + D NDN+P F +P  E  + EN+ I   + Q+ A D D   N ++ ++F  +  +  R    ++   G I V+  +D  ++++T    +   D   + K A   ++V V++ NDNAP I I  +  V   + +  + E++ +ETA+A +  +D D           +G +     + S   +D     KY +  T PLD E  + +   I   D G PP  +T  + +QV+D ND  P F  +IT V   E       V ++ ASD D G N++LVY ++        F+I    G +R  +  DRE+   Y+L+    DR       P+   L  T  + V + D ND  P F    Y FS+ E       VG V   D D                   K   +++  SV  D   F  +          S DRE    ++F ++A D G       V V + + D NDN P  +  S+    + +T +  +G  V+ + A D DSG+N+ L Y I  GN + LF++   SG++ L K+       + RLVVKVSD G  P   T +V +Y +  ++
Sbjct:   40 YKVPEEQPPNTLIGSLAADYGLPDVGHLYKLEVGAPYLR----VDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDL-VQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGP-NGVASYELQAGPEAQ-ELFGL---QVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVV-RRLLRLDRNTGLITVQGPVDR-EDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSK--KKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADR-----GSPS---LQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGD-------------------KGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLA 795          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 234.572 bits (597), Expect = 4.916e-63
Identity = 222/811 (27.37%), Postives = 383/811 (47.23%), Query Frame = 3
Query:  183 METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDF-DLSRRENLNFQMMKENNFVSLV-----NGKLFVK-ADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH---AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEV 2567
            M+ L+    F + L  V F    + +    + V+E     +LIGDL+++  +    D S    + F+++ +   V L+      G++F   A IDRE++C     +  C   + V V   +I     +I+  IEDIND++P++  + I I+IPE+S I SRY LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++ D NDN P+F++   E+SI EN  I   + Q+ A D DI +N ++ F F N ++   +  F++N   G I VK+ LD ++  +  LL +     +  A   +LV V + NDN P I I   VN +N  +L+ EN    T IA ++  D D+         +   +  +L  V ++     ++ +     LD E+   +   +   D G PP   + ++ I+V D+ND  P F  +  ++ + E     + +TK++A+D D G N+++ Y +       F++D+ TG+L      DREK  +Y    TV  + N +        L S   + V + D ND +P+F    Y F +PE       VG +   D D        + A+ +   +         F++ P   +     S DRE  + ++F ++A D G ++   +  V + + D+NDN P +    S+      +      G +V  + A+D D G+N+ + Y I+ GN   LF + Q SG++ L ++ + +D  + R++VK +D G P  L N   V  + +  V
Sbjct:    1 MDLLSGTYIFAVLLACVVF---QSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEI-FRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSN-----QFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYF--TVLAQDNGIPP------LMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGE-----NSAVTLSILDVNDQ-----FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEW-VLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESV 776          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 235.343 bits (599), Expect = 1.070e-62
Identity = 222/811 (27.37%), Postives = 384/811 (47.35%), Query Frame = 3
Query:  183 METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDF-DLSRRENLNFQMMKENNFVSLV-----NGKLFV-KADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH---AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEV 2567
            M+ L+    F + L  V F    + +    + V+E     +LIGDL+++  +    D S    + F+++ +   V L+      G++F   A IDRE++C     +  C   + V V   +I     +I+  IEDIND++P++  + I I+IPE+S I SRY LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++ D NDN P+F++   E+SI EN  I   + Q+ A D DI +N ++ F F N ++   +  F++N   G I VK+ LD ++  +  LL +     +  A   +LV V + NDN P I I   VN +N  +L+ EN    T IA ++  D D+         +   +  +L  V ++     ++ +     LD E+   +   +   D G PP   + ++ I+V D+ND  P F  +  ++ + E     + +TK++A+D D G N+++ Y +       F++D+ TG+L      DREK  +Y    TV  + N +        L S   + V + D ND +P+F    Y F +PE       VG +   D D    N  ++ +++              F++ P   +     S DRE  + ++F ++A D G ++   +  V + + D+NDN P +    S+      +      G +V  + A+D D G+N+ + Y I+ GN   LF + Q SG++ L ++ + +D  + R++VK +D G P  L N   V  + +  V
Sbjct:    1 MDLLSGTYIFAVLLACVVF---QSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEI-FRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSN-----QFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYF--TVLAQDNGIPP------LMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDY-GENSAVTLSIL---------DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEW-VLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESV 776          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 234.187 bits (596), Expect = 1.373e-62
Identity = 222/811 (27.37%), Postives = 383/811 (47.23%), Query Frame = 3
Query:  183 METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDF-DLSRRENLNFQMMKENNFVSLV-----NGKLFV-KADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH---AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEV 2567
            M+ L+    F + L  V F    + +    + V+E     +LIGDL+++  +    D S    + F+++ +   V L+      G++F   A IDRE++C     +  C   + V V   +I     +I+  IEDIND++P++  + I I+IPE+S I SRY LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++ D NDN P+F++   E+SI EN  I   + Q+ A D DI +N ++ F F N ++   +  F++N   G I VK+ LD ++  +  LL +     +  A   +LV V + NDN P I I   VN +N  +L+ EN    T IA ++  D D+         +   +  +L  V ++     ++ +     LD E+   +   +   D G PP   + ++ I+V D+ND  P F  +  ++ + E     + +TK++A+D D G N+++ Y +       F++D+ TG+L      DREK  +Y    TV  + N +        L S   + V + D ND +P+F    Y F +PE       VG +   D D        + A+ +   +         F++ P   +     S DRE  + ++F ++A D G ++   +  V + + D+NDN P +    S+      +      G +V  + A+D D G+N+ + Y I+ GN   LF + Q SG++ L ++ + +D  + R++VK +D G P  L N   V  + +  V
Sbjct:    1 MDLLSGTYIFAVLLACVVF---QSGAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEI-FRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSN-----QFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYF--TVLAQDNGIPP------LMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGE-----NSAVTLSILDVNDQ-----FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEW-VLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESV 776          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.189e-66
Identity = 234/821 (28.50%), Postives = 401/821 (48.84%), Query Frame = 3
Query:  183 METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFV-KADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSAT--DMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-----SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            M+ L+    F + L  V F    + +    + ++E     +LIGDL     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ T  D D++  +          +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       +TK++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN P +     ++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:    1 MDLLSGTYIFAVLLACVVF---HSGAQEKNYTIREEMPENVLIGDL-----LKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-TNGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLP-----STNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 777          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.436e-66
Identity = 234/821 (28.50%), Postives = 401/821 (48.84%), Query Frame = 3
Query:  183 METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFV-KADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSAT--DMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-----SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            M+ L+    F + L  V F    + +    + ++E     +LIGDL     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ T  D D++  +          +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       +TK++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN P +     ++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:    1 MDLLSGTYIFAVLLACVVF---HSGAQEKNYTIREEMPENVLIGDL-----LKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-TNGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLP-----STNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 777          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 4.310e-66
Identity = 235/821 (28.62%), Postives = 401/821 (48.84%), Query Frame = 3
Query:  183 METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFVK-ADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSAT--DMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-----SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            M+ L+    F + L  V F    + +    + ++E     +LIGDL     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DREK +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ T  D D++  +          +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       +TK++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN P +     ++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:    1 MDLLSGTYIFAVLLACVVF---HSGAQEKNYTIREEMPENVLIGDL-----LKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQN----MFGLDVIETPEGDKMPQLI--VQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLP-----STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 777          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.698e-65
Identity = 234/821 (28.50%), Postives = 400/821 (48.72%), Query Frame = 3
Query:  183 METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFV-KADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSAT--DMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW-----SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            M+ L+    F + L  V F    + +    + ++E     +LIGDL     ++D +LS   N      + F+++ +   V L       G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ T  D D++  +          +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       +TK++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN P +     ++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:    1 MDLLSGTYIFAVLLACVVF---HSGAQEKNYTIREEMPENVLIGDL-----LKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLTRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLP-----STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 777          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 3.821e-65
Identity = 230/812 (28.33%), Postives = 398/812 (49.01%), Query Frame = 3
Query:  210 FIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRREN------LNFQMMKENNFVSLV-----NGKLFVK-ADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSAT--DMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            F + L+ V F    + +    + ++E     +LIG+L     ++D +LS   N      + F+++ +   V L+      G++F   A IDRE++C    +++ C   + V +   +I     +I+  IEDIND++P++  + I I+IPE+S I S+Y LP A D D    N +  Y L    N    +F +     P+   + QL+  V   +DRE+ +   + +  ED G P  + +  L +++TD NDN PVF +   E+SI EN  +   + Q+ A D DI +N K+ FSF N ++   R  F++N   G I +K+ LD ++  N  LL +        A  ++LV V + NDN P I I   VN  N+ +++ ENI   T IA ++ T  D D++  +          +L  V ++     ++ +     LD E+ + +   +   D G PP   + ++ I+V D+ND  P F  +  TV I E       + K++A+D D G N+++ Y +       FS+D  TG+L      DREK  +Y    T+  + N V        L+S   + V I D ND +PVF    Y+F +PE       VG +   D D    N  ++ +++ +  +         F++     +     S DRE  + ++F ++A D G ++   S  V + + D+NDN      P +++S +L L          G +V  + A+D+D+G+N+ + Y I+ GN  +LF ++Q++G++ LM++    D  + R++VK +D G P  L +  IV ++ +  V+
Sbjct:   42 FAVLLVCVVF---HSGAQEKNYTIREEIPENVLIGNL-----LKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEI-FRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQN----IFGLDVIETPEGDKMPQLI--VQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLF--TILAKDNGVPP------LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDY-GDNSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP-----STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVT 809          
BLAST of Protocadherin vs. TrEMBL
Match: A0A068WFD5 (Protocadherin 9 OS=Echinococcus granulosus OX=6210 GN=EgrG_000878500 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 3.526e-102
Identity = 280/960 (29.17%), Postives = 456/960 (47.50%), Query Frame = 3
Query:  192 LANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSL--VNGKLFVKADIDRERICTKKNQCC-----------------------------CLNLFVIVYN----LKIQSN---YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRY------------TLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYD---------------QEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNS--SNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTK--------YTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYR-------IDH-AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKL----YFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSH--SSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSND----------PEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESR-------------------------FFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCY 2699
            + +++ F + L+++      A+  S+ F + E   IG  +G L E   +   D++ R  +NF  + +   V+    +G + V+  IDRE +C +   CC                              + + V+       L  QS      ++ I + D+ND+ P W+  ++ + IPEH+ IG ++ LP A D D  P+N++  Y            T++ + +   KL S +    P   Y   L L+V+A++DREK      LL+A D GSP LTGS  + I ITDIND +P F +    + I EN  +   +    A D D SD ++L +  G++ + E +  F I+ + G + V   +DY+                +   YL+PI+VTD    AET L V V N NDN P ISI   +    S     + E+    T +A+++ +D D  +       +   +           V          + ++ +KPLD ET       I C D G P   T + + +++ D ND  P F  A+    I EG+PV + + K++ASD D G  +++ YR       +D+ +   +DE +G +R+ ++FD+E            D  +   +    +V ++TT + V+I+DINDC P F+   YEF+I EG   ++ VG V A D D +  N ++ Y   I   ET S +  +     F+++P G ++T    +DRE   + +FS+ A DSG         V+++IED+NDN PQW +        SINI+   TVG +V  L+A+D D G+N  + YEII+GN  + F L+  SG+LYL K    N+          P    L +K +D G  P +NT+++RI   S +   P +S+                         + ++DL++MI MI +TL+VS +L++AIVLL+C+  +
Sbjct:    6 ITSIATFTVTLLLLHAAFTDAQKTSVAFVINEELPIGERVGSLTEKLAL---DITSRSEVNFVPLIDLRLVNFNRTSGLITVRQRIDRESLCKETGACCPGRSVIPPPVSTFHDVLLPHLSDVQYPRCAIKMLVMDQRPQTPLSQQSQEHLLIQVVIYVNDLNDNPPAWSPDRLELEIPEHTVIGRKFQLPEAADPDEGPENTVQSYRLIPSDPHDHESTVRGLASDAFKLSSELIERSPGAPYKFALGLKVEADLDREKQSAYYFLLIATDGGSPQLTGSLSVIIRITDINDQTPYFRQTNPSVEILENTAVGTQIYTAVAMDDDPSDANRLEYRMGSTASAEVQRLFSIDSRIGSVVVSGDIDYESAPILPNRDSKDPLFSDDYGYLIPIEVTDQAHIAETKLRVHVLNTNDNPPTISIQSPLQRSISKGEFYIHEDAPVGTLVATITMSDADEKTGSERGFPNRASIPYCSTTNTFFTVQPLHSAMRNLFKLVTSKPLDHETKSTHGVMIVCHDAGQPVLSTKQYLTVRLEDVNDSPPVFEKAVYYARISEGLPVHTPILKIHASDADSGEAAEVRYRFVSSGRQMDYDSMVLLDEKSGQIRSGAVFDQESIKSINFTVEAVDCASGNGTSCGGRVNTATTEVIVLIEDINDCPPEFEHQSYEFTIEEGHVSKVPVGKVHATDRDADGKNNRVRYQ--INDEETSSLLEGIQPSRLFTITPTGELYTNSVPIDREQIPLLTFSVVAMDSGEPPLSAFATVIIRIEDVNDNGPQWVYPPPGPQAASINISAYSTVGMVVARLEAIDLDIGVNGQIEYEIIRGNSQKYFDLDHLSGTLYLTKALEVNNGNNSMNEQAAPSSFALSLKATDGGDPPRSNTSLLRIIVQS-IEAFPLDSQSADLVGTGGKNQHFSSNSYFKQQSGYVDRDLLIMIVMIIITLLVSVLLIMAIVLLRCRQIH 959          
BLAST of Protocadherin vs. TrEMBL
Match: A0A068Y9F6 (Protocadherin 9 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000878500 PE=4 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 6.728e-101
Identity = 283/962 (29.42%), Postives = 458/962 (47.61%), Query Frame = 3
Query:  192 LANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSL--VNGKLFVKADIDRERICTKKNQCC-----------------------------CLNLFVIVYN----LKIQSN---YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRY------------TLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYD---------------QEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNS--SNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTK--------YTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYR-------IDH-AHFSIDENTGVLRTNSIFDRE--KTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKL----YFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSH--SSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSND----------PEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLP-------------------------AESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCY 2699
            + +++ F + L+++      A+  S+ F + E   IG  +G L E   +   D++ R  +NF  + +   V+    +G + V+  IDRE +C +   CC                              + + V+       L  QS      ++ I + D+ND+ P W+  ++ + IPEH+ IG ++ LP A D D  P+N++  Y            T+  + +   KL S +    P   Y   L L+V+A++DREK      LL+A D GSP LTGS  + I ITDIND +P F +    + I EN  +  ++    A D D SD ++L +  G++ + E +  F I+ + G + V   +DY+                +   YL+PI+VTD    AET L V V N NDN P ISI   +    S     + E+    T +A+++ +D D  +       +   +           V          + ++ +K LD ET       I C D G P   T + + +++ D ND  P F  A+    I EG+PV + + K++ASD D G  +++ YR       +D+ +   +DE +G +R+ ++FDRE  K+  + +EA      N +      +V ++TT + V+I+DINDC P F+   YEF I EG   ++ VG V A D D +  N ++ Y   I   ET S +  +     F+++P G ++T    +DRE   + +FS+ A DSG         V+++IED+NDN PQW +        SINI+   TVG +V  L+A+D D G+N  + YEII+GN  + F L+  SG+LYL K    N+          P    L +K +D G  P +NT+++RI   S +   P                          +S + ++DL++MI MI +TL+VS +L++AIVLL+C+  +
Sbjct:    6 ITSIATFTVTLLLLHAACTDAQKTSVAFVINEELPIGERVGSLTEKLAL---DITSRSEVNFVPLTDLRLVNFNRTSGLITVRQRIDRESLCKETGACCPGRSVIPPPVSTFHDVLLPHLSDVQYPRCAIKMLVMDQRPQTPLSQQSQEHLLIQVVIYVNDLNDNPPAWSPDRLELEIPEHTVIGRKFQLPEAADPDEGPENTVQSYRLIPSDPHDHESTVHGLASDAFKLSSELIERSPGAPYKFALGLKVEADLDREKQPAYYFLLIATDGGSPQLTGSLSVIIRITDINDQTPYFRQTNPSVEILENTAVGTHIYTAVAMDDDPSDANRLAYRMGSTASAEVQRLFSIDSRIGSVVVSGDIDYESAPILPNRDSKDPLFSDDYGYLIPIEVTDQAHIAETKLRVHVLNTNDNPPTISIQSPLQRSVSKGEFYIREDAPVGTLVATITMSDADEKTGSERGFPNRASIPYCSTTNTFFTVQPLHSAMRNLFKLVTSKSLDHETKSTHGVMIVCHDAGQPVLSTKQYLTVRLEDVNDSPPVFEKAVYYARISEGLPVHTPILKIHASDADSGEVAEVRYRFVSNGRQMDYDSMVLLDEKSGQIRSGAVFDRESIKSINFTVEAVDCASGNRISCG--GRVNTATTEVIVLIEDINDCPPEFEHQSYEFIIEEGHVSKVPVGKVHATDRDADGKNNRVRYQ--INDEETSSLLEGIQPSRLFTITPTGELYTNSVPIDREQIPLLTFSVVAMDSGEPPLSAFATVIIRIEDVNDNGPQWVYPPPGPQAASINISAYSTVGMVVARLEAIDLDIGVNGQIEYEIIRGNSQKYFDLDHLSGTLYLTKALEVNNGNNSMNEQAAPSSFALSLKATDGGDPPRSNTSLLRIIVQS-IEAFPLDIQSPDLVSTSGKNQHFSSNSYFKQQSGYVDRDLLIMIVMIIITLLVSVLLIMAIVLLRCRQIH 959          
BLAST of Protocadherin vs. TrEMBL
Match: A0A1I8IPY5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 6.194e-95
Identity = 247/798 (30.95%), Postives = 397/798 (49.75%), Query Frame = 3
Query:  420 KLFVKADIDRERICTKKNQCC-----C-LNLFVIVYNLKIQSNYFEI---QISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYN-SLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPP-LTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLL----VEENIQDETAIASLSATDMDNXXXXXXXX------XXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGV-PVESFV-TKLNASDCDVGVNSQLVYRIDHA---HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHE----LFKLNQKSGSLYLMKQ--PLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAES---------RFFEKDLVVMICMITVTLIVSGILVVAIVLLKCK 2690
            K F K+ IDRE +C++   CC     C L+L +IV++        EI    + + D+ND++P W   ++ + +PEHS +GSR+ LP+A D D +P+N+  RY L     S L  F + Y  + P       L L + A++DRE     +  L+A D G P  LTGS  + I+++DINDN P F +    + + EN+ + + L ++ A D D SD ++L F  G S +      F ++ + G ++  + LDY +E  +Y +P+ VTD    A+  + ++V NENDN P I+++               + EN    T +ASL   D D+    +S A      +  G L L +     S    + ++  +  DRE    F   I C D+G P +V + ++ I + D+ND TP F      V + E   P+ +FV  K+ A D D G N++L Y +D A   HF ID  T  +     FDRE   ++ L     D  +L D +   +  + T ++   I+D+NDC P F    Y F++ E +    Y+G+V A D D E  +R++ Y M+  P    S ++  YF V+ DGR++T  + +DRE  +  +F + A D      R +  V V I D+NDN PQW   S     +N++ ++ +GR V  L+  D D G N S+ Y +     H+    LF +  + G + L  Q  P  +  + +RL +  +D G  P ++   + I     V + P E          R  + +L +++ M+ VT+IVS  L+ AIV L+C+
Sbjct:  235 KCFQKSKIDRESLCSEVGACCPEAPDCKLSLSIIVFDKSQPGKVREIVRLDLRVVDLNDNAPRWNSPRLSLEVPEHSPVGSRFQLPVAMDPDKAPENATQRYELV----SGLDKFQLGYLLADPAGRQAGSLWLEIRADLDREVAAWHQAELVAVDGGHPAALTGSLTVNISVSDINDNPPRFGRFPRLVKVAENSPLSRELLRLNATDADDSDMERLRFRLGVSASQSVAEMFRVDKRTGSVWAMRTLDY-EERKSYDIPVTVTDGKHSADASVRIEVVNENDNPPKITLVSFGGGGGGSSSGNFELAENAAFGTTVASLDVFDADDKEESLSVACYVEPPTEFGILPLYK-----SAKRNFLVVSNRAFDREQTPSFTVRISCNDNGTPNRVDSVVMRIDIRDENDNTPEFLQNPLFVLLPENKDPLPAFVLAKMEARDADSGDNAELRYSLDAASSRHFDIDRGTAAIWARRSFDRELEQQFNLTVFATDLGDLPDVEGRRRTATGTVVVN--IEDVNDCPPEFSASHYAFAVEENAELTRYLGNVTASDCDAEERHRRVVYRMLGGPSGPDSQLAFNYFRVTQDGRVYTGSQPIDREFRESFTFLVLADDQA--GRRQTAHVTVSILDINDNSPQWVFPSSDTQQVNVSVQQPIGRPVARLRTKDPDYGPNGSVVYSL---ESHQPPTRLFSVTPE-GEILLSGQINPARDLGQFVRLRIVAADRGQPPRSSWANLTIRI---VERAPDEGGGGFFGSSPRTADGNLAIILAMVVVTVIVSIFLIAAIVFLRCR 1011          
BLAST of Protocadherin vs. TrEMBL
Match: A0A267DUI6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021969g1 PE=4 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 7.238e-92
Identity = 268/892 (30.04%), Postives = 437/892 (48.99%), Query Frame = 3
Query:  210 FIIFLIVVDFPMKMAKSIS---LQFQVKEHSEIGLLIGDL-----VENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCC------C-LNLFVIVYNLKIQSNYFE----IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVI---SILPHVNSS-----NNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVT-KYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTK----LNASDCDVGVNSQLVYRID----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLY-FSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSN-DPEIIR-LVVKVSDSG-PSPLTNTTIVRIYFHSEVSK--LPAESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRNLPGITYQSKEYRHGHPDG 2759
            ++ +L V    +++A S +   L+    E    G  + DL     ++  R  D +L R E     + ++  FV    G++F KA IDRE +C +   CC      C L + + + +       F+    + + + D+ND++P WT   +++ I EH+ +GS++ LP A D D +PDN+   Y L     S   LF +V    PD      LLL V  ++DRE      +++ A D G  PLTGS  + +++TDINDN P F      +SI EN  +++ L ++ A D D SD + L + F  S +      F ++ ++G I   + LDY+ +   Y +P+ V+D     ET + V++ N NDN P I   SILP    S     ++ L + EN    T IAS+   D D+ +   +        +L  +L        ++ I+   P DRE     QAT+ C D+G P +  +    I+V+D+ND  P F   I    + E    E+ +TK    + A D D GVN+ + Y +D    HA F ID  TG +     FDREK  +  +  TV+  +++ DS  TE   ++T  + V I+D+NDC PVF++  Y F++ E    R +VG V A D D E  +R I Y ++ +P +     S+L+ F VSPDG ++T+ ++LDRE    HS+S+            +  + + + DLNDN P+W +       +NI+  ++VG  V  L A D D G N ++ Y ++    ++   +  ++G L L +  + N D  ++  LV    D G P  L +   + I+   +          +  E +L++++ M+ +TL+VS +L+ AI  L+C  C R        S E ++G   G
Sbjct:   12 YLAWLFVCSLFIELAASQTSFFLRHSFVEEQPSGAKLADLRHLLQLQGGRRGDANLDRCEFQPLDIREKYFFVDSKTGEIFAKARIDRESLCEEAVTCCKGINPDCKLPMTIGMVDPTRSGPAFQEILQVDLDVLDLNDNAPRWTSPTLLLEISEHTLVGSKFKLPPADDPDKAPDNTTQIYRLA----SGTDLFRVVPVFSPDPAVSVVLLLEVLVDLDRETKPFHTIVIHAVDGGPVPLTGSVTVNVSLTDINDNPPFFTHESRTVSIPENYPLEKELFRVTASDRDASDIENLHYRFSLSASKAVLDDFRVDRRSGSIVAVRPLDYESK-REYSIPVTVSDGKHLVETTIEVRLLNINDNPPTITVKSILPEQQPSASGAQSSDLFIRENAPIGTLIASVDVKDADDKAMQETVTCFIEPSRLFGMLPLYEAARHQFKIVSNVPFDRELKSMHQATVTCHDNGSPNRDASVQNRIRVIDENDHPPTFRERIVEAQLHEN--AETSMTKPVIRMEAGDKDEGVNAAIRYSLDTQSEHA-FYIDTLTGAIYPKFSFDREKISQVNI--TVF-AKDMGDSSDTELQFTATGTVVVNIQDVNDCDPVFQQRHYSFAVVENVPNRTFVGKVRATDCDAEERHRSIVYRLIRQPGDP----SQLFPFEVSPDGSVYTSTDNLDREA--RHSYSLRVLADDQADRSDTATMSIAVLDLNDNAPRWVYPGGTAPRVNISMHKSVGDTVYKLHASDPDEGNNGTVVYSLVSVQPYDSLFVVSRAGDLTLGRSIVFNRDVNLLHNLVFNACDQGSPRQLFSVKSMSIFITEQAPNNYGLGSPKTSEGNLIIIVAMVVITLVVSIVLIAAIFFLRCNFCDRRT-----HSTERQNGRVKG 881          
BLAST of Protocadherin vs. TrEMBL
Match: A0A564YH37 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5814 PE=4 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 2.157e-90
Identity = 283/963 (29.39%), Postives = 457/963 (47.46%), Query Frame = 3
Query:  255 KSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSL--VNGKLFVKADIDRERICTKKNQCC-----------------------CLNLFVIVY---NLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTL-------------KYVNNSQLKLFSIVY--NSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSP-PL----TGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYD----------------------QEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNV--LLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVT----------KYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHF-SIDENTGVLRTNSIFDREKTGEYKLEATVYD------RRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKS----------HISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQW---SHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLS---------ND-------------PEIIRLVVKVSDSGPSPLTNTTIVRI---------YFHSEVSKLPAESR-------------FFEKDLVVMICMITVTLIVSGILVVAIVLLKCKH 2693
            + IS+ F + E    G LIG L+E    +   LS   ++ F  + +  ++ L   +G+LFV++ IDRE +C +   CC                        L+L VI         Q     I  +I DIND+ P W+   + I IPEHS IG+   LP A D D   +++  RY L             +  N + + + SI    +S      LN L L++++++DRE+ ++  LLL+A D GS  P+    TG+ ++ + +TDIND +P F +    I I E+      +  M AKD D SD  +L + F +  + E    F I  K G I + Q LDY+                      +EV  Y++P++VTD   F++  L V+++N NDNAP I++  H+    N   LL+ E++   T IA+++  D D         +  GG   S+  T     T          +Y ++ ++PLDRET      TI C D G P       + I + D ND  P F   +    I E +P  + + K+ A+D D+G+N+ + Y I    D      +D  +G + + ++FDREK           D       ++ +++  +    +S ++I ++I+D+NDC P F +  YEF + EG  P+  VGSV A DSD +  N +I Y++       +S          + +   F+++ +G I+T    +DRE   + SF++ A D G  +     +VV++++D+ND+ P W     SS + +  N++   TVGR +  LKA+D+DSG N  + Y II+GNE E F L++ SG+LYL KQ +S         N+             P+   L +K SD G +P +NTTI++I            S+ ++    SR               ++DL+++  MI V LI+S +L+ AIV L+C+ 
Sbjct:   28 QGISVIFPLAEEQPPGTLIGSLIEKLGPK---LSSPSSVLFTPLGQERYIRLNQTSGQLFVRSRIDREALCEQVGTCCTSSSKSQNAFSHAFENDDPNPDCALHLLVIDQRDPGSSTQPKLVHIIFNIVDINDNPPKWSPDTLEIEIPEHSPIGTTIQLPEATDPDQCIESAPIRYELIPQIESTSGFSNHESRNIADMFMLSITPTDSSFGASQKLN-LQLKINSDLDRERRDQYRLLLIATDGGSKNPVFGDRTGTLNIIVKVTDINDQAPYFPEEHPTIEISEDVEPRTRIFTMIAKDDDPSDATRLVYRFASMASGEVMRLFSICEKTGTITLNQELDYEVAPLLPDSRSSNSLYNSQGDKAKEVG-YIIPVRVTDGVHFSQAELRVRLKNVNDNAPNITVQSHLPRWRNTNDLLLSEDVAVGTMIATITMEDADERWMDNKLGTG-GGYSESQCETAHPFFTVQPLYPTARYQYMLVTSRPLDRETKSTHTITIACHDSGQPVLSRGVHVVIHLEDLNDSPPVFSQVLYQSKISENLPFNTLIEKVQATDSDIGLNAAIRYGIKSDVDLGDLVKLDPMSGQIYSATVFDREKMESINFTVIAMDCAGGAMNKSEINNGCSIIHTASASVI-IMIEDVNDCVPEFDQNNYEFVVKEGQRPQQSVGSVHATDSDADIKNSRIQYSISESEELQQSDHPGSVNNEGYRASSLFAITSNGEIYTRNLPIDREKTPVLSFTVIASDFGHPSLSAFANVVIRVQDVNDHSPVWIFPQSSSSIIVRANMSSHATVGREIAHLKAIDADSGPNGEIEYTIIKGNEQEFFALDKASGTLYLAKQLISIPKHPSADQNETAPTNLQNQDELTPQSFTLALKASDKGITPRSNTTILKIDVIQNQRGDRTTSQYNQYKGTSRHTGNLISRSGFGMIGDRDLMIITAMIVVALIISFVLIAAIVFLRCRQ 983          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 252.677 bits (644), Expect = 1.520e-68
Identity = 248/872 (28.44%), Postives = 408/872 (46.79%), Query Frame = 3
Query:  213 IIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLV-----NGKLFVKAD-IDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS-------------KLPAESRFFEKDL--------VVMICMITVTLIVSGILVVAI-VLLKCKHCYRN 2705
            +I   +V       K  +++ +  E+  IG L  DL  N    D ++     L F+ + +   V LV      G++F  A+ IDRER+C+     + C   + V V   +I     +I+  IEDIND++P++  + I I+IPE++ I +RY +P A D D    N I  Y L  V   +  L  I     P+     QL+  V  N+DRE  +   + +  ED G+PP + +  L + ++D+NDN PVF     E+++ EN  +   + Q+ A D D+  N ++ FSF N ++   +  F I+   G I VKQ LD +      L+ +    S   +   ++V V + NDN P I     +N  N  +L+ EN    T IA ++ TD D          +   +  +L  V  D     ++ +    PLD ET   +   I   D G PP  T+ ++ I++ D+ND  P FP     + I E     + + K+ A+D D G N+ ++Y +       F+ID  +G+L  +   DREK  +Y    TV  R N   S+P    L S   +++I++D ND +P F    Y F +PE       VG +   D+D  A +  I    +I          K  F + P   +     + DRE    ++F ++A DSG I       V + + D+NDN      P  ++S DL     +      G +VT + A+D+D+G+N+ L Y II G+   LF +++ +G++ L ++  + D  + RLVVKV D G P  L +  +V ++ +  VS             + P +    + D+        +V+I +I  T+ V  ILV+ +  L++C+   R+
Sbjct:   12 LILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNL---DPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEI-FRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVG-INGIQHYELVKVGALEFGLDII---ETPEGDKWPQLI--VQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFND-----QFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSF--TVIARDN--GSNP----LQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDAD--AGDNAIVTLSIIN--------GKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL-----VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTV--ILVIFVTALVRCRQTPRH 843          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 251.136 bits (640), Expect = 2.207e-68
Identity = 246/871 (28.24%), Postives = 407/871 (46.73%), Query Frame = 3
Query:  213 IIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLV-----NGKLFVKAD-IDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTL-KYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS-------------KLPAESRFFEKDLVVMI--CMITVTLIVSGILVVAIV-----LLKCKHCYRN 2705
            +I   +V       K  +++ +  E+  IG L  DL  N    D ++     L F+ + +   V LV      G++F  A+ IDRER+C+     + C   + V V   +I     +I+  IEDIND++P++  + I I+IPE++ I +RY +P A D D    N I  Y L K V+   L +        P+     QL+  V  N+DRE  +   + +  ED G+PP + +  L + ++D+NDN PVF     E+++ EN  +   + Q+ A D D+  N ++ FSF N ++   +  F I+   G I VKQ LD +      L+ +    S   +   ++V V + NDN P I     +N  N  +L+ EN    T IA ++ TD D          +   +  +L  V  D     ++ +    PLD ET   +   I   D G PP  T+ ++ I++ D+ND  P FP     + I E     + + K+ A+D D G N+ ++Y +       F+ID  +G+L  +   DREK  +Y    TV  R N   S+P    L S   +++I++D ND +P F    Y F +PE       VG +   D+D  A +  I    +I          K  F + P   +     + DRE    ++F ++A DSG I       V + + D+NDN      P  ++S DL     +      G +VT + A+D+D+G+N+ L Y II G+   LF +++ +G++ L ++  + D  + RLVVKV D G P  L +  +V ++ +  VS             + P +    + D++      +I V  I++G + V +V     L++C+   R+
Sbjct:   52 LILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNL---DPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEI-FRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIET-----PEGDKWPQLI--VQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFND-----QFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSF--TVIARDN--GSNP----LQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDAD--AGDNAIVTLSIIN--------GKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL-----VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTVILVIFVTALVRCRQTPRH 882          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 251.521 bits (641), Expect = 4.587e-68
Identity = 248/873 (28.41%), Postives = 409/873 (46.85%), Query Frame = 3
Query:  213 IIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLV-----NGKLFVKAD-IDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTL-KYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS-------------KLPAESRFFEKDL--------VVMICMITVTLIVSGILVVAI-VLLKCKHCYRN 2705
            +I   +V       K  +++ +  E+  IG L  DL  N    D ++     L F+ + +   V LV      G++F  A+ IDRER+C+     + C   + V V   +I     +I+  IEDIND++P++  + I I+IPE++ I +RY +P A D D    N I  Y L K V+   L +        P+     QL+  V  N+DRE  +   + +  ED G+PP + +  L + ++D+NDN PVF     E+++ EN  +   + Q+ A D D+  N ++ FSF N ++   +  F I+   G I VKQ LD +      L+ +    S   +   ++V V + NDN P I     +N  N  +L+ EN    T IA ++ TD D          +   +  +L  V  D     ++ +    PLD ET   +   I   D G PP  T+ ++ I++ D+ND  P FP     + I E     + + K+ A+D D G N+ ++Y +       F+ID  +G+L  +   DREK  +Y    TV  R N   S+P    L S   +++I++D ND +P F    Y F +PE       VG +   D+D  A +  I    +I          K  F + P   +     + DRE    ++F ++A DSG I       V + + D+NDN      P  ++S DL     +      G +VT + A+D+D+G+N+ L Y II G+   LF +++ +G++ L ++  + D  + RLVVKV D G P  L +  +V ++ +  VS             + P +    + D+        +V+I +I  T+ V  ILV+ +  L++C+   R+
Sbjct:   52 LILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNL---DPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEI-FRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIET-----PEGDKWPQLI--VQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFND-----QFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSF--TVIARDN--GSNP----LQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDAD--AGDNAIVTLSIIN--------GKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL-----VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTV--ILVIFVTALVRCRQTPRH 882          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: ENSAMXT00000036470.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10716691:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000036470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 240.736 bits (613), Expect = 2.352e-65
Identity = 249/913 (27.27%), Postives = 434/913 (47.54%), Query Frame = 3
Query:  201 LSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMM--KENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYN-LKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNG-------KIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILL---VKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXX--XXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH-FSID---ENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG--PITHRVSVDVVVKIEDLNDN----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKL-PA-------ESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRNLPGITYQSKEYRHGHPDGQSSPTAS----DMFSSAVKLSSDVPLY 2828
            L  F++ ++ +   +    S  + + V E  + G ++G++ ++  I   DL  R    F+++  +++  VSL  G LFV   IDRE +C+   +C  +++  +  N LK+    F I++ I DIND++P++  SK ++NI E S +G ++ LPLA+D D+   N++  Y L     S  + FS+   +  D   +  +L +    +DRE    I L+L A D G PPL+G+T + I I D+NDNSPVF + L ++ +KEN      +  + A DLD   N ++T++      +     F +N ++G       ++ +++ LD +++    L+ +   D  +   +  L   + V + NDN P  S   +  S      V EN    T +  L+ATD+D            S G  K + +    S+  + T+    PLDRE    F+   + QD G  P+ +   + I+VLD ND  P       T  + E     + V  +  +D D+G N ++  ++     F++    +N   L  N   DRE   +Y +         ++ +D     LSS+ ++ V I D+ND AP F  +   F + E S     + +V A+D D+   N QI Y+++ +     S +S +   ++P      +K+S + E      F ++A DSG  P++  V+V+V   I D NDN     P +S +  L    NI      G  V  ++A+D+DSG N+ L+Y I +   + LF++   SG +   ++   ND +   LV+ V D G   L+ T  V +     +  + P+       E  F   +L ++I +++V++    I +++++ L    CYR+    +  S      HPDG  S + S    D+  S+  L SDV ++
Sbjct:    8 LMDFVVIVLFLPLLLWNLSSGQIVYSVSEEVKAGTVVGNVAKDLNINVQDLEARM---FRIVSSRKSFDVSLKTGALFVTDRIDREALCSTIKKCS-MHIEAMAQNPLKL----FRIEVHIMDINDNAPLFPVSKQILNITELSAVGEKFTLPLAEDPDTG-SNAVKNYKL-----SPNEYFSLNVQNGEDSGSVELVLQKA---LDRETQSVIHLILTAIDGGKPPLSGTTEIAILILDVNDNSPVFSQSLYKVKVKENAAFGTKVLSLSATDLDEGLNSEITYAIIRQGTLSANEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLI-LTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVS------VLENTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKEKWADIFAINSITGEITV--KGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQASYKNYYSLVVNGPLDREDMPQYSV--------TILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNE-NAQIVYSLINRKNMDSSWMSMV--DINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVF--IVDENDNRPVILPPYSEAGSLNTE-NIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPKGNNLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSATVSVDVVVAESMDSVRPSLREVQIKEDNFSNLNLYLLIAIVSVSV----IFLLSLIALIAAKCYRSDDPFSRCSPPVVTTHPDGSWSYSKSTQQYDVCFSSDTLKSDVVVF 876          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 228.024 bits (580), Expect = 7.056e-61
Identity = 212/815 (26.01%), Postives = 390/815 (47.85%), Query Frame = 3
Query:  210 FIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLS--RRENLNFQMMK---ENNFVSLVN--GKLFVKAD-IDRERIC---TKKNQCCCLNLFVIVYNLKIQSNYF---EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTK------YTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI--DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN-----FPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS 2570
            +++  +V    +  A +  L + ++E  +  +LIG++ ++  I   + +     NL ++++    +N  + +++  G++F  ++ IDRE++C   + ++  C   + V++    + ++YF   +I+I ++D ND++P++    I I+IPE++ I SR+ +P A D D  P NS+ +Y L  VN        IV    P+     QL+  V  N+DRE+ +   + +  ED GSP  + +  L + +TD+NDN PVF +   E+ I E++ +   + Q+ A D D+  N ++ + FG  ++   R  F +N   G I V++ LD ++  N  L  +    S+  A   + + V + NDNAP I +   ++ +N  +L+ E     T IA ++ +D D         +   G  +  +  D+    K      Y +  +  LD E  + +   I   D G P    T ++ +++ D+ND  P F   +  + + E    + ++T + A+D D G N+++VY++  + + F +D  TGVL  + +FDRE    +    T  D           + L S   + V I D ND +P F    ++F + E       VG +   D+D  A    +    ++   E         F + P   +  +  S DRE    ++F + A DSG      +  V + + D+NDN     +P  + S  L     +      G +V  + A+D D+G+N+ L Y I+ GN   LF+++  +G++ L ++P   D  + RLVV +SD G P  L    +V +Y ++ V 
Sbjct:    7 YLLATLVACLWLDPAIAQELIYPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVI----LPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGP-NSVYKYEL--VNGQSAFGLDIV--ETPEGEKWPQLI--VQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKD---------TDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGT--------RALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD--AGENAVVSLSILNDNEN--------FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKL-----VPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVLVFLYVNNTVG 778          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 5.520e-56
Identity = 228/819 (27.84%), Postives = 369/819 (45.05%), Query Frame = 3
Query:  264 SLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNF--VSLVNGKLFVKADIDRERICTKKNQCCCLNLFV----IVYNLKIQSN----YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKL--FSIVYNSLPDKTYL----------NQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTE-ISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSM-NIEDRSKFYINGKNGKIFVKQILDYDQE-VNTYLLPIQVTDSTKF---AETILLVKVQNENDNAPVISILPHVNS--SNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLS-RVLTDLSVVTKYTILL--TKPLDRETNEFFQATIKCQDDGYPPQVTTKIIN--IQVLDKNDCTPHF--PA------AITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH--------FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKL------FYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFP---------QWSHSSDLGLSINITREETVGRLVTV-LKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPS 2519
            +L ++V E   +G +IGDL ++  +         +++   +   +   V+ ++G+L V   +DRE +C ++   C    F+    +    K Q +      ++Q+ + DINDH+P +    + ++I E   +G R  LP A D D+   NSI  Y +   +   L+L  FS+V +   D              ++ LL +   +DRE +   ELLL  ED G+P L+GS  LTI + D NDN+PVF+ P T  + I E++ +   + Q+ A D D   N  + +SF   + ++  ++  +++G  G + V+     D+E +  + L +   D  +    A   + V++ ++NDNAPV  ++        +  + + EN+   T +  +S +D D  S+          ++L      +L+   K   LL  T+ LD E  + +  ++   D G P    +K++N  I V+D ND TP F  PA      A+  V + E  P  + V  L A+D D G N  + + +            FS++  TG L   +  DREK   Y+L     D        P  K   +  I+RV + D ND AP F  +       Y+F + E +S   YVG+V   D D E  N +++  +V      ++    +  +    G +  T   LDRE    +  S+ A DSG      S  V + + D NDN P          W H         +      G LV V + A D D+G N    YEII GN   +F LN  SG+L L +   S D  + RLVV+V D G S
Sbjct:   28 ALLYEVDEEVLVGYVIGDLRQSNLLCVCFFPPAPHVSPLPLHTPSLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAG-TNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVD------VRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPK--LSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACD-----GGSPQRK---ARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLD-EGDNARVALNLV-----REAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKH---------VRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGS 814          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 202.986 bits (515), Expect = 1.161e-53
Identity = 206/778 (26.48%), Postives = 353/778 (45.37%), Query Frame = 3
Query:  252 AKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMM---KENNFVSLVN-----GKLFVKA-DIDRERICTKKNQCCCLNLFVIVYNLKIQSNYF----EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF-----GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD---STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG 2513
            A+   + ++V E    G  IG+   + R+ D++L     L +++M    E+    LV      G+LF     +DRE +C  ++     ++ V V  L +Q   F    E++I++EDIND++P +    + +++PE++  G R+ +  A D DS   N + RY L   + + +  F +      +   +  L++R   ++DRE+ +  E+ L A D GSPP +GS  L IN+TD NDNSPVF +    + I EN+ +  ++ Q+ A D D   N ++ +       G       +  F ++  +G + V  +L+  +E   Y + I  TD       A   + V V + NDN+P I I   V   N V+ + E       +A ++ +D D      +        ++   L  L+   +Y +   + LD ET   +   IK  D G      T  + I++LD ND  P F      V + E   +   +  ++A+D D+  N+++VY +       F +D  TG++      DREK   Y           ++  D    VL     + V + D+ND  P F    ++F + E       VG V   DSD E  N ++  +++          ++  FS+ P+  +  +    DRE    +   ++A D G      +V VV+ + D+NDN P             +      G +VT + A+D+D+ +N+ L Y I+ GN H LF ++   G++ LM+        + RLVV+VSD G
Sbjct:   34 AEEFKVSYRVAEELREGAFIGNPSVDLRLADYNLE----LTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEA-NGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVR--KSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNR-EESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPD-IGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSF--------TILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSD-EGENGRVRLSIL-------GTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 56.225 bits (134), Expect = 3.806e-8
Identity = 58/224 (25.89%), Postives = 98/224 (43.75%), Query Frame = 3
Query: 1878 IRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGR---IFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNE--------HELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGP 2516
            +R+ ++DIND AP F       S+PE +          A D D EA N    Y ++     T S   +L  + + +G        ++SLDRE   ++  ++ A D G   H  S  + + + D NDN P +  +    +++ I     VG  V  L A D D+G N+ + Y +               LF+L+Q SG + +       +  + R+++  +D GP
Sbjct:  139 VRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEA-NGVRRYELLPSDPATVSAF-ELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAE---VNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGP 357          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 176.022 bits (445), Expect = 2.675e-45
Identity = 174/679 (25.63%), Postives = 307/679 (45.21%), Query Frame = 3
Query:  258 SISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNF----VSLVNGKLFVKADIDRERICTKKNQC-------CCL--NLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT-YLLPIQVTD---STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXG--GLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA---------HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPV-----FKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLD--RETYDMHSFSIEAWDSG 2189
            +I++++ + E    G L+G L ++ + +   ++   + +F++M+ ++F    V   +G +  +  IDRE+ C +   C       C L   LF +V+           ++ + DINDH+P + +S++ + I E   +G+R  L  A+DLD    N++  Y L      + + F +   +  D     +L+  V + +DRE+  +  L L A D G PP +G+T + I + D NDNSPVF +    ++++E+      L  + A D+D   N ++ +SF + ++ E R  F ++ K GK+ +K  LD+  E+N+ Y + IQ  D   S+  A   +LV V++ NDNAP I +   + S  + + V E    E+ +  ++ +D+D++   +      G    KL      L     Y ++    LDRE    +   ++  D G PP+V  +   +++LD+ND  P F  +     + E     ++VT + A D D   N  + Y +  +         + SI+ ++G +      D E       +    D     D  P    L +   + V I D ND APV      +       +P  +     V  V A DSD EA N ++SY +V         I++L       G +FT   S+     +   HS  +   D G
Sbjct:   28 AITVKYALYEEQPAGTLVGRLSDDLQGR---VAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVH----------AEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVG-GNALRAYHLD-----ENERFGLALRARTDGAKYAELV--VKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDH--ELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKL------LPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARD-----DGVPP---LVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEA-NGELSYRIVQGNERNLFRINRL------GGEVFTNAASVTDAAASATRHSLVVMVRDRG 662          

HSP 2 Score: 157.147 bits (396), Expect = 2.630e-39
Identity = 175/620 (28.23%), Postives = 279/620 (45.00%), Query Frame = 3
Query:  888 HLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYING-KNGKIFVKQILDYDQEVNTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLS-RVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKI-INIQVLDKNDCTPH------FPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-DHAHFSI--DENTGVLRTNSIFDREKTGEY--KLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSH---SSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEII---RLVVKVSDSGPSPLTNTTI--VRIYFHSEVSKLPAESRFFEKD-LVVMICMITVTLIVSGILVVA 2669
            H  + + DIND++P F +    + I E+  +   +    A+DLD+  N    +    +       +   +G K  ++ VK  LD +QE   Y L +   D     +   T++ + V + NDN+PV +      +S NV  V E+    T + +L+ATD+D         S S  +    R L  L   T   + L   LD E N  ++ +I+ +D G P  +     + + V D ND  P         +   TV++ EG   ESFV  +  SD D   N  +   +  H HF +    +  V+ TNS  DRE+  +Y   LEA+        D     +V +    +R++  D ND  P F +  YE S+ E +SP  YV +V A D+D E  N  I+Y +V    E        Y S++P          LD E     +F ++A D G      +  V V+I D NDN P  +H    +  G+ + + R+  +G LVTV++A DSDS  N  L+Y I+QGNE  LF++N+  G ++     +++         LVV V D G   L+ T    +R+  H +      E++  +   L VM       L ++ +++VA
Sbjct:  121 HAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQE-GEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFA-----QTSCNVT-VREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTG-KLSLKGQLDHELNSEYEISIQARDMG-PSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEAS--------DGGTPPRVAARQFTVRLL--DENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEH-NGMIAYNVV--ESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGV-VRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGDDGADETQPLDASMLAVMALGAACALTLAAVVLVA 717          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 1.514e-40
Identity = 175/678 (25.81%), Postives = 295/678 (43.51%), Query Frame = 3
Query:  537 EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD---NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID--HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTE-KVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIY 2552
            ++ + + D+ND+ PV+   +   +I E+   G+      A D D   + ++ RY L   + ++ ++ ++             +  RV  ++DRE+    +L + A D G         +TI + D  D  P F +      + EN      +  + A  LD++ N       G+      R  F I    G+IF    +D +++   Y L +         E  + V V + N++APV        +S  V + E+   + +   S+ ATD D   N          +GG K   +  D  +  +Y       LDRET E +  T+   D G  P  ++  +N+ VLD ND  P F ++    +  E   V S V  + A+D D G N  + Y  +    +F +D  TG + +  +FDRE        A+     ++V +D    K L     ++V ++D+ND  P F K  Y+ S+ E +S    +  V A D D E +N  + YA+       K       F+V       T   SLDRE    ++  + A DSG      S  V V++ D NDN P+++ S    LS++      VG L+  L A D D+G +  + Y I+ GN H  F +++ +GS++L ++       + RL V   D G  P ++ TI+ ++
Sbjct:  539 KVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTV-RYQLTAGDAARFQVNAVT----------GAVSTRV--SLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQ-----RGSFSIEWSGGRIFTANAIDREEQA-FYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFD-----RASYEVSIAEDEPVN-SRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFG-IFPDGQLYVRYE------LDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASF--SFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVD-EGVNGALRYAINEGNEGGK-------FTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESL---LSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVH 1171          

HSP 2 Score: 152.91 bits (385), Expect = 1.384e-37
Identity = 197/744 (26.48%), Postives = 329/744 (44.22%), Query Frame = 3
Query:  423 LFVKADIDRERICTKKNQCCCLNLFVIVYNLKI----------QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD--STKFAETI-LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGG--LKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG--PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXY--EIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIR--------LVVKVSDSG-PSPLTNTTIVRIYFH 2558
            L V + +DRERI               +YNL I          +S    + + + D+NDH+P +  S     + E +  GS      A D DS   N+  RY++  V+ + L  FS+      D++     L+  D  +DRE    + L + A+D G+ P T  T LT+ + D+ND  P+F +     +  EN+    ++  + A D D+ +N  + ++F   M  + R  F ++   GK+   + LD  +E+  Y L +Q  D  S     T  + V V + NDN PV   + +  S      + EN    TA+ +++ATD D  +        + G   +        +V T+ +      LDRE    +Q  +   D G+    +  I+ I V D  D  P F     +  + E V   + V  ++AS  D  +N+ + Y I        FSI+ + G + T +  DRE+   Y+L                   ++    + V++ D+N+ APVF +  YE SI E         SV A D D    N ++        YE         F + PDG+++   E LDRET + +S ++ A D+G  P++  V+V+V V   D+NDN P ++ SS +    +   E+ VG LV  ++A D+D+G N  + Y  E  Q N    F+L+ ++G +  ++  + +   +IR          V  +D G P PL +   V+++  
Sbjct:  292 LKVASQLDRERIP--------------MYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGL-NAKLRYSI--VSGNDLGWFSV------DES---TGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDR-EELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFAS------ILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVS------LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVA-----------NSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKD-SGKNGEVK-------YEIGEGNGGEKFGIFPDGQLYVRYE-LDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVL--DVNDNKPLFNSSSYV---FHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN----FELDSETGRIASLR--VFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQ 963          

HSP 3 Score: 151.754 bits (382), Expect = 2.953e-37
Identity = 156/588 (26.53%), Postives = 262/588 (44.56%), Query Frame = 3
Query:  537 EIQISIEDINDHSPVWTQSKIV-INIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYV-NNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISIL---PHVNSSNNVLLVEENIQDETAIASLSATDMDN-XXXXXXXXXXXGGLKLSRVLTDLSVVTKYTIL-LTKPLDRETNEFFQATIKCQDDGYP-PQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFP 2255
            E+++ + D+ND++P + +  ++ +   E + +G +  L  A D D  P N ++ +  K V  N + +L  +    +  + +L+   L     +DRE      L + AED GSP   G   + + + D NDN P F KP    S+ E++ +   L     +DL       L   F              + K G +  +Q LD++     Y L ++  D            ++++ + NDN P I  +   P   S++    V+E+    T  A ++ TD D+ ++      S  GG +    +     V    +L +   LDRE    +  TI   D+G P  +  T  + + V D ND  P F  +     + EG P  S+V  + A D D G+N++L Y I    D   FS+DE+TG++ T+   DRE      L        N+   D   +  ++ T + V + D+ND  P+F +  Y  +  E S P ++V SV A DSD+   N  + Y     P +  +   +++   S  G++ TT +SLDRE  + +   ++A D G      +  V V + DLNDN P
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGP-NGVNHHAYKIVSGNEEGRL--VPPRPVTKRAFLH---LATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDLLHRGRGPLAVPF--------------DPKTGMVSTRQPLDFEAR-RQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSAS----VDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVL--------NISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDL-GENGTVRYNF--DP-DMPAQYREMFRLDSLTGKV-TTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHP 552          

HSP 4 Score: 144.05 bits (362), Expect = 8.107e-35
Identity = 169/683 (24.74%), Postives = 294/683 (43.05%), Query Frame = 3
Query:  333 RIQDFDLSRRENLNFQMMKENN---FVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSP-PLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVE--ENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH-----AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKK----LFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRET----YDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETV 2315
            R  D D  +   + +++ + N    F    +G+L+V+ ++DRE       +   L +  +   ++  S+   + +++ D+ND+ P++  S  V +  E  ++GS      A D D+  +  ++    K   N +L   +    SL  + +  + L+R      +         ++A D G P PL     + + + D+NDN P F K + + S+ E+      L ++ A D+D   N  L ++  N  N  +  KF ++   G+I +   LD  +E  +Y L +  TDS      A   + V+V +ENDN P  +         ++L V+  E+ +    + +L+A+D D   +     +   G   +    D S     ++ L + LD ET   ++  +  +D G PP+ +  I+ + V D ND  P F        I E +P+ + V  + A D D  VN +L Y I       AHF+ID  +G + T +  DRE TG    E TV   R    + P     S+   + V++ D ND AP F      L        GS     VG++ A D D EA N  + YA+           + + F +     I  T   LDRE+    + +   ++EA  + P T R    ++      N   P++    D    IN+ + +T+
Sbjct:  781 RATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRE-----TREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASL--RVFDREALIR------QGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAI-NEGN--EGGKFTVDASTGQITLLGSLDR-EETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFT--------ESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRST---GSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGL-FEVTV---RATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGS----VVGTLQASDPD-EAENAAVRYAVT-------GGDAAILFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQ--DYESPINLLQGQTI 1417          

HSP 5 Score: 138.658 bits (348), Expect = 3.354e-33
Identity = 156/584 (26.71%), Postives = 248/584 (42.47%), Query Frame = 3
Query:  867 PPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQD----ETAIASLSATDMDNX---------XXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPD---GRIFTTKESLDRETYDMHSFSIEAWDSG--PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEI-IRLVVKVSDSGPSPLTNTTIVRI 2549
            PP++    + I++ D+NDN PVF  P  E+ ++EN    + +  + A D D   N  +T+S  +         F ++  +G +   + LD  +E  +YLL ++ +D T   +  L V V++ NDN+P  S   H  S +   + E+   D       I ++ A D D+          +       + G   L  V   L+V        T+PLDRE+   +    +  D G      T  + + VLD ND  P          + E  P  + + +++A+D D GVN++L + I        F++  N G L      DRE+   Y L   V DR       P  + LSS   + +I+ D+ND AP F       + PE S     V +V A D D    N  + YA+     E            + +   G +   +E LDRE    ++ ++ A D G  P+T   ++ V V   D NDN P++           I  +E  G  V  L A D D G N  L Y+I  G+    F+L+   G+L + + PL  +      L V+  D G    ++T  VR+
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSG----SEGAFVVDAASGVLRASRRLDR-EERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSR--HAYSFD---VAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNV--------TRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVG-NDGQLSVARALDRERQSFYNLVVRVSDRAR----HPPAR-LSSAVRVSLILTDVNDNAPAFTSPRSALA-PEDSPVGAVVATVQAVDPD-SGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRE-LDREARQSYALTVLAVDKGRPPLTSTATLAVTVG--DANDNAPRFPRRE---YEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVAR-PLDRERTASYELAVRARDGGGPARSDTASVRV 2042          

HSP 6 Score: 136.732 bits (343), Expect = 1.386e-32
Identity = 167/665 (25.11%), Postives = 269/665 (40.45%), Query Frame = 3
Query:  267 LQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMK--ENNFV-SLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLP-----LAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQ------NENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTD-------LSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH----AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGS-SPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWD 2183
            ++ +V+E++  G +I  L       D D  +   + + ++   E  FV    +G L     +DRE   +         L  +  +    +    + +++ D ND+SP +++     ++ E +    +         LA D DS P   ++ Y L    +S        +   P    LN     V   +DRE      L   A D G   L  +  L +N+ D NDN+P          + E+      L ++ A D D   N +L FS  +S + E R   +  G +G++ V + LD +++ + Y L ++V+D  +     L   V+      + NDNAP  +       S    L  E+      +A++ A D D+        + +   +              L+ VT   + L + LDRE  + +  T+   D G PP  +T  + + V D ND  P FP       I E  P  + V +L+A D D G N +L Y I        F +D   G L      DRE+T  Y+L     D      SD        T  +RV + D+NDC+P F+   Y     E +  P + +  V+A D D+ + + Q++YA                FSVSPDG +   + SLDRE    H   I A D
Sbjct: 1521 MELEVEENTGEGEVIFTL----SATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASY--------LLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVT-YALAPSEDSDWA--DGAFGLHPVTGALN-----VTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSI-SSGDPEGR---FAVGNDGQLSVARALDRERQ-SFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-------SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTG-EVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSD--------TASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGS-SGQVTYAA-------AGGNDGGAFSVSPDGHVHLLR-SLDREAQPQHVLIITATD 2133          

HSP 7 Score: 122.479 bits (306), Expect = 3.016e-28
Identity = 147/607 (24.22%), Postives = 244/607 (40.20%), Query Frame = 3
Query:  525 SNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFID-----QYLCQMFAKDLDISDNDKLTFSFGNSMNIE-DRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETI-LLVKVQNENDNAPVISILPHVNSSNNVLLVE--ENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDG-YPPQVTTKIINIQVL--DKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-------------DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHS 2270
            S++ +++IS+ED+ND+ PV+   ++ + + E++  G   +   A D D    N++  Y++  ++ S+        + +          LR    +DRE+     L + A D           L++ + D NDNSP F +      + E+   D       +  + A D D     ++T++   S + +     F ++   G + V + LD +     Y+L  + TD    A T  L V V + NDNAP +         N+ L  E  E+    T++  +SATD D         S S G    R     +V     + + + LDRE   F+   ++  D   +PP   +  + + ++  D ND  P F  +  +    E  PV + V  + A D D G NS + Y +                 F+++  TG +R     DRE    Y L     D+            L+ST  + V + D ND AP F +  YE +I E   P   V  + A D D E  N ++ Y       +  S      F + P          LDRE    +  ++ A D G      +  V V + D+ND  P +  S
Sbjct: 1497 SSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQG-QNALVTYSV--LSGSEGAFVVDAASGV----------LRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRA-CYVLRARATDGGGLAATARLYVNVLDANDNAPSVQ--------NDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR----FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF-TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDK--------GRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPD-EGANGELRY-------DIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLS 2057          

HSP 8 Score: 91.6633 bits (226), Expect = 8.436e-19
Identity = 99/380 (26.05%), Postives = 156/380 (41.05%), Query Frame = 3
Query: 1464 PLDRETNEFFQATIKC------------QDDGY-----PPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI---DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSI-----PEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPI--THRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSP 2522
            PLD      F  T +C            +D+G      PP  +   + I V D ND  P F      + ++E       +  L+A+D D G N+ + Y +       F +D  +GVLR +   DRE+   Y L     D  +  D+            + V ++D ND +P F +  Y F +     P+G + R  +G+VLA D+D      +++YA+   P E  S  +   F + P          LDRE+   +     A D G +  T R+ V+V+    D NDN P   + S   L+  +  +   G  +  + A D D G+N+ L + I  G+    F +    G L + +           LVV+VSD    P
Sbjct: 1456 PLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDAR-----------LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFG-EVTYALA--PSE-DSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVL----DANDNAPSVQNDS---LAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHP 1812          

HSP 9 Score: 80.4925 bits (197), Expect = 1.995e-15
Identity = 100/384 (26.04%), Postives = 163/384 (42.45%), Query Frame = 3
Query: 1434 VTKYTIL---LTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF--PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSI--DENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFY-----EFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVV---KVSDSGPSPLTNTT 2537
            VTK   L    T PLDRE N  +   ++ +D G P +     +N+ V D ND  P F  PA   +V                A D  VG   + +        ++  D  TG++ T    D E   +Y L        +L  +D     LS      + + D+ND  P  + ++        S+ E ++P      V   D+D    N ++S ++V      + H   L+    P  R+      LDRE   M++ +I A D+G P+    +  +VV + D+ND+ P+++ S+    +  ++     G  V  + A+D+DSGLN+ L Y I+ GN+   F +++ +G   L+      D E+   VV      D G  P T  T
Sbjct:   80 VTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASV----------------AEDSPVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTL--------SLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGG--NERGHF-VLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSA---YAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTG---LVTTDGKVDREVASSVVLNISAQDQGAQPKTAYT 430          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 1.072e-37
Identity = 189/679 (27.84%), Postives = 305/679 (44.92%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDIS-DNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST-----KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRE-TNEFFQATIKC-----QDDGYPPQVTTKIINIQVL--DKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA----HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHR----VSVDVVVKIEDLNDNFPQWSHSS-DLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRL 2489
            Q     ++I++ D+ND++PV+ +   V    E+    +      A D DS P+N I+   L    ++    FSI  +       L + L     + ++     I L ++A D GSPPL  +    + + D NDNSP+F +    I+I EN      +  + A D D S +  +L+  +    ++E  ++F IN ++G I    +LD  + V+ Y+L ++  D       K     + + + + NDN P    LP+       + + EN    T I ++SA D D +       +        R+    S   + T L    LDRE  N    A+++       D G PP+  T    + VL  D ND  P F      + + EG+P  S + ++ A+D D G N  + Y +  A     F +D  TG++ T    DRE    Y+L         LV +D     LSSTT + +++ D+ND AP F       S+ E  +    V S+   D+D   +N ++S+ +     + +       FSV     +  T  SLDRET   +S  IEA D+GP   R     ++DV+V   D+NDN P +   S ++ +  N+TR    G ++  ++A D D G+N  + Y II GN+   F +N  SG +     PL  D E + L
Sbjct:  111 QETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILP--TSAYSSYFSITVSGGYGVVTLARAL-----DYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIY----SLEGSTQFRINARSGDITSTTLLDR-EAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYA------VTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRI-NAASGKIRTTGL---QLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLR--------LVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDAD-SGLNAELSFFITGGNQDGQ-------FSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVL--DVNDNRPLFLEGSYEVSVPENVTR----GAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPL--DRETVAL 743          

HSP 2 Score: 141.739 bits (356), Expect = 4.429e-34
Identity = 151/568 (26.58%), Postives = 250/568 (44.01%), Query Frame = 3
Query:  546 ISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFS----IVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFY-INGKNGKIFVKQILDYDQEVN----TYLLPIQVTDSTKF-------AETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKL--EATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWD 2183
            + + D ND+SP++ ++   I IPE+   G+      A D D SP+            ++Q ++ +    I   +L D+  ++Q +L V A +D                G+   TG   + I + D+NDN P +      ++I EN      +  + A D D+++N  L ++      I+  + FY IN  +GKI    +    +++N      +  I V+ + +        A   + V +Q+ NDN P    LP+       L V E +   + +  ++ATD D  +      S +  L   R    L   T     L + LDRE    +Q  +   D G P   +T  +++ VLD ND  P F  A + V + E V  +S V  LN +D D G+N++L + I        FS+    G++RT    DRE    Y L  EA        +D+ P     + TT + V++ D+ND  P+F +  YE S+PE  +    +  V A D D E IN ++ Y ++     + +       +VS  G I      LDRET  +H+  +EA++
Sbjct:  229 VEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRA-VD-------------GGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYA------IDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYA------LQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALP--RPDFQLDAATGLITTLVQ-LDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEA--------IDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDID-EGINGRVWYRII-----SGNQDGNFLVNVS-SGLISRGATPLDRETVALHALQVEAFN 752          

HSP 3 Score: 127.487 bits (319), Expect = 9.422e-30
Identity = 162/604 (26.82%), Postives = 263/604 (43.54%), Query Frame = 3
Query:  870 PLTGSTHLTINITDINDNSPVFLKPLTEISIKEN-NFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK------FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGG-----LKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA---------HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYV-----GSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPD-GRI-FTTKESLDRETY--DMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXX--XXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSND--PEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSK 2573
            P   +T + I ITD NDN+P F     E+ + E  +     +  + A D D  DN ++ ++   GN+      + F I+   G +   + LD++     YLL +  TD  +       +   + V V + ND  P       + S    + V E  Q    IA+  A+D D+        S   G       +S    DL V  +Y       LDRET  F+  TI  +D G PP  +T  + ++VLD +D  P F        + E   V + V+++ ASD + G N   +  + H+          F  D  TG++  N   DRE+  EY+L  TV D     + D        + I+ V I D ND +PVF ++ YE  IPE +SP   V     G + A D+D   +N  ++Y+++          S  YF +  D G +     + LDRE         +I   D G      +V + V + D+NDN P ++ +S     +       VG  V V+KA+D D G+    ++ Y I  G  ++ F +++ +G L +   P+  +  PE + +VV  +D  P   T +  +R+   +E+ +
Sbjct: 1151 PAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTA-----ATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWF-----LRSYEGPIDVSEG-QPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRV-RRYV-----ELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAAL--LQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRD-----NPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPE-NSPNGTVLTVLNGPIYASDADF-GVNATLAYSLLGG--------SSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGG--RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLE--NSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGG-NDTFGIDESTG-LIVTVAPIDYETRPEYLLMVVA-TDQAPPFHTASCELRVSLQNELDE 1713          

HSP 4 Score: 119.783 bits (299), Expect = 2.280e-27
Identity = 176/692 (25.43%), Postives = 311/692 (44.94%), Query Frame = 3
Query:  537 EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQL--LLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQ-EVNTYLLPIQVTD--STKFAETI-LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYT-------ILLTKPLDRETNEFFQATIKCQD--DGYPPQVTTKIINIQVLDKNDCTPHF---PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID--HAHFSIDENTGVLRTNSI-FDREKTGEYKLEATVYDRRNLVDS-----DPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGR--LVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEI---IRLVVKVSDSGPS 2519
             + I++ + ND+ P+++     +++ E++ +G+     LA DLD+     +S +                ++   DK  L+    L+ V A +D E   +  + ++A D G     G   + IN+ D+NDN+PVF +     + +EN+     + ++ A D D   N+++T+S   +          ++G  G + + + LDY++    T  L I   D  S     T+  +V+V +ENDN+P+       + ++  + + ENI     +  ++ATD D        +   G L L   +  L   T++        I  T  LDRE    +   ++  D  DG   +     +NI +LD ND  P +   P A+T V   E  P  + +  ++A+D D+  N  LVY ID  +  + I+  +G +RT  +  DRE        +     R++V S      P  +  +S T+  V+++D+ND  P F  L Y   + EG      +  V A D D E  N  ++Y+M        + + +  F +     + TT   LDRE    +   + A D G      +  + + + D+NDN P + H +   +S+     E+V R  +V  L   D+DSGLN+ L++ I  GN+   F +  + G   L++  +S D E      LV++  D+GP+
Sbjct:   15 RVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYH----------------FSDDSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAG--RVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIF------DRNSYSIAIPENILAGATVLYVNATDGDQ-------SPEYGQLSL---IYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIV---ENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASM----RSIVVSGADRGSPPRRATASATVT-VLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPD-EGANGNVTYSMT-------AALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF-HPARSAVSL----MESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDG---LVRTVVSLDRETKASYSLVIEAIDNGPA 648          

HSP 5 Score: 115.931 bits (289), Expect = 3.092e-26
Identity = 159/637 (24.96%), Postives = 263/637 (41.29%), Query Frame = 3
Query:  540 IQISIEDINDHSPVW-TQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSIS-------------RYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLT-EISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT-YLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF--PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA---------HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKV-LSSTTIIRVIIKDINDCAPVFKKL------FYEFSIPEGSSPRMYVGSVL-AEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEA-----WDSG--------PITHRVSVDVVVKIEDLNDNFPQWS-HSSDLGLSIN 2294
            + +++ D ND+SP +   S  ++ + E +  G+   +  A D D+  + ++S             +Y L   N S + +  +      +KT    +L R+ A                 D GSPP + + +L++ + D+NDN P+FL P    +S+ E       +  ++A D D   N ++TF   +        K  I   +G I V    + D+E    Y L +   D          I+ V V + ND  P  + L  V +    + V E++   + +A++ AT+             +G  K +  +   S +   T LL      ++ E F  T    D G PP      + ++VLD ND  P F  P   T V I E +PV   + ++ A D D G N  + Y   HA          F I+  +G++ T    DRE    Y L         L+ SD  + V   ST  ++V++ DI+D  PVF  L      +  FSIPE S P   VG+V  A D+D+ A N  + Y +       K ++S+          +      LDRE    ++  ++A     W           P   R   +V V +ED+ND +P ++ H    G++++
Sbjct: 1825 VYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTS-QFILFRIVA----------------LDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGG----DKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERP--AFLAPVQT----VSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL------KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLI--------LLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGA-NAIVYYFIAAGNEGNKFNLSRW--------GLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVD 2411          

HSP 6 Score: 112.464 bits (280), Expect = 3.334e-25
Identity = 162/636 (25.47%), Postives = 269/636 (42.30%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQS-KIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYL-----NQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS------TKFAETILLVKVQNENDNAPVISILPH-----VNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRET--NEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVP-VESFVTKLNASDCDVGVNSQLVYRIDHAH-----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISK----LYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGP------ITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKA 2342
            + + + D+ND +P + +S +  I++ E  + G R    +A D DS               N +L+ +SI+ +  P   ++       L +R    +DRE      L ++A+D G+PPL  +  + + + D++DN PVFL      S+ E   +   + ++ A D +   N         +        FY + + G ++V + LD ++ V  Y L + V D+       +    I++V + +ENDN+PV S + +      NS N  +L   N         + A+D D         S  GG   +  L D       ++ L + LDRE       + TI  QD G   +  T  + + VLD ND TP F     T ++ E  P V + V  + A D D+GV      R   A      F IDE+TG++ T +  D E   EY L         +V +D      +++  +RV +++  D    F    Y+ ++ E + P   V  V A               +V K +E K H  +         +  G I TT+ +LDRE  D +  ++ + D GP      +T++    V V + D NDN P++   S     + +      G L+TVL A
Sbjct: 1268 VSVHVADVNDVTPWFLRSYEGPIDVSE-GQPGPRIATFMASDQDSGL-------------NGELE-YSII-DGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRER-VAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLN-------GPIYASDADFGVNATLAYSLLGG-SSAYFLIDRD-RGNVSMALGQGLDREGIPGGRLELTILVQDGGR--RNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLM--------VVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEI-TTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGS--ATLVEVRESAAPGTLLTVLHA 1864          

HSP 7 Score: 109.768 bits (273), Expect = 2.476e-24
Identity = 123/478 (25.73%), Postives = 205/478 (42.89%), Query Frame = 3
Query:  879 GSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQ--NENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTIL-LTKPLDRET--NEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVG---VNSQLVYRIDHA-HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYD------MHSFSIEAWDSG--PITHRVSVDVVVKIEDLNDNFPQW 2261
            GS  + I + + NDN P+F  PL  +S+ EN  +   + Q+ A DLD     ++++ F      +D  KF ++  +G I V   LD+ +    + + +   D     ET   V++   + NDN PV     +V ++       EN    T +  + ATD D+        S       S   + ++V   Y ++ L + LD E         TI   D G PP  +T    ++V D+ND +P F     ++ I E +   + V  +NA+D D         L+Y ++ +  F I+  +G + + ++ DRE   +Y L     D  +  D        +    + + + D+ND  P ++ L Y  +I E +     + +V A D D+   N  + YA  I P       +  Y   +  G+I TT   LDRE  +      M S  +   D G  P     S  V V ++D+NDN P +
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFS-----DDSDKFSLDPASGLISVAAALDF-EATPRFTVTVMARDGGG-QETAGRVRINLLDVNDNTPVFQRDSYVGTA------RENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFS-ITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQK------TGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNE-NGTLVYA--IDPP------NPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSF 460          

HSP 8 Score: 95.5153 bits (236), Expect = 5.747e-20
Identity = 110/442 (24.89%), Postives = 196/442 (44.34%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLL-RVDANIDRXXXXXXXXXXXXXDSGSPP--LTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQE-VNTYLLPIQVTDSTKFA---ETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT-KPLDRETNEFFQATIKCQDDGYPP--QVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVL-RTNSIFDREKTGEYKLEATVYD 1820
            + I++ D+ND+ P W      + I E++  G+  +   A D D + +      TL Y  +     + I  N+   K     L L R D N          +++   D GSPP   T S  +T+ + D+NDN P F+     + + E    +  L Q+ A D D   N  +T+S   ++    R  F ++   G   +  ++  D+E V  Y L +  TD    A    T L + V + NDNAP        + + + + + E++  ++ + SL+ TD D+          +GG +  +     SV  +  ++ T   LDRET   +   I+  D+G     +  T  +++ VLD ND  P F      V + E V   + + ++ A+D D G+N ++ YRI       +F ++ ++G++ R  +  DRE    + L+   ++
Sbjct:  334 VNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENG-----TLVYAIDPPNPFYRI--NAASGKIRTTGLQLDREDLN-PISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAAL---PRPDFQLDAATG--LITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF------HPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQ----FSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFN 752          

HSP 9 Score: 90.5077 bits (223), Expect = 1.645e-18
Identity = 127/563 (22.56%), Postives = 235/563 (41.74%), Query Frame = 3
Query:  438 DIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVW-TQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRV--DANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXX--XXGGLKLSRVLTDLSV-VTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQV-TTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTK------------LNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDS-------DPT-EKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQIS 2033
            D+ +     K +Q     +  +      +S  F + + + D+ND+ P++ +     +++ E    G+      A D D+ P+  ++ + ++     +L +              +  ++RV   ANIDRE      L+++A D G+PPL+GS  + + + D+ND  P FL P+  +S+ E+  +  ++  + A +     N K T+          ++ F ++  +G +   ++L   +  N   +         + +  L V+V + ND+ PV  + P+      V+ + E +     I  + A D D         S   +GG+  SR      +  T   I   + LDRE+   +   +   D G P    +T+ + + + D +D  P F      V  D G P +SF                 A D DVG N+ + Y I   +    F++    G+L   S  DRE +  Y +        N   +       DP+ ++ L     +RV ++DIND  PVF    +E++   G +    VGS L +   +EA++R + 
Sbjct: 1905 DVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVT-FRIESGGGDKLSIGP------------SDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGI----GKNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPN----GTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVG-SRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVF-----IVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSR-WGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLRE---VRVYLEDINDQWPVFTN--HEYT--AGVAVDAKVGSELLQ---LEAVDRDVG 2429          

HSP 10 Score: 88.1965 bits (217), Expect = 1.011e-17
Identity = 141/547 (25.78%), Postives = 236/547 (43.14%), Query Frame = 3
Query:  882 STHLTINITDINDNSPVF-LKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGN--SMNIEDRSKFYINGKNGKIFVKQI-LDYDQEVNTYLL-PIQVTD------STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNX--XXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKP---LDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI---DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNL--VDSDPTEKVLSSTTIIRVIIKDINDCAPVF--KKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMV----IKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGL---SINITREETVGRLV-TVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQ 2426
              ++ +N+TD NDNSP F     T + ++E+      L  + A D D   N  ++          I  +    I  ++G   V     D+ ++ + ++L  I   D      ST F  +++++ V   NDN P+      ++     + V E     T +AS+ ATD D      +     S GG KLS   +D        I+   P   +DRET   +   +   D G PP   + I+ + V D ND  P F A + TV + E + V SFV  + A++   G N++  Y+I       F++   +G++ +  +               Y+R NL  V +D     L     + V + D+ND  PVF         +I E     + +  VLA D D E  N  + Y+ +    +   + +S      F ++    I +T  +LDRE+  ++S  + A D G P+++  +  + V ++D++DN P +    D G    S +I      G  V  V  A+D+D G N+ + Y I  GNE   F L++
Sbjct: 1822 GAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDV---NDNVPIF-----LSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSD-------GIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKS------------YERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGD-EGQNGAVRYSFLHAGGVGSRDWES------FRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSR 2334          

HSP 11 Score: 82.0333 bits (201), Expect = 7.890e-16
Identity = 179/751 (23.83%), Postives = 295/751 (39.28%), Query Frame = 3
Query:  417 GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFE-----IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENN---FIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVL----------------TDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIIN-------IQVLDKNDCTPHFPAAITT-VYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFS----------IDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVF-KKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSP-DGRI-FTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPL 2525
            G ++V   +DRER+   +       L + V +     +Y       + ++I D ND+SPV++Q      IPE+S  G+   +       S  D  ++  TL Y   S L   S  +  L D+   N + + +   +DRE I    L L            +  L + + D+NDN+P F        + EN+        + +   +DL + D   + +S  +  N      F I+   G I     +DY+     YLL +  TD       A   L V +QNE D     S+  +  +      + E     T +  ++A  M     +         L L+ ++                 +L    +  I     LDRE  + +  T+  +D G P +    + N       + V D+ND +P F A   T V + E     + +T L+A+D D G N  +  R  H H            I   +GV    +I D  K  ++  + + +    +V  D      S+T  + VI+ D+ND  P+F     Y  S+ E  +P   V SV A D+D    N Q+++ +            KL  S+ P DG I      ++DRET   ++  + A D G      S  V V ++D+ND  P +        ++++    +VG  V  +KA ++  G N+   Y+ I G     F ++  SG   +    L    E   L    +D G  PL
Sbjct: 1447 GLVYVNRPLDRERVAEYR-------LTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVN-ATLAY---SLLGGSSAYF--LIDRDRGN-VSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGN----DTFGIDESTGLIVTVAPIDYETRPE-YLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAA------LSEAAVPGTVVVRVAAPQMKAPPKLP--------LPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGG-PREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARA-HTHTGTRIPPQYILIIQNESGV----TIVDVAK-ADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDAD-AGPNGQVTFRI------ESGGGDKL--SIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQ---TVSVLESLSVGSFVATVKATENYKGHNTKYTYK-IAGIGKNAFTVHATSG--LVTSTRLLKSYERFNLTAVATDHGRPPL 2142          

HSP 12 Score: 77.411 bits (189), Expect = 1.634e-14
Identity = 92/366 (25.14%), Postives = 154/366 (42.08%), Query Frame = 3
Query:  855 DSGSPPLTGSTHLTINITDINDNSPVFLKP--LTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK----FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLS-ATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT-KPLDRETNEFFQATIKCQDD-GYPPQVTT------------KIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYR------IDHAHFS---------------IDENTGVLRTNSIFDREKTGEYKLEATVYD 1820
            D G PPL G   L + + D+ND+ PVF+ P   T ++I E   +   + ++ A D D   N  + +SF     +   D   F IN  +G I   + LD + +   Y L +  +D  +     +   L V + + +DN PV  +LP   +      + E+    TA+ ++S A D D  +  I     + G + ++       ++++ +L+    LDRE + ++   +K   +  + P VTT            + + + + D ND  P F     T  +     V S + +L A D DVG NS ++YR      I H+  S                 E  G+LRT  +F     G + LE    D
Sbjct: 2136 DHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQA-VYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKF-----NLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRILSILYIKHSSNSSTRMYNIFTLGRCARAGERDGILRTYDLFTAYGPGYFMLEVVAAD 2495          

HSP 13 Score: 69.707 bits (169), Expect = 4.546e-12
Identity = 100/383 (26.11%), Postives = 160/383 (41.78%), Query Frame = 3
Query: 1170 IQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT--KPLDRETNE-FFQATIKCQDDGYPPQ---VTTKIINIQVLDKNDCTPHFPAAITT-VYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA----HFSIDENTGVLRTNSI--FDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETK-SHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDS--GPITHRVSVDV-VVKIEDLNDNFPQWSH 2267
            I +T +   A T +L+++ +ENDNAP         ++  VLL E       A+A+++A+D D         +   G   +    D       T +LT  K LD E +   +   +   D    P     +T  +++ V D ND TP F  +    + + EG P     T + ASD D G+N +L Y I        F I    G LR       DRE    Y L         ++  D     L+ST  + V + D++D  PVF  L    S+ E ++    V  V A D+     N   + A +++   T   +  + +++ S  G ++  +  LDRE    +  ++   D+   P   R   D+ +V I D NDN P +S 
Sbjct: 1145 ICLTATPAQATTSVLIRITDENDNAPAFGA-----ATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGID-----NGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFM-ASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNL--------TIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDA-----NEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRP-LDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQ 1502          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 184.882 bits (468), Expect = 3.324e-47
Identity = 195/695 (28.06%), Postives = 318/695 (45.76%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETI---LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVY---RIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLV---VKVSDSGPSPLTNTTIVRIYFHSEVSKLP 2579
            +S   +++I+I ++ND+ P +     V +IPE   I +      A D D +P       T   V  +    F I  +S          L+ V   +DRE      L++ A ++GS   +   + TI + D+NDN+PVF       S+ EN  I Q + ++ A D D  +N K+T+     +++ D SKF +N   G +  K+ LD + +  +Y L +   D  K +++    + + + + NDN+P  S       S   L V EN  + + I  + A+D D  +      S   G   +    D    T   I +   +DRE    +  TI  +D G PP V+T  + I V D+ND +P F +  T+  IDEGV + S V  + A+D D G N+Q+ Y   R D + F+I+   GVL      +RE    Y L     DR +         +++S   + V++ D+ND  PVF    Y  S+ E S+    V +V A+DSD+ A N  + Y+++    E +  I+      S  G I TT   LD E    +   + A DS    +    +V +++ +LND  P ++       +   +  E      +V+K   SD     SL+Y I+ G + + F ++Q+SG   ++      D E++ L    V+V+D+G  PL+N T V I    E    P
Sbjct:  977 KSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP------LTFDIVEGNAGSSFKIDQSSG---------LISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYE----LSVGDTSKFEVNPATGLVTTKRPLDREDQA-SYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFS------QSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRID---STTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGS--------PMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGA-NAVLRYSIISGNDEKRFKIN------STSGVIMTTTP-LDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQ-----NYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSG---IISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSP 1615          

HSP 2 Score: 176.792 bits (447), Expect = 1.165e-44
Identity = 211/799 (26.41%), Postives = 346/799 (43.30%), Query Frame = 3
Query:  273 FQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSL--VNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLK-----IQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETI---LLVKVQNENDNAPVIS-------ILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTK-PLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF--PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLM----KQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLP 2579
            F+V E S  G  IG +       D D S   ++ + +    +  S+    G + +K  +D E    KK Q      +++    K      +S+   +++ ++D+ND+ P + +S     + E+   G       A D DS  +  IS   L    N    +            +  ++  RV   +DRE I    L + A+D        +T + I+I D NDN P F  P +  +I E++     + Q+ A D DI  N  +T++   GN  N      F ++ ++G + V+  LD  + + +Y L ++ +D+    ++I   + V V + NDNAP          I    +  + VL V+   +DE +  +++                   L LS   +D   +     +L+K PLD ET   +Q T+  +D G P +  T  + I +++ ND  P F  PA +T+  I E V + + V KLNA+D D    + L + I   +    F ID+++G++      DRE T  Y L       R        E V ++ T IRV+  D+ND APVF    Y  S+ E       V  V A D D E  N +++Y + +         SK  F V+P   + TTK  LDRE    +S  + A D G  +      + + I DLNDN PQ+S S     ++ +T     G  +  + A D D+G N  + Y II GN    F+++  +G + ++    ++ L++      L +   DSG  P  +T  V I    E    P
Sbjct:  589 FRVSESSSPGHQIGQVAAT----DADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYE----KKTQ------YMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAM----------DRFTGEITTRVP--LDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGP-SRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGN-----SFQLDPRSGILSVRSTLDR-ETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAIT-------------------LSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTS--IPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVV-----RATETGSQGESVYNNAT-IRVL--DVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRD-EGENAKVTYELSV------GDTSK--FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSK---YTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALAS----YNLTISAKDSGVPPWVSTAFVAITVADENDNSP 1306          

HSP 3 Score: 175.637 bits (444), Expect = 2.372e-44
Identity = 211/781 (27.02%), Postives = 341/781 (43.66%), Query Frame = 3
Query:  303 LLIGDLVENYRIQDFDLSRRENLNFQMMKENN--FVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH--FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEII---RLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRFFEKDL 2609
            + +G +V      D D+     L++ ++  +   F     G +  K   DRE   TK +    L           +S    ++I I D+ND+ PV++ ++   ++ E   IG+      A D D+  +N+  RY+    N +       V             ++ V  ++D E+     L L   D GSPPLT ++HL IN+ DINDN PVF     +  +KEN        Q+ A D D S N  L F    GN     D   F I+G  G I + +  DY+ +   Y L +Q  D     K+    + + +++ ND++PV S       SN    + E+    + + +++ATD+D+            G        D       +I ++  LDRET   +   ++ +D G   + ++  + I + D ND +P F         +   P    + ++ A+D D   N  + Y +      FSI+ +TG++   +  D EK  +Y +  T  D        P+    SS T+++V++ D+ND  P F K  Y  ++ E  +  + V  V A D+D  A N +ISY+++       S    + F++       TT+  LDRET   +S +I A D   +    +  V + I D NDN P ++  S      NI+ +   G  V  L A D D G N ++ Y II GN+   F+L+ +SG L +     + D E I    LVVK SD+G SP  + T      H  V  +   +  FEK L
Sbjct:  181 VAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRE---TKASYQVALR--AQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNG-NNADLRYSFTSGNTNHAFTLDAVTG-----------VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENT---PAGTQVSATDRDSSTNGALVFGIIKGN-----DDGVFTIDGSTGIISIAKSPDYENKTR-YDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFS------PSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNID---ANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQ-IGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKD-----GGTPSR---SSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGA-NGKISYSIL-------SGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRF----NISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRS---TLDRETIPSYTLVVKASDAG-SPQQSIT---ASIHVSVLDVNDNAPRFEKSL 898          

HSP 4 Score: 173.711 bits (439), Expect = 8.948e-44
Identity = 204/747 (27.31%), Postives = 328/747 (43.91%), Query Frame = 3
Query:  303 LLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVN---GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDV--GVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLG-LSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEII-RLVVKVSDSG 2513
            L IG  V      D D      + +++   +     VN   G +  K  +DRE           L +  + +    QS    I ++I D+ND+SP ++QSK  + + E++  GS     LA D D+  +    R T   ++ +    F I      D T     ++ V   +DRE +    L + A+DSG PP   +  + I + D NDNSP+F    T   I E   I   +  + A D D   N ++ +S        D S F IN  NG + VK+ ++  + V TY L I+ +D       ++  L V V + NDN PV       NS + +  V EN    T++ +++A D D  +  +   S   G    R   +    T   I+ T PLD E    +   +   D  Y  +     + I+V++ ND TP F     T  + E  P  + V K++ASD D    ++  +V   D   FSID+ +G++ T  + DRE    Y ++  V D  N          LS+ T + + I D ND +P F    Y  SI E S+P  +   + A D+D E  N +I+Y +               F +     + T  + LDRE    +  +I+A D G      S+ + V + D+ND+ P  + SS  G +  N  +E  V R++    A D+D+GLN+ L + ++      +F L+  +G +   K PL  + + +  L + V+D G
Sbjct: 1112 LPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDRE-----DQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANG---RVTYSIISGNHGNAFRI------DSTTGRITVVGV---VDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRG----DTSAFAINAMNGVLTVKKEINR-ETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVF------NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKIN---STSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGN--------PPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDAD-EGTNARITYNLSRNDA----------FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRIL----ASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDIS-TKVPLDREQQAVYTLRIGVADKG 1800          

HSP 5 Score: 172.17 bits (435), Expect = 2.677e-43
Identity = 202/699 (28.90%), Postives = 313/699 (44.78%), Query Frame = 3
Query:  546 ISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD--STKFAETI-LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVV-VKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEII---RLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLP---AESRF 2594
            I+++D+ND++P +  S     + E   +GS      A DLD   +  +S              +S+V       T  +Q ++R     DRE     ++ L A+D GSP  +G   + I I D+NDN PVF       S+ E+  I   +  + A D D  +N  L +SF  GN+ +      F ++   G + V + LD++Q  ++Y L + VTD  S    +T  LL+ V + NDN PV S  P    S     V+EN    T +   SATD D+S+          G        D S      I + K  D E    +  T++ +D G P +  T  + I + D ND +P F  +  +  I E   + S V  + A+D D G   +L YR+   +    F+ID N+G +R +S  DRE T  Y L+    D              SS+T + + ++DIND +P+F+   Y F + E SSP   +G V A D+D ++ N  + YA+           +   FS++    + T K  LD E    +  ++ A D G    R S+ VV V ++D+NDN PQ++ S     +  +      G  V  + A D+DSG N  ++Y I+ GNE+  F +++ +G +   + PL  D E I    L +   D         T V I    E    P     SRF
Sbjct:  156 ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLS--------------YSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNH-----AFTLDAVTGVVTVSRSLDFEQR-SSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS--PSAYQSR----VKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGVFTIDGST---GIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDG--------GSTSRSSSTRVTIALQDINDNSPIFQGP-YVFRVSESSSPGHQIGQVAATDAD-DSSNGDVRYAL---------SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGG-TPSRSSLTVVKVMVDDVNDNPPQFAKSL---YTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEI-TTRVPL--DRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRF 796          

HSP 6 Score: 169.474 bits (428), Expect = 2.122e-42
Identity = 175/655 (26.72%), Postives = 292/655 (44.58%), Query Frame = 3
Query:  417 GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQ----------SNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQL--LLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKP-LDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID-HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLK 2339
            G++ V   +DRE + +              YNL I           S  F + I++ D ND+SP++  ++    I E   IGSR  +  A D D               +N+Q+  +SIV         +N +  +L V   I+RE +    L + A D GSP +T    LT+ + D+NDN PVF       S++EN+     +  + A D D+  N  L +S    ++  D  +F IN  +G I     LD+ +E + Y L +  TDS   A+T + ++V N ND      I P     N    V EN    T++  +SA+D D+  ++       GG    +     S+  +  I+ T   LDRE    +   ++  D G PP      + I++LD+ND +P F ++  +  I E     SF  KL A+D D G N+++ Y +  +  F I  ++GV+      DRE    Y L     D        P +   +S+  IRV + DIND  P+        S+ E      +V  +LA D+D   +N +++++++       S+  K  F++       +TK  LDRE   +++  I   D G  +     DV++ + D +DN P++  +       N+T  E++ R  ++++
Sbjct: 1258 GRITVVGVVDREALAS--------------YNLTISAKDSGVPPWVSTAF-VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEG-------------SNAQV-FYSIVRGDTS-AFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI---ISGNDEKRFKINSTSGVIMTTTPLDF-EEKSQYGLEVTATDSKYTAKTNVTIRVINLND------ITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIV--GGKDSDK----FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDH-----GTPPQ---ASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADT-GLNAELTFSLL-------SNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPT-----EYNVTISESLPRGASIVQ 1845          

HSP 7 Score: 139.813 bits (351), Expect = 2.529e-33
Identity = 153/536 (28.54%), Postives = 243/536 (45.34%), Query Frame = 3
Query:  879 GSTHLTINITDINDNSPVFLKPLTE--ISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLS--VVTKYTILLTK-PLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQ 2456
            G T + I++ D NDN+P F  PL     +I+EN    Q +  + A D D   N  +T+S  +  N     KF +N K G+I     LD++ + ++Y + I   D  K    + L+ V + NDNAP  ++  +         V E++   + +  L+A D+D           +  L  S V  D S   V    ++ TK   DRET   +Q  ++ QD G P +     + I++LD ND  P F +A  T  +DE V + + +  + ASD D G N+ L Y       +HA F++D  TGV+  +   D E+   Y L  +V DR     S P    L+ T+ + + + DIND  PVF    Y+  + E +     V    A D D  + N  + +  +IK  +         F++     I +  +S D E    +  +++A D G      +  V + IED+ND+ P +S S+    S  I     +G  V  + A D DSG    L Y +I GN    F ++  SGS+ +  +
Sbjct:   52 GRTVVVIDVKDENDNAPEF--PLNSYVFNIRENTPAAQ-VAIVTATDRDSGTNAAITYSLFSGEN-----KFMMNSKTGEIRTVTPLDHETK-DSYTMRISAFDG-KHTTFVPLITVDDVNDNAPFFALSVYKTG------VYEDVAVGSIVRQLTAVDLD--------VGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHA-FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDR----GSPP----LTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRD-SSTNGALVFG-IIKGNDDG------VFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSN---YSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSE 540          

HSP 8 Score: 128.257 bits (321), Expect = 8.908e-30
Identity = 149/576 (25.87%), Postives = 260/576 (45.14%), Query Frame = 3
Query:  300 GLLIGDLVENYRIQDFDLSRRENLNFQMMKENN---FVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQ-LKLFS---IVYNSLP-DKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGN-SMNI---EDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI---DHAH-FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPR 1970
            G+ IG  V      D D      + + +++ +     ++ +NG L VK +I+RE + T       L +        + ++  E+ + + D+ND+ PV+     + ++ E+S   S   L +A D      N++ RY++   N+ +  K+ S   ++  + P D    +Q  L V A   +                    T  T++TI + ++ND +P F +     S++EN+     + ++ A D D         SFG+ S +I   +D  KF I+ ++G I    +LD  + V+ Y + ++VTD+        T + +K+ +ENDN+P        +SS+    + EN    +    L+ATD D  +             LSR    +   +   I L +PLDRE    +   I+ +D G PPQ ++  I + V+D ND  P   ++     + E  P E+ V ++ ASD D G+N++L + +   +H   F++D  TG + T    DRE+   Y L   V D+ N     P+   LSS   + + + D +D  P F+   Y  +I E S PR
Sbjct: 1320 GVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPT-----YTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSA-QSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSK-------------------YTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD---------SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDR-ELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSP------KFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARIT------YNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGN-----PS---LSSVADVIIDVIDEDDNCPRFQPTEYNVTISE-SLPR 1839          

HSP 9 Score: 103.99 bits (258), Expect = 2.255e-22
Identity = 95/362 (26.24%), Postives = 161/362 (44.48%), Query Frame = 3
Query: 1461 KPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI--DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVI-IKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTT 2537
            +  DRE+   ++ T+  QD          ++ I V D+ND  P FP       I E  P    V  + A+D D G N+ + Y +      F ++  TG +RT +  D E    Y +  + +D ++             TT + +I + D+ND AP F    Y+  + E  +    V  + A D D+  IN ++SY++V             YF+V   G +  TK + DRET   +  ++ A D G  +      V ++I D+NDN P +S +     + ++  +  +G  +  + A D D+G N+ L Y    GN +  F L+  +G + + +           L + V+D G  PLT+T+
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQ-VAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKH-------------TTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDV-GINARLSYSLVSGDTS--------YFTVDSQG-VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQ---YTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTS 360          

HSP 10 Score: 90.1225 bits (222), Expect = 4.333e-18
Identity = 109/394 (27.66%), Postives = 168/394 (42.64%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQL--LLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILL--------TK-PLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCD 1679
            + I + ++ND +P +TQ     ++ E+S   +      A D DS    S+S              +SIV     DK  ++Q   ++     +DRE +    + +   D+G+PPL+  T +TI I D NDNSP F       SI EN+    +  ++ A D D   N ++T+      N+     F I   +G I + Q LD + + +TY L IQ  D     + +   + V V + ND+ P+I      NSS+    V EN   ET +  + A+D D             GL      + LS   K    L        TK PLDRE    +   I   D G P   +   + I V+D++D  P F      V I E +P  + + ++ A D D
Sbjct: 1500 VTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSF--GSLS--------------YSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITY------NLSRNDAFMIGASSGVITLAQPLDRENK-STYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLI------NSSSLRGSVRENQPKETHVMRILASDADT------------GLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 11 Score: 60.077 bits (144), Expect = 5.198e-9
Identity = 70/230 (30.43%), Postives = 107/230 (46.52%), Query Frame = 3
Query: 1713 DHAHFSIDENTG-VLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGN 2399
            D   F+ID +TG +  T   FDRE    Y+L     D  N        +     T++ + +KD ND AP F    Y F+I E ++P   V  V A D D    N  I+Y++        S  +K   + S  G I T    LD ET D ++  I A+D     H   V ++  ++D+NDN P ++ S        +  +  VG +V  L A+D D G+N+ L+Y ++ G+
Sbjct:    8 DQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAAN--------RCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRE-NTPAAQVAIVTATDRD-SGTNAAITYSLF-------SGENKFMMN-SKTGEIRTVTP-LDHETKDSYTMRISAFDG---KHTTFVPLIT-VDDVNDNAPFFALSV---YKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD 211          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 178.718 bits (452), Expect = 2.385e-45
Identity = 204/732 (27.87%), Postives = 326/732 (44.54%), Query Frame = 3
Query:  417 GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNY-FEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDS---TKFAETILLVKVQNENDNAPVISIL---PHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLP 2579
            G +   A IDRE       Q   LN           SN    +Q+ ++DIND+ P +      + I E   + +   +  A D D+  +N    YT+   +N+    FS+   + P  + L  +  +    +DRE  +  +L + A D G+P L G   + I I D ND++PVF +     SI EN      + ++ A D D   N  + ++  +   I+  S F ++   G I  KQ LD++ + N+Y   +  +D    +K     + + V + NDN+P + I    PH   + +  +  EN    T IA +  TD D+++   +    + G         +  +  Y I L KPLDRE   F+  T+   D G P + T   + I V D ND +P F +   T  I E     S+V +LNA+D D G N  + Y I    D   F +D  +G++ T    DRE+     +  T  D      S P     + +T + V I D ND  P F K  Y+ +I EG+S    V  V A D D    N +I+Y +      + + ++ L F ++    +  TK  LDRET  ++SF++ A D G      SV V + I D+NDN P +          +I   E  G+L+ V  A D+D G N+ ++Y+II GN +  F ++  +G +  +        E   L++   D G      T +V +   ++   LP
Sbjct:   49 GVISTTARIDRETTTQISLQLRTLN----------PSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAG-NNGTVDYTIASGDNT--ATFSLGTTACPTGSTLCVITKKP---LDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI-DWDAIQSNSIFDLDSSTGVIRTKQNLDFEVK-NSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPH---NGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDD--EGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDH----GSAPK----TGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVD-SGDNGRITYEI----SSSDAQVNGL-FELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFA---SIMENEPPGKLLQV-TATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLP 739          

HSP 2 Score: 155.221 bits (391), Expect = 4.098e-38
Identity = 182/653 (27.87%), Postives = 281/653 (43.03%), Query Frame = 3
Query:  528 NYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSP----VFLKPLT-EISIK-ENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQE-VNTYLLPIQVTDSTKFAETIL---LVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH------FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSS-DLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSG 2435
             Y  I I+I D NDH+PV+TQ+  + +I E++K G       A D DS  +  I +Y + +         +I  NS+ D    +  ++R   N+D E        ++A D G P       +TIN+ D NDNSP     +L P   + +I+ EN+ I+  +  +   D D + N +      N    +D   F +    G  F++     D+E V  Y L + VTD    + + L   L+ V + NDN+P  +      S+     + E  Q+ + +  L+ATD D         S +GG  L     D        +   KPLDRE       TI  QD G  P+  +  + + ++D ND  P F  +     I EG  + + V +++A+D D G N ++ Y I  +       F ++  TGVL T S  DRE    Y       D       DP    L S+  + + I DIND APVF  + Y  SI E   P   +  V A D+D E  N  ISY ++          +   FS+     + +T  SLD E  +  S  I A D G      +  V V + +  DN P + +   +  +  N+ +   VGR+    K        N S++Y I+ G+   LF ++   G
Sbjct:  188 GYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDI-KYAIDW--------DAIQSNSIFDLDS-STGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNG---DDEGCFKVEFL-GFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFT------SNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQ---SGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDH-----GDPQ---LMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDAD-EGTNAVISYDII-------GGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTK------DKNGSISYAIVSGDPTNLFLVDSTGG 794          

HSP 3 Score: 146.747 bits (369), Expect = 1.731e-35
Identity = 199/777 (25.61%), Postives = 322/777 (41.44%), Query Frame = 3
Query:  306 LIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQC-CCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEV-----NTYLLPIQV--TDST-KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH----AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETY----DMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSH--SSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLP 2579
            L+G +V N    D D  +   + +Q+      +  +N    V   I   R  T  ++    + +         Q +   I I++  IN H P +T S  V ++     +  +++  +A D DS  +  +  Y++   N  +  LF I       K Y+ + LL+             +L++ A D G P  + S  +TI I D ND+  +F+      ++ EN+     +  + A  LD S    + +S      I   S F ++ ++G+I  +  LD ++ +     N Y++  +    D+T K  + I++V V + NDNAPV S   +       + V E     + +  + A D D         S   G  + +   + S    +   L+K LDRET   +   +K  D       +T  I I V D ND  P FP +  TV I E   + S V  LNASD D+G N  + Y I +    A F ++  TG L      D E T  Y+L  T  D   L+        LSST  + V + D+ND AP+F       ++ E  +    VG   A D D    N  I+++M        S      FSV+      TT  ++D ET     D     + A D G         + V++ D NDN P +    ++  G S+N          V  + A D D   N  + Y II GN +  F L+  +G L ++ Q + ++P I +L ++ SD G       T+V ++    +   P
Sbjct:  858 LVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGV---IKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS-IN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQL-FYSIPQGN--EEGLFGIFPGG---KLYIRKSLLQA-------LKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL-----ISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYA------ITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELH---LSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQD-HGLIP-------LSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDT-GTNAHIAFSMY-------SQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN----------VMTITAEDPDRNSNGKVTYSIISGN-NGYFNLHPSTGQLQMIHQ-IPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGP 1574          

HSP 4 Score: 131.339 bits (329), Expect = 9.901e-31
Identity = 180/683 (26.35%), Postives = 302/683 (44.22%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPL-AKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG--PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFH 2558
            + I + D+ND+SP +T +    NI E ++ GS Y L L A D D   DN    Y++   N+  L  F + + S          L+     +DRE++  + + + A+D GS P TGST +T+ I D NDN P F+K   + +I E   I   + Q+ A D+D  DN ++T+   +S + +    F +N + G ++ K  LD + + + Y   +   D       +   + + + + NDNAPV   + +  S      + EN +    +  ++ATD D  +  +      GG        D S     T+     LD E  EFF   I  +D G      T ++N+ VL+K D  P F   +    + E VP  + V ++ A+  D   N  + Y I        F +D   G+++ N   DRE+  +Y L   V  R   V      K LS+   + + + D ND AP F        I +G+     VG V+    +  A++       +++ Y+  S+   L +  S  G I   ++  D +    ++  + A DSG  P    +++ + + I    ++ P+++ SS +    ++   + +      + A+D DSG N  L Y I QGNE  LF +    G LY+ K  L        L+V+ +D G    + +  V IY  
Sbjct:  411 VLIDVTDVNDNSPAFTSNAYTANISELAQNGS-YVLQLNATDPDEG-DNGTVSYSITGGND--LGWFQVDFQSG---------LVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSS-DAQVNGLFELNTQTGVLWTKSQLDRETK-SLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFAS------IMEN-EPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTL---ASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLL--AVIARVGTV------KPLSAQATVNIEVLDRNDNAPQFSTSSVIVDI-DGT---WLVGQVVY---NAAAVDLDAGKNGLVR-YQLTSNAEGLLWINSTSGVIKLARKLTDGDET-QYTVQVLASDSGSPPQHSTMTIHITLSI----NHPPKFTLSSYV---THVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGI-FPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQ 1041          

HSP 5 Score: 124.405 bits (311), Expect = 1.236e-28
Identity = 169/682 (24.78%), Postives = 292/682 (42.82%), Query Frame = 3
Query:  264 SLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMK-ENNF-VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYN-LKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLL--LRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST--KFAETI-LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD---NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTI-LLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF---PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI---DHAHFSIDENTGVLRT-NSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAW---DSGPITHRVSVDVVVKIEDLN 2243
            + +F V E+S  G L+G LV +      D SR +++ + ++  E++F V + +G++  +  +DRE +         +     +YN   I+ +   + +++ D+ND++PV++++   I + E S  GS  +   A D D   DN+      K+        +S+V  +  DK ++N     L +   +DRE      L++ A D+ +  L  +  + I + D ND  PVF +    ++I E+  I   +  + A D DI  N  + +S  N  N+   + F +    G++ V + LD+ +    Y L I   D      + T+ + V V + NDNAP+    P        L V EN+     +   +A+D D   N+    S  S +     S       + T   I L T P  R++   FQ  +   D G P   T K I +QV D+ND +P F   PAA     ++        V  + A D D   N ++ Y I   ++ +F++  +TG L+  + I D     +  ++A          SD  +    + T++ V  +      P F    Y+ S+ E       V +VLA      ++N  I Y +        S  SK  F V     +  T   +DRE     SF++  +     GP     S  V + ++D+N
Sbjct: 1054 TFRFAVAENSSPGTLVGTLVAHA----LDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEG-DNA------KF-------FYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNG-NLA--AMFDVESATGRLIVAKSLDF-ETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPV------TLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDS---FQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN--------VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQA----------SDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQ-SSLNGNIEYYLT-------SDSSKGGFEVVKSTGVVKTTRGIDREGMGA-SFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 6 Score: 90.5077 bits (223), Expect = 3.108e-18
Identity = 159/655 (24.27%), Postives = 259/655 (39.54%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQ--NENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVV--TKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRM----YVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVS-----------PDGRIFTTKESLD--RETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSL 2441
            + ++I D ND+ P + +S     I E + IG+      A D+DS  DN    Y +   +     LF +              +L   + +DRE        +LA+D G P L  S  + + I+DINDN+PVF       SI EN    + L Q+ A D D   N  +++     +   +   F I+   G I     LD++ E    L+        K+A    +V V   N+ DN PV  +    N       V EN+   T +  + AT  D + +I           +S   T+L +V  T   I +   +DRE    +   +  +     P      +NI+VLD+ND  P F  +   V ID    V   V    A D D G N  + Y++           G+L  NS      +G  KL       R L D D T+        ++V+  D +   P    +    ++     P+     YV  VLA     + ++ Q  Y + +     K+   +L++S+            P G+++  K  L   + +YD+    + A D G  +   SV V + I+D ND+   + +++       +    + G LV  L A   D      + Y +I    H  F ++ +SG +
Sbjct:  516 VTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSG-DNGRITYEISSSDAQVNGLFEL---------NTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGK-LLQVTATDADEGTNAVISYDI---IGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVF-LYEMYN-----FTVYENVPKGTLVGRVYATTKDKNGSISYAI-------VSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQL------TSNAEGLLWINS-----TSGVIKLA------RKLTDGDETQYT------VQVLASD-SGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLAS----QPLSYQFFYVVAVDQDSGKN--GQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLI---VRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNT---FRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESH--FAVDVRSGQI 1105          

HSP 7 Score: 55.8398 bits (133), Expect = 1.018e-7
Identity = 63/226 (27.88%), Postives = 96/226 (42.48%), Query Frame = 3
Query: 1611 TVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFT--TKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLG 2282
            T ++ E  P  ++V K++ +    G   Q         F  + NTGV+ T +  DRE T +  L+      R L   +P+ + +S    ++V + DIND  P F  L+Y   I E            A D D    N  + Y   I   +  +  S L  +  P G      TK+ LDRET D +  +I A D G         + + I D ND+ P ++ +S LG
Sbjct:   13 TFHVQEEQPPGTYVGKVDGASAFEGSPKQ---------FGFNSNTGVISTTARIDRETTTQISLQL-----RTL---NPSNQPIS----VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPD-AGNNGTVDY--TIASGDNTATFS-LGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLG 213          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 179.104 bits (453), Expect = 2.562e-45
Identity = 207/732 (28.28%), Postives = 330/732 (45.08%), Query Frame = 3
Query:  417 GKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVW---TQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDA-NIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKF----AETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGG-----LKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA--------HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            G +  K  +DRE++          NL ++ ++   +S  + + + ++D+ND+SP +   T +K+V+   E+ K   +  + +  D  S   NS   YT+  V+ +   +F ++     D      L++   +  +DRE+++   L + A D G+P   G   L+I + D NDN P F       +I EN  +   + Q+ A D DI  N ++ +S     + + ++ F I+   G I     LDY+ +  +YL+ ++  D        +  I+ ++V + NDN PVI +   +  S     V EN    T +A +S +D D+        +  GG     +K   VL D S+     I + + LDRET++ F     C D G PP+ T K   I V D NDC P F        + E   V + V  +NA D D G NS+LVY I +          F+ID ++G++ T +  DRE+  +  L   V+DR     S P    LS    + V + D ND  P F +  Y  S+ E S     V  +LA+D DI   N  I Y+++              F + P   + T   +LD E    ++F + A D G  +   +V   V + DLNDN P +  SS    S+       +G+ +  LKA+D DS   +   + I QGN  E+F ++  SG + L K       +   L VK  D G     N  IV I
Sbjct:   12 GVITTKTVLDREKVS-------AYNLTIVEFSTPPKS--YTVLVYVQDLNDNSPSFVRGTSAKLVVF--ENDKDFRQKLIAVDSDFGS---NSTQSYTI--VSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI--ETHSDPQAIFGIHPTTGVIVNNVRLDYEAK-RSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGS---YQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFD-VLNDESI-----IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDR----GSPP----LSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDI-GENSLILYSILTP---------NTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVH--VSLTDLNDNQPVFDPSS---YSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNI 691          

HSP 2 Score: 172.555 bits (436), Expect = 2.797e-43
Identity = 171/657 (26.03%), Postives = 293/657 (44.60%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSK----IGSRYYLPLAKDLDSSPDNSISRYTLKYVN--NSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH--AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSI----PEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIE----DLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMK 2453
            + I++ D+ND  P++++++    I EHS+    IG  + +   K  ++    SIS+     +   NS   L+     S  D   +  L L V A                 D G+PPL G  ++TI + DINDNSP F      + + E+  I      +   D D     +++FS  ++      + F ++   G + + +++DY     +Y LP+Q  D     + +  +L +KV + ND +PV       N S    ++E    D   I  + ATD+D+        +    +  S+      +     I +   LDRE  E +   +   D G P + ++  + + V D ND  PHF  A    ++ E  PV +++  ++ASD D G N  + YR D   A F +D+ TG + T+ + DRE    Y          ++V +D         T + VI++D+NDC+P F K  Y  ++    P GSS    + +++A D D +  N  I+Y +V  P           FS++    + T    LDRE    H   + A D G      S++ +  IE    D+NDN+P + + +       +  +  +G +V  + A+DSD G N  + Y+I+ GN    FK+N+ +G +  ++
Sbjct:  689 VNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLY---LQSEVDHEKIPSLYLTVQAK----------------DKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPG----TLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFG-----NWSYTAHVLETTPPDSNII-EVVATDVDSGENGRISYAFDSKVDTSK----FGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVF--------SIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSS----LLTLIATDDDQQGPNSDITYMIVAGPKA---------FSLNQVTGVLTLVSPLDREVTHRHILHVVASDKG---GNQSLETITYIEINVLDVNDNYPVFINETTFK---TVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLR 1285          

HSP 3 Score: 168.703 bits (426), Expect = 3.561e-42
Identity = 211/760 (27.76%), Postives = 343/760 (45.13%), Query Frame = 3
Query:  213 IIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKEN-NFVSLVN--GKLFVKADIDRERI-----CTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYI-NGKNGKIFVKQILDYD--QEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLS--VVTKYT--ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCD-VGVNSQLVYRIDHA--HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVV-VKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSG 2435
            I  L V D P   +K+    F ++EHS+   +IG +    R    D      + + + K N + + L+N  G L++++++D E+I       +        LF           Y  + I++ DIND+SP +  S I++ +PE + IG  +Y     D DS          L  V+ S L     ++N   +   L+   L    N  R       L + A+D GSPP + +  L + + D+ND SPVF        + E    D  + ++ A D+D  +N +++++F + +   D SKF + NG  GKIF+K  LD +  +E N  ++ I      + +   + V V + NDN       PH   ++    V+EN    T + ++SA+D D           S G    R  T ++  +V K T  I  ++ LDRE    +  +I   D G  P+V    + + V D NDC+P F     +V ++E +PV S +  L A+D D  G NS + Y I      FS+++ TGVL   S  DRE T  + L     D+          + L + T I + + D+ND  PVF       ++PE       V +VLA DSD +  N ++ Y +V       +  +   F ++    + +T  +LD E  + +   + A D G    + S  +V + +ED NDN P +  +  +     I     +   VT +KA D DSGLNS + Y I   +    FK+N ++G
Sbjct:  691 ITVLDVNDEPPIFSKA-EYNFTIQEHSQALSVIGHVHAISR----DKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLF----------GYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSG--------VLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSAR----SYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKV---DTSKFGLRNG--GKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNN------PHFQQASYAFFVKENEPVATYLGAVSASDSDE---------GSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGG-------NQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSD-QGDNGKVRYKIV-------NGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITW---IYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETG 1385          

HSP 4 Score: 137.887 bits (346), Expect = 1.222e-32
Identity = 180/682 (26.39%), Postives = 303/682 (44.43%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD---STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD----NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRE-TNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITH-RVSVDVVVKI--EDLNDNFPQWSHSSDLGLSINIT---REETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTN 2531
            +++ + D+ND+SPV+       ++ E +   S     +A D+DS  +  IS      V+ S+  L              N   + + + +DRE IE+  L ++A D G+P  + S  + + + D+NDN+P F +      +KEN  +  YL  + A D D   N  +T+ F   +     ++F ++ + GKI   Q+LD + +  +Y+  I  TD   S +  +T + V V++ ND +P  S       +   + V E++   +++ +L ATD D    NS       +      L++V   L++V+        PLDRE T+      +     G     T   I I VLD ND  P F    T   + E +P+ S V  + A D D G N ++ Y+I + +    F I+E TGV+ T    D E T  Y L  +  D          ++  +S  ++ + ++D ND  P F K      I E       V ++ A D D   +N +I Y +        S   + +F ++ +  +  T   +DRE    +S  + A D       R+     +KI  +DLNDN P++       +S N+T    +E     VT + ALD D+G   ++ Y I+  +  + F L+ K+G L L+      D     L +  +D G  PLT+
Sbjct:  898 LELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL-------------RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQV-----AQFIVDKQTGKITTSQVLDREAKA-SYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFS------KNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVS--------PLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGK-------KQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDD-SGLNSRIWYTI-------DSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKF-------VSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK-FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTS 1523          

HSP 5 Score: 120.939 bits (302), Expect = 1.643e-27
Identity = 157/624 (25.16%), Postives = 269/624 (43.11%), Query Frame = 3
Query:  414 NGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISD-NDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEV-NTYLLPIQVTD--STKFAETILLVKVQ--NENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGG-----LKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTT-KIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVF--KKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTK---------ESLDRETYDMHSFSIEAWDSG--PIT 2198
             GK+F+K+ +DRE I     +   L +  I +    +S+  ++++ ++D+ND++P + Q+     + E+  + +      A D D   +  ++     Y  ++Q+  F  + +    K   +Q+L       DRE        ++A D GS P    T +T+ + D+ND SP F K    +++ E+  +   L  + A D D    N  +T+     M +     F +N   G + +   LD  +EV + ++L +  +D    +  ETI  +++   + NDN PV      +N +     V E +   + +A++ A D D             G      K++         T   I   + LD E    +   +   D G   Q T+ +++ I V D ND  P F       +I E VP+ + VT + A D D G+NS++ Y ID     AHF I+  TG+++T    DRE+  EY L+    D+     +   +  L +T  +++II+D+ND AP F  + L Y                 + ED   E  N Q++    + P +T    +  Y  VSPD   F+            SLD E    ++  I A D G  P+T
Sbjct:  965 GGKIFIKSKLDREDI-----EEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVT-----YRFDTQVAQF--IVDKQTGKITTSQVL-------DREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITY-----MIVAGPKAFSLNQVTGVLTLVSPLD--REVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVF-----INETT-FKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINE--------TTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQ-----AFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY-----------------VMED---EPFNFQVTSITALDP-DTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLT 1522          

HSP 6 Score: 119.783 bits (299), Expect = 3.799e-27
Identity = 170/648 (26.23%), Postives = 279/648 (43.06%), Query Frame = 3
Query:  537 EIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQL--LLRVDANIDRXXXXXXXXXXXXXD-SGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAET----ILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQ---VTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI---DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSL 2441
            ++ + + D+ND SP ++++K  + + E   +GS     +A D D    NS     + Y+  +  K FS           LNQ+  +L + + +DRE   +  L ++A D  G+  L   T++ IN+ D+NDN PVF+   T  ++ E   I   +  + A D D  DN K+ +     +N      F IN   G I   + LD+ +  N Y+L +  TD  K  +     ++ + V++ NDN P     P +        + EN+   T + ++ A D D+        +     +  R    ++  T   I  T P+DRE    +   ++  D  +  Q     T  + I + D ND  P F +   T Y+ E  P    VT + A D D G    + YRI   D   FS+D  TGVL+     D E   +Y L  +  D    + S P    L+S  +  V++ D+ND  P F +  +  ++ E       V  V A D D    N +++Y++        S +    FS+     +  T   LDRE  D +  ++ A          S  V + + D NDN P++  S  + L +    E +  RL+  L   D D G N+ + Y I+ GN    F + + +G L
Sbjct: 1104 QVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNS----DITYMIVAGPKAFS-----------LNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKI---VNGNTDGTFKINETTGVISTLRALDF-EVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIIT------WIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDS--QSPRAHFKINSETGL-IQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLT-YVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATD----LGSPP----LTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRD-SGSNAELTYSI-------PSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFI-SPVVTLKV---PENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGEL 1702          

HSP 7 Score: 117.472 bits (293), Expect = 1.980e-26
Identity = 146/548 (26.64%), Postives = 241/548 (43.98%), Query Frame = 3
Query:  855 DSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD-----NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIE-AINRQISY---------AMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSG 2435
            D GSPPLT      + + D+NDN P F + L   ++ EN      + ++ A D D   N +LT+S  + + ++   KF I+  +G I    ILD +++ +TY L +  T  +   + + T + + V + NDN P   I P V      L V EN      I +L+  D+D          I   ++ G   + R   +LS  TK        LDRET   +Q +++ +D   P       I I + D+ND  P F  ++ +  I E  P  + +  L ASD D G N  +VY +    +  +SID  TG++ + + F+     EY       D+      DP   ++     +R+ I+D N+ AP F K  YE  I   +S    V  V A D+D + + N +++Y         ++ +    T S  +   FS  P GR               H+  I A D G    R    V + I ++ D+ P++ + +   +S  I     VG  +T ++A    +  ++ + Y II GN+   F ++  +G
Sbjct: 1515 DLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMD---KFSIDKHSGLIVTNSILDREKK-DTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKF-ISPVV-----TLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTK--------LDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQ----GQDPKMAIVP----VRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGR---------------HALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVS--IPENSKVGSYITTVRA---RASSDAQVTYSIISGNKGRAFYVDPFTG 2015          

HSP 8 Score: 111.694 bits (278), Expect = 1.113e-24
Identity = 161/706 (22.80%), Postives = 300/706 (42.49%), Query Frame = 3
Query:  243 MKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSL----VNGK--LFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQL-------LLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST-KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTD-------LSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHA---HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGS--SPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDN---FPQWSHSS 2273
            + ++ ++   +QV E++ IG  +  +     + D D  +   +N  +   + + S+    +N +  + V   +DRE      +    L    I      ++     +I++ D+ND +P + +      + E++ + +   +  A D D             + +NS+L +++I  N+   ++YL+         ++    ++DRE+I ++ L +L  D GSPPL+ +  + +N+TD NDN P F +     S+ EN+     + Q+ A+D DI +N  + +S      +   + F+++ + G +   + LD++ + ++Y   +  TD   +     + V + + NDN PV       + S+  +   EN +   +I  L A D D+               ++R + +        SV     I L K LDRET + +  T+K  D G    V   I+NI VLD ND  P F  A     I E     S +  ++A   D G N+++VY I      +  +  +TG L   S  D EK     L     D+        T  +     +   +I DIND +P F        +PE +      Y  SV   DS +     ++S++++  P         L+   S  G +  TK      +   ++  ++A D G      +  + +K+ D+ND    F  WS+++
Sbjct:  279 IHVSYTLGGSYQVTENATIGTQVARV----SVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRE-----THDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQD-------------FGSNSEL-VYTIA-NTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSI-----LTPNTPFFLDPRKGLVTNSRTLDHEVQ-SSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVF------DPSSYSVEYFENTRIGQSICQLKAIDRDSPK-----------FAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKG-------TPPLFGYANVTIAVI-DINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLG---RVSFSLLSNP-------GTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTA 919          

HSP 9 Score: 107.071 bits (266), Expect = 2.679e-23
Identity = 181/714 (25.35%), Postives = 310/714 (43.42%), Query Frame = 3
Query:  528 NYFEIQISIEDINDHSPVW-TQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKP--LTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXG--GLKLSRV-LTDL----SVVTKYTILLTKP------LDRET--------------NEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVN-SQLVYRIDHA-HFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWS--HSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIR--LVVKVSDSGPSPL-TNTTIV 2543
             Y  +QI I +I D  P +  Q+   ++IPE+SK+GS  Y+   +   SS     ++ T   ++ ++ + F +         +   + +     +D E  +   L L+A   G   L G   L IN+ D NDNSP F     L +++     F  +++ ++ A D+D   N K+T+S   GN   +     F I+   G+I   ++LD +    ++ L I+ TDS    K     + V V + NDN P+   L  VN       + E+ +    + S+ ATD D  S +     S+   G+ + RV  TD     +   KY+  +T        +D +T              + F Q  ++  D G PPQ     + I +  +    P F        + E   + + V  +  +D   G+   ++ Y I+++ +F I + +GV+  N   D E    + L  +  D     D+ P++ V      + + + D+ND  PVF +  Y     EG      V +V A D D  A N ++ +A+       +S   K  F++     +  T+ +LD ET   H  S+ A D G       V V +++ DLNDN P +     +D+ +  N+       RL  +  A D DSG N+ L++ +I G    LF +++ SG L         +  + +  L +K +D+G  PL +N TI+
Sbjct: 1944 GYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGS--YITTVRARASSD----AQVTYSIISGNKGRAFYV-------DPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV-----FTIDSTTGEITTAKLLDRETTA-SFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVN-------IREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAID-----DTAPSKPV---RVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGA-NGRVWFAI-------QSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNS---RLYEI-NATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITII 2607          

HSP 10 Score: 104.76 bits (260), Expect = 1.430e-22
Identity = 148/613 (24.14%), Postives = 267/613 (43.56%), Query Frame = 3
Query:  528 NYFEIQISIEDINDHSPVWTQSKIVINIPEHS-KIGSRYYLPL-AKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMN-----IEDRSKFYINGKNGKIFVK------QILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAP----------VISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKY-------TILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFK-----KLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFS--IEAWDSG--PITHRVSVDVVVKIED 2237
             Y  + I++ D ND+SP +  S ++  + E +     R+ + + A D+DS  +  ++ Y++   N  +  +F+I  +S   +    +LL       DRE     +L++   DSG PP + +  + + +TD+NDN P+F  PL+E++I+E+      +  + A D D     +LT++  ++       +   +    +G N +I           +DY  + +T ++  + T   +  ++ + + VQ  +   P          +I+  P     +    V EN    T++ ++  TD            ++ GL L R+  ++     +        I + KPLD ET   F   +   DD  P +     + I V D ND  P F  +       EG+PV + V  ++A+D D G N ++ + I    D   F+ID  TGV+RT    D E    + +     D      S P    +S T  IRV+  D+ND  PVF+      +    ++P  S  R+Y   + A D D  A N ++S+ ++           +  F +       TT  + D E   ++ +S  I+A D+G  P++  +++ V V  ED
Sbjct: 2049 GYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVT-YSIWTGN--EAGVFTI--DSTTGEITTAKLL-------DRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF-DPLSEVNIREDTRTGAVVTSVVATDTD--KESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTD------------NAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDE----GSPPMHTDVSVT--IRVL--DLNDNPPVFRVPGPNDVQVLENLPLNS--RLY--EINATDRDSGA-NARLSFTVI-------GGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADED 2614          

HSP 11 Score: 102.834 bits (255), Expect = 5.439e-22
Identity = 135/529 (25.52%), Postives = 227/529 (42.91%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLD------------SSPDNSISRYTLK---YVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDAN---------ID-RXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGN-SMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETI---LLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPA-AITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSD 2006
            +S   ++++ + D+ND+ P++     V NI E ++ G+     +A D D            S+P  +I R +       +N+Q+K    + NS       +Q+  ++DA+         ID R +   I++ + A D G PP     ++ I IT      P F  P     + EN  +   +  +   D      +      G  S NIE+ + F I  ++G I V + LDY+ +   +LL +   D T  ++ +   + + V + ND  PV         S  +    E I   T + ++SA D D+ +      +   G        D        I   + LD ET +    +++  D+G PP  T   + I+VLD ND  P F       V + E +P+ S + ++NA+D D G N++L + +        F ID+ +G L TN  FD E T  Y+   T+        +D     LSS   I V + D ++  P F ++ Y+F +P  +    +VG V A D D
Sbjct: 2154 KSTNCQVKVVVTDLNDNPPLFDPLSEV-NIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNS-------DQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTSVLTVRVTD------NAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETK-RRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFG------QSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKT---GVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKA------TDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRD 2648          

HSP 12 Score: 68.9366 bits (167), Expect = 1.132e-11
Identity = 67/277 (24.19%), Postives = 121/277 (43.68%), Query Frame = 3
Query:  897 INITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTK--PLDRETNEFFQ--ATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVY 1706
            IN++D+ND  PVF +        E   +   +  + A D D   N ++ F+  +    +D+  F I+ K G I  ++ LD+ + + T+ + ++ TD        +  + ++V + NDN PV  +        N + V EN+   + +  ++ATD D+ +      +  GG      L D     K++  LT     D E    +Q   TIK  D G PP  +   I + V D+++  P F        +     +  FV ++ A+D D G   ++ +
Sbjct: 2395 INVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSG---DDKGSFAIDRKTGVIRTQRALDH-ETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRV-----PGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLID-----KFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFF 2657          

HSP 13 Score: 50.8322 bits (120), Expect = 4.109e-6
Identity = 78/292 (26.71%), Postives = 132/292 (45.21%), Query Frame = 3
Query: 1731 IDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYV--------GSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIF------TTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI-IQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIR---LVVKVSDSGPS-PLTNTTIVRI 2549
            ++ N GV+ T ++ DREK   Y L    +       S P +    S T++ V ++D+ND +P F +         G+S ++ V          ++A DSD  + + Q SY +V        ++ KL      DG ++       +   +DRE  D +  +I A D G   +   + + + +ED NDN P++S+ S  G    I     VG  +  + A D D G N+ + Y I    +   +F ++  +G   ++   +  D E  R   +VVK  D G S  L+++ IVRI
Sbjct:    7 LEYNAGVITTKTVLDREKVSAYNLTIVEF-------STPPK----SYTVL-VYVQDLNDNSPSFVR---------GTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQ-SYTIV---SGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSG---TIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTG---VIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRI 267          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 166.777 bits (421), Expect = 1.238e-41
Identity = 187/730 (25.62%), Postives = 329/730 (45.07%), Query Frame = 3
Query:  411 VNGKLFVKADIDRERICTKKNQCCCLNLFVIVYN-LKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVD---ANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMD-NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISK----LYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVS-VDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRI 2549
            V G++   A++DRE +   +       LFV   + + + S+  ++ + +ED+ND+ PV++     I   E S  G+      A D D              + ++   L+SIV N + D   +N +   +    + +DRE  E     + A DSG P  + +  + I + DINDNSPVF        ++EN      +  + A D D+  N KL++     +     ++F I+   G I  ++ L+  +E  +Y L ++  DS    +   T +++ V + ND+      +P    S     V E+++    +  ++ TD D N +  +    SSG   L   + + + +       T  LDRE N  +   I  +D G P   +   + I + D ND  P F  ++  V + E V +++ V ++ A+D D G N Q  Y+I        F ID NTG++   +  D EKT  Y L  +  D    + + P    L+    + + + D++D APVF K  Y   + E  +   +V +V A D D EA ++++ Y +     ++   I +    +  + +P G        L+RET+  +   + A     +T + S V  V+ + D+NDN P++   S +   +  T   T   ++TV KA D D G +  + + I+ GNE+ +F+++ K+G L   +     D     LVV   D G   L+++  V I
Sbjct: 1243 VTGEIRTVAELDRENVTQYE-------LFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDAD--------------IGDNAAVLYSIVEN-VTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVL----YTRFAIDPDTGNITTREPLNR-EETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDH------VPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIIS----TTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQD----LGTPP----LTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSG-------CLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTV-KAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNI 1919          

HSP 2 Score: 166.007 bits (419), Expect = 2.271e-41
Identity = 182/681 (26.73%), Postives = 297/681 (43.61%), Query Frame = 3
Query:  561 INDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLF------SIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQE-VNTYLLPIQVTDSTKFAETIL--LVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTD---LSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLK--AXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIY 2552
            IND SP++ +S   +N+ E +  G    + + +   +  D  I+       N ++ K +       I+ +S  D+ + N  +L V A                  +G+   T   H+T+  TD+ D+ P F      + + EN  I   + ++ A D DI D    + + G+   +     F I+   G+I  + + + D+E V  Y L +Q  DS      +L  +V+V++ NDN PV S+  +       +   E   + T+I  + A D D                +   +TD   ++ +T    L +  LDRE  E+F  TI+  D G P + +T  + I+++D ND +P F       Y+ E  P  + V  + ASD DVG N++L Y +    +  F+ID +TG + T    +RE+TG Y L         L   D   +    TT + + + D ND  P F +  Y FS+ E       VG V   D DI   N ++ Y +        S  + L FSV+    I +T  +LDRE    ++  I A D G      +  V++ IED+NDN P +S S       N+T  E+V     V++  A D D G N    Y+I  G+  ++F ++  +G + +  +       +  L V   D G  PLT    V I+
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRG----IVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTA--------------ANIVAGAQDTTTQVHITV--TDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGL-----FTIDNVTGEI--RTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYT------IEYWEESPEGTSILQVKAIDADIGDNAAVL------YSIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTL--------TLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDIND-NARVRYYI-------SSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKS-----VYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIH 1702          

HSP 3 Score: 121.324 bits (303), Expect = 1.160e-27
Identity = 144/545 (26.42%), Postives = 232/545 (42.57%), Query Frame = 3
Query:  891 LTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD---STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETA-----IASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF---PA---AITTVYIDEG-VPVESFVTKLNASDCDVGVNSQLVYRI---DHAHFSIDENTGVLRTNSIFDREK---------TGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFS-IEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSL 2441
            +T+ + D+NDN P F        I EN      + Q+ A D D  +N +L+F+       +D   F ING +G +   + LD  + + TY L +   D   S++     L V V +ENDN P I+         + L +  NI +        ++S++A D D  S      S SGG   SR    L+  T    +    LDRE  + +   I   D+G PP   +  +++ +LD ND TP F   PA   A   + +DEG   +   +  +NA+D D   N ++ Y +   +H  F +D  TG L      DRE           G + L+ T  D+     + P     S+T  + + ++D ND +P F+   YE  + E + P   V  V A D D+E   + I Y +       K  + KL                     Y+ H  + +   +S     R    VV+ ++D+NDN P ++ S     + ++      G  V  + A D D G N  + Y++  GN+ + F +N  +G +
Sbjct:  480 VTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAG---DDGGHFSING-SGLVTTARELDR-ETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQIT---------DGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD--SRFT--LNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQ-----ATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVI-YNITDGDENRKCEVEKLV------------------RHYNWHKKNCVLCKESKCSVERTY--VVIYVDDVNDNDPVFNQSK---YAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEI 977          

HSP 4 Score: 115.931 bits (289), Expect = 5.778e-26
Identity = 178/683 (26.06%), Postives = 281/683 (41.14%), Query Frame = 3
Query:  522 QSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTF--SFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFA---ETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLT--KPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVY-RIDHAH----FSIDENTGVLRTN----SIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSP--RMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGL---SINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSD 2507
            +S+   + I + DIND+SPV+  +     + E+   G+   +  A D D   +  +S     YV      L  ++Y           +  R   N  RE+     L L A DS      G+T + I +TD ND+ P F +     S++E+  +   + ++   D DI+DN ++ +  S GN+  +     F +N   G I     LD +Q   +Y L I   D    A    T +++ +++ NDN P+ S      S  NV L  E++  +T +  + ATD D  +        + G        D+  +   T L+T    LD E    +  T+  QD G PP      + I V D +D  P F     +  + E V     V  +NA+D D   + + VY RI+  +    F I E +GV+  N       +RE    Y+L+     R NL     TE+      +I V+  D+ND AP F    Y  S+ E + P     + +V A+D D E  + +I + +V       S      F +     + T    LDRE    +S  + A D G      SV V + + D+NDN P      D+ +       + +E +   V V      D    + + Y I    E + F LN+ SG L         D  +  L VK S+
Sbjct: 1379 KSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLS-----YV------LSGVLYTRFAIDPDTGNITTREPLN--REETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLM-----FSVNETTGIISTTSTLDREQNA-SYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFS-----KSVYNVTL-RESVFLKTQVVQVIATDPDEGANGQFTYKITAGDT-----DDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNL-----TEQKSLVPAVITVL--DVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGD-EGESGEIIFTIV-------SGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASN 2016          

HSP 5 Score: 105.531 bits (262), Expect = 9.171e-23
Identity = 209/819 (25.52%), Postives = 344/819 (42.00%), Query Frame = 3
Query:  204 SKFIIFLIVVDFPMKMAKSISLQFQVK--EHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENN------FVSL--VNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNL---KIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDK-------LTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVN-------------------------TYLLPIQVTDSTKF-AETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSV-VTKYTILLTKPLDRETNEFFQATIKCQDDG-YPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAP-VFKKLFYEFSIPEGSSP-RMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSIN-ITREE---TVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIR 2486
            SKF  FLIV D+           +  K  E++ +G  I       +I   D     N   Q    N       F SL  VNG+L +   +D E             L VI  +L   K++S    I I + DI+D  P + QS  +  I E++ IGS      A+D D   +N I     + ++ +   +F+I  N+          ++ V+ +ID EK +   + + A +   P    +  + + + D+NDN P FL+ +    ++E+  +     ++ +  L ++D DK       L    G      D  KF I+  +G +++ + LDY++++N                           ++  +   S KF A   + + + N NDN P+ +      SS N  + EE I   T IA ++ATD D  +         GG          SV     TI   + LD +T   +Q ++  +D G +  ++    + + + D ND  P F     T  I E +P  + V ++ A+D D G N +L + I    D  HFSI+  +G++ T    DRE    Y L  + YD    V S      L+      V + D ND  P +   L    +I EG+    + + S+ A D D  + N Q++Y+M        S     +   S  GR+  +   LDRE  D +   I   D+G   +  S  V V I D+NDN P +  +    L+   IT +E   T+ + +  + A D D+  N  + Y +  G+EH  F+L+  +G L + K+     P++ R
Sbjct:   29 SKFF-FLIVDDYNDNAPVFTEQPYMAKIAENARVGTTI------LKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFE-------VARSYMLVVIAEDLGVPKLESRTTVI-IEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPI---LYEIISGNSDGVFTIDSNTG---------VITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALP---GRVVSDQLQVTDGDKNPVFRRVLYHLVG-----ADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFA-----KSSYNYTMDEE-ITPGTHIADITATDADLGTFGALTYELRGGQAAY-----FSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSIN-GSGLVTTARELDRETIATYTLTVSAYDHG--VSSRHKHVQLT------VNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGS-NGQLTYSM--------SGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSL-SGDEHGFFRLDPVTGELSVRKELDRESPQMSR 782          

HSP 6 Score: 103.605 bits (257), Expect = 2.828e-22
Identity = 131/516 (25.39%), Postives = 225/516 (43.60%), Query Frame = 3
Query:  903 ITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAE---TILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDM---DNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIK--DINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQ 2426
            IT IND SP+F K +  +++ E+      + ++ A D D   N  + +S   +      +KFY++   G I V   LD + + N Y+L +   +    A+   T + + V +      VI   P+ NSS+  + + EN    T +  ++A D    D  S  I+     G   +  V  ++  V +        LDRE    ++  ++ +D         K++ +QV D ND  P F     T+   E  P  + + ++ A D D+G N+ ++Y I      ++  T  +  N+I      G  +L+  V +  N         V S ++   V IK  DIND +PVF    Y   + E       V  V A D D+   N ++SY +        S +    F++ PD    TT+E L+RE    ++ ++ A DS       +  V++ + D ND+ PQ++ S   G + ++  +  VG  V  +   D D   N+ + Y I  GN   +F +N+
Sbjct: 1079 ITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGA-----EAKFYVSRSTGDIIVDSPLDREFK-NVYILNVTAANIVAGAQDTTTQVHITVTD------VIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAE--------LDRENVTQYELFVQAKDSVNLVSDLLKVV-VQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSI------VENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDV-GTNAKLSYVL--------SGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQS---GYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNE 1555          

HSP 7 Score: 98.9821 bits (245), Expect = 8.283e-21
Identity = 154/623 (24.72%), Postives = 255/623 (40.93%), Query Frame = 3
Query:  540 IQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLT-EISIKENNFIDQYLCQMFAK-DLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEV-NTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQD-ETAIASLSATDMDNXXXXXXXXXXXGG----LKLSRVLTDLSVVTKYTILLTKPLDRETNEF---------FQATIKCQDDGYP---PQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG-PITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVL 2336
            + ++++D+ND+ P +T      +I E+   G+  +   A D DS  +    R +           FSI  + L          +     +DRE I    L + A D G         LT+N+ D NDN+P     LT   +I E       L    A  D D   N +LT+S          S+F +N   G++ +      D+E+ ++Y L I VTD+        T + V + + NDN P     P  + +  V+ V+E        +  ++ATD D  +      S SG      +L  V  +LSV         K LDRE+ +          F   I   D   P    +  T  ++I V D ND +P F +      + E     S V +++A+D D+    +++Y I       DEN           R+   E  +    + ++N V    ++  +  T ++ + + D+ND  PVF +  Y   + E S     V  V A D D +  N +I+Y +     +    I+ +   ++  G I       DRE       +++A D G P + +   +VV+ ++D NDNFPQ+S +   G    I     VG  +T++
Sbjct:  480 VTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGEN---GRLSFNISAGDDGGHFSINGSGL----------VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGG-----DSRFTLNSATGRLQISPT-GLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSV--------RKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDG----DEN-----------RKCEVEKLVRHYNWHKKNCVLCKESKCSVERTYVV-IYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRD-QGANGKITYKLTNGNKDDAFSINNVTGEITVAGVI-------DREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFT---GYEGEIAENSPVGSTITMV 1048          

HSP 8 Score: 96.2857 bits (238), Expect = 6.206e-20
Identity = 136/540 (25.19%), Postives = 229/540 (42.41%), Query Frame = 3
Query:  273 FQVKEHSEIGLLIG-------DLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFV----KQILDYDQEVNTYLLPIQVTDSTKFAETILLV----KVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTD--LSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHF--------PAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-----DHAHFSIDENTGVLRTNSIFDREKTGEYKL 1802
            F V+E  ++G  +G       D+ +N R++ +  S   +L F        V+   G +   + +DRE     +N    L +    + +    +   + I+IED+ND+ P++++S   + + E   + ++    +A D D   +    ++T K        +F I  N+          L+ + A +D EK     L + A+D G+PPLTG+  + I+++D++DN+PVF KP     + EN     ++  + A D+D   + K  +    S N +  S F I  ++G I +       L+ +     Y L +         E   LV     V + NDNAP      +V S   VL     I D T I ++ A D D   +     +   G +      D    V+T+     T+PLDRE   F+   +  +D G P   ++  +NI VLD ND  P          P   TT  + E +     V  + A D D      L+Y       +  +F ++E +G LRT    DRE +  + L
Sbjct: 1510 FSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFS-------VNETTGIISTTSTLDRE-----QNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGAN---GQFTYKITAGDTDDVFYIDANTG---------LITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTD--SMFLIGEQSGVITLNCTPSGCLNRETHAR-YELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRS---VLEDTGPITDAT-ILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTR-----TRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDT---KNLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYL 2010          

HSP 9 Score: 89.7373 bits (221), Expect = 5.177e-18
Identity = 187/830 (22.53%), Postives = 326/830 (39.28%), Query Frame = 3
Query:  303 LLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSL-VNGKLFVKA--DIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIE--DINDHSPVWTQS-KIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVF----LKPLTE--ISIKEN-NFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYD--------QEVNTYLLPIQVTDST------KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH----FSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEG-----------------------SSPR---------------------------MY-------------VGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDS 2510
            L  G +V      D D      L+F +   ++     +NG   V    ++DRE I T         L V  Y+  + S +  +Q+++   D ND++P  T    I  NI E +  G+     +A      PD   S   L Y  +     F++  NS   +  ++         +DRE  +  +L++   D+GSPP T ST + + I D+NDN+P F     + L    I++ E    I++ L  + A D D   N K+ +S       ++   F ++   G++ V++ LD +        Q    +LL I  TD        K A   + + V++ NDN+      P   S N    + E  +  + +  +SATD D                  +V+ +++   +      + L R  N   +  + C++     + T  +I +   D ND  P F  +     + E  P  + V +++ASD D G N ++ Y++ + +    FSI+  TG +    + DRE    + L     D+      +P+ +   +  +I V  KD ND  P F    YE  I E                        SSPR                           MY             +G V A D D E IN  I Y+         S+ ++  F VS           LDRE  +++  ++ A +        +  V + + D+ D+ P ++ SS   L++ ++   ++G  VT + A   D  +  +++Y I  G+ + LF ++  +G +  + +    +     L V+  DS
Sbjct:  507 LPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTARELDRETIAT-------YTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAA---VDPDAG-SNGQLTYSMSGGDSRFTL--NSATGRLQISP------TGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSG----DEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNS------PQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYK-------------GKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCSVERTYVVIYVD--DVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQ-----GEPSSRKTFAEVVITV--KDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRD-EGINAIIFYS---------SNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSS---LTVKLSENASIGTNVTKITA--LDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDS 1270          

HSP 10 Score: 82.0333 bits (201), Expect = 1.179e-15
Identity = 124/553 (22.42%), Postives = 233/553 (42.13%), Query Frame = 3
Query:  855 DSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD---STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYI-----DEGVPVESFVTKLNASDCDVG-VNSQLVYRI---DHAHFSIDENTGVLRTNSIFDREKTGEYKLE---------ATVYDRRN--------LVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSV-DVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLN 2423
            + G     GS    + + D NDN+PVF +      I EN  +   + ++ A D D   N ++ + F N+   +    F +N  NG++ +   LD+ +   +Y+L +   D       + T ++++V + +D      + P    S  +  +EEN    + + ++ A D D             G        D +      I +   +D E  + F+ T+K  +    P   +      V+   D   + PA + +VYI     D  +P      +L  +D D   V  +++Y +   D   F+ID  +G L  N   D EK   +  +          + +D             ++D +EK  ++ ++   +I ++ND  P+F K  Y +++ E  +P  ++  + A D+D+         A+    YE +      YFSV+ D    +  + LD +T   + FS+   D G     +++  V V ++D+NDN P+++    +  + +I      G +V  + A D DSG N  L++ I  G++   F +N
Sbjct:   20 NGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQ-TPFFSLNSVNGELTLGGPLDF-EVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISD------MPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNT---GVITVNGSIDAEKTDVFRITVKASE---VPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLI-NVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFG-----ALT---YELRGG-QAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTG---MPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSIN 545          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 166.392 bits (420), Expect = 2.025e-41
Identity = 194/743 (26.11%), Postives = 325/743 (43.74%), Query Frame = 3
Query:  309 IGDLVENYRIQDFDLSRRENLNFQMMKEN--NFVSL--VNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQS---NYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSV-VTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI-----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPL-SNDPEIIRLVV 2495
            +  LV   R  D D      + F+++  N  NF S+  +NG++ VK  +D E I          NL V   + K Q    N   + I++ D+ND++P +  S     IPE+  +G  +Y   A D D   +  I+              FS + N LP     N   + +   +DREK+ K    + A D G P   G+  +TI + DINDN P F +     SI EN+     + Q+ A D D S    + +S  +S    DR  F IN + G I +   L+Y+ + + Y+  +  +D    +  ++ V V + N +AP      +         V+E+    T++ ++ ATD D  S             ++ ++ + SV  T   I     LDRE  + ++  +   D G P       + I + D ND  P F        + E +     V +++ASD D+G N+Q++Y           F+ID   G++RT    DRE   EY+L     D+     + P +    ++  ++VI++D+ D  P+F+K  YE ++PE + PR  V +V A+  D+      + Y++V          S   F ++P+     T   LD ET   +  ++ A  S   T      V+V ++D+NDN P           +NI  +E         K    D  ++  L +++++GN  E   LN  SG L + K+ + ++ P  I++ V
Sbjct:  249 VNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGV-------FNLLVTAQD-KGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEIT--------------FSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPD-SGPTNVVYSIVSSSG-HDRC-FRINPQ-GLITLSCTLNYNTK-HVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAE------VKEDASLGTSVLTVLATDRDTGSNAKIS------YSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQ----GTPPGQ----ASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSP-ETGMMYSIV-------RGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSPFFTE---TTVMVYLKDINDNTPVLE-----AFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGNAKEWVTLNATSGELSVNKKLIQASKPANIKIAV 928          

HSP 2 Score: 142.124 bits (357), Expect = 5.214e-34
Identity = 165/587 (28.11%), Postives = 263/587 (44.80%), Query Frame = 3
Query:  528 NYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSF--GNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSV-VTKYT--ILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATV-YDRRN--LVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFP 2255
             Y ++ I++ D+ND+ P++ ++    +IPE   IG       A D DS  +  +    L   ++     FSI   S           + V   +DREK+    L + A+D G+PP + +  + I + D+ND +P F K +   +I+E+  ++Q +  + A D D   N ++ F    GN MN      F IN  NG++ VKQ LDY+  +  + L +   D  +   + +T + + + + NDNA      P   SS+   ++ EN         + A D D+         ++G +  S +  DL   + + T  I + + LDRE    F   IK +D G P +  T  I I +LD ND  P F        I E     + V ++ A D D G  + +VY       SI  ++G  R    F     G   L  T+ Y+ ++  +     ++ +LSST ++ V + D N  AP FK+  Y   + E +S    V +VLA D D  + N +ISY++     E         FSV     +  T  SLDRE  D + F + A D G    +    V + I D+NDN P
Sbjct:  110 GYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILN--SDGDNSAFSIGEVSGA---------VTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNF-----FSINRINGEVRVKQKLDYEM-IGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNA------PQFVSSHFQTMIPENYAVGQEFYRVQAYDKDH--------GTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSG-PTNVVY-------SIVSSSGHDR---CFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGS-NAKISYSIATLVPE---------FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDP 644          

HSP 3 Score: 130.954 bits (328), Expect = 1.432e-30
Identity = 118/461 (25.60%), Postives = 200/461 (43.38%), Query Frame = 3
Query:  918 DNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTK---FAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIA----SLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI----DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSH 2267
            +N P F +   + S+ E+  +   +  + A D D   N  + +S   S N+   + F I+   G I  K+ LD  + ++ +   ++  D  +        L + V + NDN P+           N+   +  I ++ +I     ++ A+D D+ S              +   +   V    T++  K LDRE    +   ++ QD G PP+  T  + I +LD NDCTP F   + +  I E VPV   VT + A+DCD G N ++ + I    D   FSI+   G +R     D E  G + L  T  D+         +  L + T + + + D+ND AP F    ++  IPE  +       V A D D    N +I+++ +          + L FS++ +    + KE LDRE     +F I+A D G      +  + + + D+NDN P++S 
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLD-REFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFE--------RNIYAAD--IPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVM--KKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDK--------GQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKD-HGTNGEITFSFM---------QNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQ 444          

HSP 4 Score: 120.939 bits (302), Expect = 1.669e-27
Identity = 172/662 (25.98%), Postives = 284/662 (42.90%), Query Frame = 3
Query:  606 NIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDST---KFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGG-----LKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRI--DHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEII---RLVVKVSDSGPSPLTNTTIVRIY 2552
            ++ E +++G+      A D DS   N + RY++    N    L S  Y S+   T +    +     +DRE +++    + AED G P L G   LTIN+ D+NDN P+F + +    I E+  I  ++  + A D D   N ++ +   NS    D S F I   +G + V + LD  ++V TY L +Q  D     + A   + + + + ND  P  S    V S+     + E++     + ++ ATD D  S          G       ++R+  ++ V  K        LD E    F   +  QD G P       ++I ++D ND  P F ++     I E   V     ++ A D D G N ++ +    +   FSI+ENTG +      DREK  ++       D+       P ++    T  I + + DIND  P F +  Y  SI E S     V  V A D D    N  + Y++V      +       F ++P G I T   +L+  T  ++ FS+ A D G ++   +  V V + D N + P++   S    S  +  + ++G  V  + A D D+G N+ ++Y I        F +++ +G   ++K   S D E +   R  V  +D G   L   + V I+
Sbjct:   28 SVSEDAEVGTVVATVSASDPDSG-SNGMIRYSMSPSQN----LMSATYFSIDQITGV----ITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDG--DNSAFSIGEVSGAVTVMKKLD-REKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFS--KKVYSAT----IREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQK--------LDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDK-----GVPFKE---GTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTN--VVYSIVSSSGHDRC------FRINPQGLI-TLSCTLNYNTKHVYVFSVSASD-GMLSS--TALVYVNVTDSNTHAPEFKRRS---YSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI--ATLVPEFSVDETTG---VIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIH 635          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 226.483 bits (576), Expect = 1.633e-60
Identity = 227/801 (28.34%), Postives = 370/801 (46.19%), Query Frame = 3
Query:  264 SLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFV-KADIDRE--RICTK--KNQCCCLNLFVIVYNL--KIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT---YLLPIQVTDSTKFAETILLVKVQNENDNAPVISI--LPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLS-RVLTDLSV--VTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTV-YIDEGVPVESFVTKLNASDCDVGVNSQLVYRID-----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKE---------SLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKL 2576
            S+ ++V+E      LIG L  ++ + D     +  +    ++    V    G +F  +  IDRE  R C    K + C L   V V +L         E +I ++DIND++P +  S + I++PE++ +G+ + +PLA D DS   N ++ Y L    ++       V +    K  L QL+  V  N+DRE  +  +L + A D G+P       L + +TD NDNSP F  P  E  + EN+ +   + Q+ A D D+  N ++ +S   +++   +    I+   G I+VK  LD  +E+N+   Y++        K ++T + ++V ++NDNAP + I  +  V  S  +  + E++   TA+A +  +D D     +     +G +    R  +D +     KY +  T PLD E  + ++  I   D G P   +T  + +QV D ND +P F   I  V + +E  P E+ +  + A+D D G N++L Y I         F ID NTG ++  +  DRE    Y+   T  D+       P  K  ++T +I+V+  D ND  P F    Y FS+ E   P   VG V   D D                   K   + ++ SV PDG  F  +          S DRE    ++F ++A D G       V V + + D NDN P  +  S+      ++   +    V V++A D DSG N+ L + I  GN ++LF+++  SG + L K+       + RLVV+VSD G  P   T +V IY +  +S +
Sbjct:   23 SILYRVQEEQPPNTLIGSLAADHGLPDSGHLYKLEVGAPYLR----VDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSE-RNGVADYALTAGPDAATLFGLQVADDRGGK--LPQLI--VLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPK-LLRIDRTTGIIYVKGPLDR-EEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETIL-DVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADK-----GSPVHKG-TATVVIKVL--DCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMD-------------------KGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFR-QLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNV 783          

HSP 2 Score: 62.3882 bits (150), Expect = 2.563e-9
Identity = 96/352 (27.27%), Postives = 153/352 (43.47%), Query Frame = 3
Query: 1596 PAAITTVY-IDEGVPVESFVTKLNASDCDVGV-NSQLVYRID--HAHFSIDENTGVLRTNSI-FDREKTGEYKLEATVYDRRNLVDSDPT--EKVLSSTTII----------RVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRI--FTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEH--ELFKLNQKSGSLYLMKQPLSNDPEI--IRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPA 2582
            PA  + +Y + E  P  + +  L A   D G+ +S  +Y+++    +  +D  TG + T  I  DRE         T+ D R+LV   P   E  +S T ++          R+ ++DIND  P F       S+PE +         LA D D E  N    YA+   P    + +  L  +    G++       +LDRE  D +  +I+A D G         + V + D NDN P++ H S       ++    VG  V  +KA DSD G N  + Y + Q  +   +L ++++ +G +Y+ K PL  + EI  +   V   D GP P ++ T V I    +    PA
Sbjct:   19 PAKGSILYRVQEEQPPNTLIGSLAA---DHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRE---------TLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSER-NGVADYALTAGP--DAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPS---YEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYV-KGPLDRE-EINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPA 350          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 226.483 bits (576), Expect = 4.495e-60
Identity = 226/801 (28.21%), Postives = 370/801 (46.19%), Query Frame = 3
Query:  264 SLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFV-KADIDRE--RICTK--KNQCCCLNLFVIVYNL--KIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNT---YLLPIQVTDSTKFAETILLVKVQNENDNAPVISI--LPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLS-RVLTDLSV--VTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTV-YIDEGVPVESFVTKLNASDCDVGVNSQLVYRID-----HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKE---------SLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKL 2576
            S+ ++V+E      LIG L  ++ + D     +  +    ++    V    G +F  +  IDRE  R C    K + C L   V V +L         E +I ++DIND++P +  S + I++PE++ +G+ + +PLA D DS   N ++ Y L    ++       V +    K  L QL+  V  N+DRE  +  +L + A D G+P       L + +TD NDNSP F  P  E  + EN+ +   + Q+ A D D+  N ++ +S   +++   +    I+   G I+VK  LD  +E+N+   Y++        K ++T + ++V ++NDNAP + I  +  V  S  +  + E++   TA+A +  +D D     +     +G +    R  +D +     KY +  T PLD E  + ++  I   D G P   +T  + +QV D ND +P F   I  V + +E  P E+ +  + A+D D G N++L Y I         F ID NTG ++  +  DRE    Y+   T  D+ + V         ++T +I+V+  D ND  P F    Y FS+ E   P   VG V   D D                   K   + ++ SV PDG  F  +          S DRE    ++F ++A D G       V V + + D NDN P  +  S+      ++   +    V V++A D DSG N+ L + I  GN ++LF+++  SG + L K+       + RLVV+VSD G  P   T +V IY +  +S +
Sbjct:  100 SILYRVQEEQPPNTLIGSLAADHGLPDSGHLYKLEVGAPYLR----VDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSE-RNGVADYALTAGPDAATLFGLQVADDRGGK--LPQLI--VLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPK-LLRIDRTTGIIYVKGPLDR-EEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETIL-DVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKG------TATVVIKVL--DCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMD-------------------KGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFR-QLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNV 860          

HSP 2 Score: 62.3882 bits (150), Expect = 3.175e-9
Identity = 96/352 (27.27%), Postives = 153/352 (43.47%), Query Frame = 3
Query: 1596 PAAITTVY-IDEGVPVESFVTKLNASDCDVGV-NSQLVYRID--HAHFSIDENTGVLRTNSI-FDREKTGEYKLEATVYDRRNLVDSDPT--EKVLSSTTII----------RVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRI--FTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEH--ELFKLNQKSGSLYLMKQPLSNDPEI--IRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPA 2582
            PA  + +Y + E  P  + +  L A   D G+ +S  +Y+++    +  +D  TG + T  I  DRE         T+ D R+LV   P   E  +S T ++          R+ ++DIND  P F       S+PE +         LA D D E  N    YA+   P    + +  L  +    G++       +LDRE  D +  +I+A D G         + V + D NDN P++ H S       ++    VG  V  +KA DSD G N  + Y + Q  +   +L ++++ +G +Y+ K PL  + EI  +   V   D GP P ++ T V I    +    PA
Sbjct:   96 PAKGSILYRVQEEQPPNTLIGSLAA---DHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRE---------TLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSER-NGVADYALTAGP--DAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPS---YEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYV-KGPLDRE-EINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPA 427          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 224.557 bits (571), Expect = 7.728e-60
Identity = 230/824 (27.91%), Postives = 379/824 (46.00%), Query Frame = 3
Query:  369 LNFQMMKENNFVSLV-----NGKLFV-KADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTL-KYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETV-GRLVTVLKAXXXXXXXXXXXXYEIIQGNE-------HELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS-------------KLPAESRFFEKD--------LVVMICMITVTLIVSGILVVAI-VLLKCKHCYRN 2705
            L F+ + +   V LV      G++F     IDRE++C+     + C   + V V   +I     +I+  IED+ND++P++  + I I+IPE++ I +RY +P A D D    N I  Y L K V    L +        P+     QL+  V  N+DREK +   + +  ED G+PP + +  L + I+D+NDN P+F     E+S+ EN      + Q+ A D D   N ++ F+F N ++   +  F IN   G I VKQ LD +      L+ +     +  +   ++V V + NDN P I     +N  N  +L+ EN    T IA ++ TD D          +   +  +L  V  D     ++ +    PLD ET   +   I   D G PP  T+ ++ I++ D+ND  P FP     + I E     + + K++A+D D G N++++Y +       F ID  +G+L      DREK   +       D      S P    L S   +R+I++D+ND +P F    Y F +PE       VG +   D+D    N  I+ +++           K  F + P   +     + DRE    ++F ++A D G         V + + D+NDN P +   S    S ++ R  T  G +VT + A+D+D+G+N+ L Y II             LF +++ SG++ L ++ +  D  + RLVVKV D G P  L   T+V ++ +  VS             + P +    + +        ++V+I +I  T+ V  ILV+ +  L++C+   R+
Sbjct:   61 LQFKPVYKTGDVPLVRVEANTGEIFTTNHRIDREKLCSGVFTEKRCYYEIEVAVLPDEI-FRLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVG-INGIQNYELVKSVTEFGLDIIET-----PEGDKWPQLI--VQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVFND-----QFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDN----GSTP----LQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDAD-AGDNAAITLSIL---------NGKDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSS-NYSYDLVRTTTTPGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQPESLQAITLVHLFVNDTVSNATFIQEQLRKSMETPLDRNIGDSEVTPQANGYVIVVIAIIAGTMTV--ILVIFVTALVRCRQTPRH 849          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 224.942 bits (572), Expect = 9.628e-60
Identity = 230/824 (27.91%), Postives = 379/824 (46.00%), Query Frame = 3
Query:  369 LNFQMMKENNFVSLV-----NGKLFV-KADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTL-KYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL--KLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETV-GRLVTVLKAXXXXXXXXXXXXYEIIQGNE-------HELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSG-PSPLTNTTIVRIYFHSEVS-------------KLPAESRFFEKD--------LVVMICMITVTLIVSGILVVAI-VLLKCKHCYRN 2705
            L F+ + +   V LV      G++F     IDRE++C+     + C   + V V   +I     +I+  IED+ND++P++  + I I+IPE++ I +RY +P A D D    N I  Y L K V    L +        P+     QL+  V  N+DREK +   + +  ED G+PP + +  L + I+D+NDN P+F     E+S+ EN      + Q+ A D D   N ++ F+F N ++   +  F IN   G I VKQ LD +      L+ +     +  +   ++V V + NDN P I     +N  N  +L+ EN    T IA ++ TD D          +   +  +L  V  D     ++ +    PLD ET   +   I   D G PP  T+ ++ I++ D+ND  P FP     + I E     + + K++A+D D G N++++Y +       F ID  +G+L      DREK   +       D      S P    L S   +R+I++D+ND +P F    Y F +PE       VG +   D+D    N  I+ +++           K  F + P   +     + DRE    ++F ++A D G         V + + D+NDN P +   S    S ++ R  T  G +VT + A+D+D+G+N+ L Y II             LF +++ SG++ L ++ +  D  + RLVVKV D G P  L   T+V ++ +  VS             + P +    + +        ++V+I +I  T+ V  ILV+ +  L++C+   R+
Sbjct:   61 LQFKPVYKTGDVPLVRVEANTGEIFTTNHRIDREKLCSGVFTEKRCYYEIEVAVLPDEI-FRLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVG-INGIQNYELVKSVTEFGLDIIET-----PEGDKWPQLI--VQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVFND-----QFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDN----GSTP----LQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDAD-AGDNAAITLSIL---------NGKDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSS-NYSYDLVRTTTTPGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQPESLQAITLVHLFVNDTVSNATFIQEQLRKSMETPLDRNIGDSEVTPQANGYVIVVIAIIAGTMTV--ILVIFVTALVRCRQTPRH 849          
BLAST of Protocadherin vs. Ensembl Medaka
Match: ENSORLT00000036025.1 (pep primary_assembly:ASM223467v1:10:15153493:15160535:-1 gene:ENSORLG00000023815.1 transcript:ENSORLT00000036025.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.246 bits (565), Expect = 1.122e-59
Identity = 199/676 (29.44%), Postives = 326/676 (48.22%), Query Frame = 3
Query:  267 LQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNF-VSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTD---STKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAH---------FSIDENTGVLRTNSIFDRE--KTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFS------IPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG--PITHRVSVDVVV 2225
            + F V E  + G +IG+L ++  I    L  R      ++ +  F V L  G LFV   IDRE +C   ++C  LN+  ++ +     N + I+++I DIND++P + +   V N+ E S  G RY LP A D D+   NS+  Y L     S  + FSI  ++  D      +L +    +DREK   + L+L A D G P  +G+  + +N+ D+NDN+P+F KPL ++S++EN  +   + ++ A DLD   N ++ +S     N++   KFY+  ++G+I +K  LDY +E N Y L +Q +D   S +   + +L++V + NDNAP ISI   ++       V+E  +  T +A ++ TD D     I+       L   ++ T+      Y++++   LDRET   +  TI   D G  P  +T +IN+QV D ND  P FP     VY+ E   V + +TK+ A D D+  N+ L Y +  ++          +I+  TG +     FD E  KT ++K++AT          D     LSS   + V + D ND +P     + E        IP  +    +V  + A D D    N  +SY +      ++   + L+   +  G I T +   D +    H   +   D+G   ++  VS++VVV
Sbjct:   27 MSFSVSEEVDKGTVIGNLAKDLNIVSQQLEERGFRIVSLLSKKYFEVDLRTGALFVNERIDREELCPNTHKCS-LNIEGLISS---PMNIYRIEVNILDINDNAPKFLEQIHVFNVSESSSAGERYPLPAAHDADTGI-NSVKTYKL-----SPNEFFSIDVSTSRDGLSAELVLQKA---LDREKQPNVRLILTAVDGGKPARSGNMQIIVNVVDVNDNTPLFSKPLYKVSVRENESVGTTILKLNATDLDEGSNAEIKYSLMKRGNVDSHEKFYVVPESGEIVLKNRLDY-EENNAYELRVQASDKGGSPRSGYSKVLIEVVDMNDNAPEISITSVMSP------VKEKAEIGTVVALVTVTDKDGGQNGITTCKIKNILPF-KLTTNYK--NYYSLIVDGLLDRETVAEYNVTITAVDAGSLPLSSTAVINVQVSDVNDNAPTFPEGAMNVYVRENSQVGNVITKVTAHDADIDDNADLTYFLIDSNSWKTQISSILNINSKTGEIMAMQSFDYEKLKTFQFKVQAT----------DSGVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDPD-SGYNALLSYHL------SEPKGNNLFRIGTSSGEIRTKRRMSDND-LKSHPLLVLVSDNGEPSLSATVSIEVVV 661          

HSP 2 Score: 136.732 bits (343), Expect = 2.621e-32
Identity = 177/674 (26.26%), Postives = 297/674 (44.07%), Query Frame = 3
Query:  888 HLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAET---ILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVY--IDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH-AHFSIDENTG---VLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSG--PITHRVSVDVVVKIEDLNDNFPQ----WSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPA--------ESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRNLPGITYQSKEYRHGHPDGQSSPTAS----DMFSSAVKLSSDVPLY 2828
             + +NI DINDN+P FL+ +   ++ E++   +      A D D   N   T+    +           +G + ++ +++ LD +++ N  L+ +   D  K A +    ++V V + NDN P+ S  P    S     V EN    T I  L+ATD+D  S      S      +        V     I+L   LD E N  ++  ++  D G  P+     + I+V+D ND  P    +IT+V   + E   + + V  +  +D D G N     +I +   F +  N      L  + + DRE   EY +  T  D  +L         LSST +I V + D+ND AP F +      + E S     +  V A D+DI+  N  ++Y  +I     K+ IS +    S  G I    +S D E      F ++A DSG  P++  V+V+V V   D NDN P     +S    +  S NI      G  V  ++A+D DSG N+ L+Y + +   + LF++   SG +   ++   ND +   L+V VSD+G   L+ T  + +      + +          E  F + +L ++I +++V++    I +++++ L    C+R     +  S      HPDG  S + +    D+  S+  L SDV ++
Sbjct:  114 RIEVNILDINDNAPKFLEQIHVFNVSESSSAGERYPLPAAHDADTGINSVKTYKLSPNEFFSIDVSTSRDGLSAELVLQKALDREKQPNVRLI-LTAVDGGKPARSGNMQIIVNVVDVNDNTPLFS-KPLYKVS-----VRENESVGTTILKLNATDLDEGSNAEIKYSLMKRGNVDSHEKFYVVPESGEIVLKNRLDYEENNAYELRVQASDKGGSPRSGYSKVLIEVVDMNDNAPEI--SITSVMSPVKEKAEIGTVVALVTVTDKDGGQNGITTCKIKNILPFKLTTNYKNYYSLIVDGLLDRETVAEYNVTITAVDAGSLP--------LSSTAVINVQVSDVNDNAPTFPEGAMNVYVRENSQVGNVITKVTAHDADIDD-NADLTY-FLIDSNSWKTQISSILNINSKTGEIMAM-QSFDYEKLKTFQFKVQATDSGVPPLSSNVTVNVFVL--DENDNSPSILAPYSEHGSVN-SENIPYSAEAGYFVAKIRAVDPDSGYNALLSYHLSEPKGNNLFRIGTSSGEIRTKRRMSDNDLKSHPLLVLVSDNGEPSLSATVSIEVVVLESTADMQTPFRHVPLKEDSFSDLNLYLLIAIVSVSV----IFLLSLISLVAVRCHRTDGSFSRYSAPMITTHPDGSWSYSKATQQYDVCFSSDTLKSDVVVF 760          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000029673.1 (SMESG000029673.1)

HSP 1 Score: 2080.06 bits (5388), Expect = 0.000e+0
Identity = 1054/1056 (99.81%), Postives = 1055/1056 (99.91%), Query Frame = 3
Query:  183 METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRNLPGITYQSKEYRHGHPDGQSSPTASDMFSSAVKLSSDVPLYHNQLYHPNRLIYEAPSGVMSFQTIRKPDSLPLYYTLKPKRSLSDGIGELPGNYMKTPFTNIYDIQQRHYALAQNFISVPPLTPENVNAHYFQHSNTVPTPTASTPMLNGSGISQANPNFESPTPLHGDIRLNNTVKWSDTVDDKRIYERITSAENAEIHCNHSLMTKDQISSFV 3350
            METLANLSKFIIFLIVVDFPMKMAKSISLQF+VKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDREKIEKIELLLLAEDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNSSTIISCASSSGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPA ITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKALDSDSGLNSSLNYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRNLPGITYQSKEYRHGHPDGQSSPTASDMFSSAVKLSSDVPLYHNQLYHPNRLIYEAPSGVMSFQTIRKPDSLPLYYTLKPKRSLSDGIGELPGNYMKTPFTNIYDIQQRHYALAQNFISVPPLTPENVNAHYFQHSNTVPTPTASTPMLNGSGISQANPNFESPTPLHGDIRLNNTVKWSDTVDDKRIYERITSAENAEIHCNHSLMTKDQISSFV
Sbjct:    1 METLANLSKFIIFLIVVDFPMKMAKSISLQFRVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCCCLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDREKIEKIELLLLAEDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNSSTIISCASSSGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPATITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKALDSDSGLNSSLNYEIIQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRNLPGITYQSKEYRHGHPDGQSSPTASDMFSSAVKLSSDVPLYHNQLYHPNRLIYEAPSGVMSFQTIRKPDSLPLYYTLKPKRSLSDGIGELPGNYMKTPFTNIYDIQQRHYALAQNFISVPPLTPENVNAHYFQHSNTVPTPTASTPMLNGSGISQANPNFESPTPLHGDIRLNNTVKWSDTVDDKRIYERITSAENAEIHCNHSLMTKDQISSFV 1056          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000012836.1 (SMESG000012836.1)

HSP 1 Score: 300.827 bits (769), Expect = 1.106e-85
Identity = 262/824 (31.80%), Postives = 407/824 (49.39%), Query Frame = 3
Query:  306 LIGDLVENYRIQDFDLSRRENLN----FQMMKENN--FVSLVNGKLFVKADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQ--ISIEDINDHSPVWTQ--SKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKL-FSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPL-TEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGL-----KLSRVLTDLSVVT-----KYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNE-HELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRF--FEKDLVVMICMITVTLIVSGILVVAIVLLKC 2687
            L+ +   N  + D +     N N    F+++ +N   ++    GKL  K+ IDRE IC +   N  C + LF++ +  K  +    I+  I I DINDH+P W +  + + + IPEHS I S + LP A DLD  PDN    YT+    + ++K    ++  S  +  Y N+L L V   +DREK  + ++L+ A D G PPL+G   + I +TDIND+SP F   +   IS+ EN  I+  +    A+D+D SD + L FSF ++   E    F++  K+G++ +++ LDY+ ++ +Y   +QVTD   F    + VKV N NDN+P IS+     +   +L V EN +    I ++  TD D++           GL      + + + +LS ++     K+ +   KP DRE   +   TIKC D G PP+ ++    + +LD ND  P F        I E + V + + +L A D D  +N+   + +      +F I+  TG + +  IF+ E++  Y++ A V D           KV      + + I+D+ND +P F K  Y FSI E              DSDI  IN+ I Y    KP   KS +   +  V+ DG+IF     LDRE     +F I A D+G  T   S  + ++++D+NDN P+W H       INIT    VG  V   +A D D G NS L Y I + N   ++F+L   +GSLY+ +    +D    RL + V D G   L  T   ++    ++      S F  FE DL++++ ++ VTLI+   L+ AI  LKC
Sbjct:   15 LVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKYGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIQVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKM-SYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSF--AGGELLTVSENSESGQHIGAVVVTDADDN----------SGLLPVFCSIDKPIVELSPLSDEARNKFLLKTLKPFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSL----EGTFHKVFGK---VDLNIEDMNDNSPRFDKDIYHFSIYEN-------------DSDISEINKAIRYNF--KPGTDKSILK--HIGVTQDGKIFVRSSQLDREKNSSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNSPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGKFEGDLLIILVLVIVTLIICLGLISAIWFLKC 801          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000012836.1 (SMESG000012836.1)

HSP 1 Score: 300.827 bits (769), Expect = 1.123e-85
Identity = 261/819 (31.87%), Postives = 408/819 (49.82%), Query Frame = 3
Query:  306 LIGDLVENYRIQDFDLSRRENLN----FQMMKENN--FVSLVNGKLFVKADIDRERICTK--KNQCCCLNLFVIVYNLKIQSNYFEIQ--ISIEDINDHSPVWTQ--SKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKL-FSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPL-TEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNXXXXXXXXXXXGGLKLSRVLTDLSVVT-----KYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRID---HAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEIIQGNE-HELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPAESRF--FEKDLVVMICMITVTLIVSGILVVAIVLLKC 2687
            L+ +   N  + D +     N N    F+++ +N   ++    GKL  K+ IDRE IC +   N  C + LF++ +  K  +    I+  I I DINDH+P W +  + + + IPEHS I S + LP A DLD  PDN    YT+    + ++K    ++  S  +  Y N+L L V   +DREK  + ++L+ A D G PPL+G   + I +TDIND+SP F   +   IS+ EN  I+  +    A+D+D SD + L FSF ++   E    F++  K+G++ +++ LDY+ ++ +Y   +QVTD   F    + VKV N NDN+P IS+     +   +L V EN +    I ++  TD D++S ++          + + + +LS ++     K+ +   KP DRE   +   TIKC D G PP+ ++    + +LD ND  P F        I E + V + + +L A D D  +N+   + +      +F I+  TG + +  IF+ E++  Y++ A V D           KV      + + I+D+ND +P F K  Y FSI E              DSDI  IN+ I Y    KP   KS +   +  V+ DG+IF     LDRE     +F I A D+G  T   S  + ++++D+NDN P+W H       INIT    VG  V   +A D D G NS L Y I + N   ++F+L   +GSLY+ +    +D    RL + V D G   L  T   ++    ++      S F  FE DL++++ ++ VTLI+   L+ AI  LKC
Sbjct:    7 LVEECSNNSIVTDLNNRFHSNFNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDANPDCKIALFILYHPGKRTTKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNKDGEMKFDLRVIMKSSLNSKYGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIQVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKM-SYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSF--AGGELLTVSENSESGQHIGAVVVTDADDNSGLLPVF-----CSIDKPIVELSPLSDEARNKFLLKTLKPFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRATIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSL----EGTFHKVFGK---VDLNIEDMNDNSPRFDKDIYHFSIYEN-------------DSDISEINKAIRYNF--KPGTDKSILK--HIGVTQDGKIFVRSSQLDREKNSSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNSPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFITEPNSGRDIFQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQQIETYHGLSLFGKFEGDLLIILVLVIVTLIICLGLISAIWFLKC 793          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 291.197 bits (744), Expect = 1.919e-81
Identity = 271/967 (28.02%), Postives = 436/967 (45.09%), Query Frame = 3
Query:  201 LSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMK-------ENNFVSLVNGKLFVKADIDRERICTKKNQ-----CCCLNLFV---IVYNLKIQSN-----YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVN-NSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISIL---------PHVNSSNNVLLVEENIQDETAIASLSATDMD-------NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPA------AITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH---AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKP-----------YETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI-------------------------IQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYF-------------HSEVSKLPAESRF-FEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYR-----NLPGITYQ----SKEYRHGHPDGQSSPTASDM 2786
            L +F I+L    F  ++   I + F+V E S    +IG+      I +  L ++  + F           E  F+     +  V   +DRE IC  + Q     C     F+   I+ + K Q++        + + I DIND+SP W+   I +++PEHSKIG+   LPLA D D  P N+  +Y + Y + N   KL          + +  +L L V+ + DREK   + + L A D    PL+G   + I++TDIND  P F K      I EN  +   + Q+ AKD D SD  KL F F NS++   R++FYIN   G+I     +DY+ + + Y +P+ VTD     +  L ++V+N NDN P IS+L         P  +S     L  EN      +ASLS +D D       N    +         +   + +   ++  + ++ TK  DRE    + A + C D       T+    I + D ND  P F         I +  I EGV + + + ++ A+D D+G N+ + Y +D      FSID  +G LR   +FD EK  +++L     +  N +      ++L +   I V I+D+NDC PVF+K  Y F++ EG S  +YVG V+ +D DI +      + ++  P           Y   +  +  YF +   G I      LDRE     SF I+A D        +  V ++I D+NDN P W   +     +N++ +E +G  +  LKA D D G N  + Y I                         I+ N HE+F L+  +G++Y+ ++   +D    ++ V+ SD G  P     I R++                + +K    SR  FE DL++MI ++ + ++V+ ++V+ I++L+C++  R      L   T Q    S+ +    PDG S    +D+
Sbjct:   16 LIRFCIWLSYF-FNKEIHGQIEIHFKVVEESPTNSVIGN------IHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL------KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIK-SEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLA-ENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFEL---TINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPP--QKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDI 962          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 290.812 bits (743), Expect = 2.212e-81
Identity = 271/967 (28.02%), Postives = 436/967 (45.09%), Query Frame = 3
Query:  201 LSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENYRIQDFDLSRRENLNFQMMK-------ENNFVSLVNGKLFVKADIDRERICTKKNQ-----CCCLNLFV---IVYNLKIQSN-----YFEIQISIEDINDHSPVWTQSKIVINIPEHSKIGSRYYLPLAKDLDSSPDNSISRYTLKYVN-NSQLKLFSIVYNSLPDKTYLNQLLLRVDANIDRXXXXXXXXXXXXXDSGSPPLTGSTHLTINITDINDNSPVFLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRSKFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNENDNAPVISIL---------PHVNSSNNVLLVEENIQDETAIASLSATDMD-------NXXXXXXXXXXXGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPPQVTTKIINIQVLDKNDCTPHFPA------AITTVYIDEGVPVESFVTKLNASDCDVGVNSQLVYRIDH---AHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNLVDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVGSVLAEDSDIEAINRQISYAMVIKP-----------YETKSHISKLYFSVSPDGRIFTTKESLDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLGLSINITREETVGRLVTVLKAXXXXXXXXXXXXYEI-------------------------IQGNEHELFKLNQKSGSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYF-------------HSEVSKLPAESRF-FEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYR-----NLPGITYQ----SKEYRHGHPDGQSSPTASDM 2786
            L +F I+L    F  ++   I + F+V E S    +IG+      I +  L ++  + F           E  F+     +  V   +DRE IC  + Q     C     F+   I+ + K Q++        + + I DIND+SP W+   I +++PEHSKIG+   LPLA D D  P N+  +Y + Y + N   KL          + +  +L L V+ + DREK   + + L A D    PL+G   + I++TDIND  P F K      I EN  +   + Q+ AKD D SD  KL F F NS++   R++FYIN   G+I     +DY+ + + Y +P+ VTD     +  L ++V+N NDN P IS+L         P  +S     L  EN      +ASLS +D D       N    +         +   + +   ++  + ++ TK  DRE    + A + C D       T+    I + D ND  P F         I +  I EGV + + + ++ A+D D+G N+ + Y +D      FSID  +G LR   +FD EK  +++L     +  N +      ++L +   I V I+D+NDC PVF+K  Y F++ EG S  +YVG V+ +D DI +      + ++  P           Y   +  +  YF +   G I      LDRE     SF I+A D        +  V ++I D+NDN P W   +     +N++ +E +G  +  LKA D D G N  + Y I                         I+ N HE+F L+  +G++Y+ ++   +D    ++ V+ SD G  P     I R++                + +K    SR  FE DL++MI ++ + ++V+ ++V+ I++L+C++  R      L   T Q    S+ +    PDG S    +D+
Sbjct:   20 LIRFCIWLSYF-FNKEIHGQIEIHFKVVEESPTNSVIGN------IHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL------KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIK-SEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLA-ENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFEL---TINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPP--QKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDI 966          
The following BLAST results are available for this feature:
BLAST of Protocadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y7.956e-6628.33protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y8.685e-6628.33protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y8.796e-6628.33protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y8.796e-6628.33protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y1.151e-6528.33protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.929e-3627.46FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-17.380e-2625.72FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-31.127e-2525.45Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
hmr-12.233e-2523.48Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-12.233e-2523.48Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft4.671e-4726.99gene:FBgn0001075 transcript:FBtr0077478[more]
ds2.460e-4326.68gene:FBgn0284247 transcript:FBtr0078045[more]
ds2.460e-4326.68gene:FBgn0284247 transcript:FBtr0343249[more]
stan1.908e-3826.80gene:FBgn0024836 transcript:FBtr0339463[more]
stan2.174e-3826.80gene:FBgn0024836 transcript:FBtr0330601[more]
back to top
BLAST of Protocadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh119.434e-6728.02protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.300e-6627.91protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh1a5.918e-6229.28protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a5.986e-6229.28protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a41.001e-6129.14protocadherin 1 alpha 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Protocadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047798.12.190e-6226.93protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.12.636e-6226.93protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.12.797e-6226.93protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000027070.13.847e-6027.99pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
vapa2.541e-5628.01VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protocadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh16.032e-6628.32protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh16.032e-6628.32protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11x4.916e-6327.37protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.070e-6227.37protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.373e-6227.37protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6WYY1|PC11X_PANPA2.189e-6628.50Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR2.436e-6628.50Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6X862|PC11X_GORGO4.310e-6628.62Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6WXV7|PC11X_PONPY1.698e-6528.50Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
sp|Q9BZA8|PC11Y_HUMAN3.821e-6528.33Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WFD53.526e-10229.17Protocadherin 9 OS=Echinococcus granulosus OX=6210... [more]
A0A068Y9F66.728e-10129.42Protocadherin 9 OS=Echinococcus multilocularis OX=... [more]
A0A1I8IPY56.194e-9530.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DUI67.238e-9230.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A564YH372.157e-9029.39Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Protocadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.520e-6828.44protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh112.207e-6828.24protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh114.587e-6828.41protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSAMXT00000036470.12.352e-6527.27pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh97.056e-6126.01protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.15.520e-5627.84pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh111.161e-5326.48protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.12.675e-4525.63protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.11.514e-4025.81pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006996.11.072e-3727.84pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461893.324e-4728.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354122.385e-4527.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404702.562e-4528.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303641.238e-4125.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482372.025e-4126.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.633e-6028.34protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a4.495e-6028.21protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh117.728e-6027.91protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh119.628e-6027.91protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSORLT00000036025.11.122e-5929.44pep primary_assembly:ASM223467v1:10:15153493:15160... [more]
back to top
BLAST of Protocadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029673.10.000e+099.81SMESG000029673.1[more]
SMESG000012836.11.106e-8531.80SMESG000012836.1[more]
SMESG000012836.11.123e-8531.87SMESG000012836.1[more]
SMESG000022791.11.919e-8128.02SMESG000022791.1[more]
SMESG000022791.12.212e-8128.02SMESG000022791.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015204 ID=SMED30015204|Name=Protocadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=3429bp
GCGGATTAAATGAGAACAAATAAAATCTGAATTTTATAATCTAATGAATG
AAATTTTTGTAATAAACGATTTCGATTGGCTAAAAAACCGGCCAATGGAG
AAACAGAACAGAAATTTAAAATCAAATGATTTCTCTACTATCGAAGTCTT
TCATAATACTAATGTAATTTCTGAGCAATTTAATGGAAACTCTGGCAAAT
TTATCCAAATTTATCATTTTCCTGATAGTTGTTGATTTCCCAATGAAGAT
GGCAAAATCCATTTCGTTGCAATTCCAAGTAAAAGAACATTCAGAAATTG
GATTATTAATCGGTGATCTTGTGGAAAATTATCGAATTCAAGATTTCGAT
TTGTCTAGGAGAGAAAATCTCAATTTTCAAATGATGAAGGAAAACAATTT
CGTTTCTCTGGTCAATGGGAAATTGTTTGTCAAAGCTGACATCGATCGAG
AAAGGATTTGCACTAAAAAGAATCAATGTTGTTGTTTAAATCTGTTTGTG
ATTGTTTACAATTTGAAAATCCAATCGAATTATTTTGAAATCCAAATCTC
AATTGAAGATATCAATGATCATTCTCCGGTTTGGACCCAATCAAAAATCG
TCATTAATATTCCCGAACACTCAAAGATCGGCTCGAGATATTATCTTCCT
CTTGCTAAGGATCTCGACTCTTCTCCGGATAATTCTATTTCCCGCTACAC
TTTGAAATACGTAAACAACTCCCAATTGAAACTCTTCAGCATTGTGTACA
ACTCGCTGCCAGACAAAACCTATCTCAATCAATTGCTGCTGCGAGTCGAT
GCCAATATCGATCGAGAGAAAATAGAGAAAATAGAACTGCTCCTATTGGC
TGAGGATTCCGGCAGCCCGCCGCTCACTGGCTCGACGCATCTGACGATCA
ACATCACCGATATCAATGACAATTCTCCGGTTTTTCTTAAACCTTTAACG
GAAATATCAATCAAAGAAAACAATTTCATCGATCAATATTTATGCCAAAT
GTTTGCAAAGGATTTAGACATTTCCGACAACGACAAACTGACATTTTCCT
TTGGGAATTCTATGAACATCGAGGACAGGTCAAAGTTCTATATCAATGGG
AAAAATGGGAAAATCTTTGTGAAGCAAATATTGGATTATGATCAAGAGGT
GAACACGTACCTGCTGCCAATTCAAGTGACAGACAGCACAAAGTTTGCCG
AAACAATACTTCTAGTGAAAGTGCAAAACGAGAATGACAACGCCCCCGTC
ATATCGATTTTGCCCCATGTCAACAGTTCAAATAATGTGTTGCTGGTGGA
GGAAAATATCCAGGATGAGACCGCAATTGCCTCTTTGAGTGCGACTGACA
TGGATAATAGTTCGACAATTATTTCCTGCGCCTCAAGTTCCGGGGGCCTC
AAATTGTCGCGTGTACTGACAGATTTGTCAGTAGTGACGAAATACACAAT
TCTGCTGACAAAACCTCTCGACAGAGAAACAAATGAATTCTTTCAAGCGA
CAATAAAATGCCAGGACGATGGATATCCTCCGCAAGTCACCACAAAGATA
ATAAACATTCAGGTTTTGGATAAAAACGACTGCACTCCCCATTTTCCGGC
AGCAATTACTACAGTTTACATTGATGAAGGAGTTCCGGTTGAGAGTTTTG
TAACGAAATTGAATGCCTCCGACTGTGACGTTGGGGTAAACTCGCAGCTC
GTCTACCGGATAGATCATGCTCACTTTTCCATAGACGAAAATACGGGCGT
CCTCAGGACCAATTCTATATTTGATCGTGAGAAAACCGGAGAATATAAGT
TGGAGGCGACGGTTTACGATAGGAGAAACCTCGTGGATTCCGACCCAACA
GAAAAGGTCCTGTCGAGCACGACAATAATCAGAGTGATTATTAAGGATAT
CAATGATTGCGCTCCGGTTTTCAAGAAACTGTTTTACGAATTCTCGATTC
CCGAAGGAAGTTCCCCAAGGATGTACGTTGGGTCGGTGCTCGCTGAGGAT
TCAGACATCGAAGCGATCAACCGACAGATCTCTTACGCAATGGTCATCAA
ACCATATGAAACAAAAAGTCACATTTCAAAGCTTTATTTTTCTGTCAGTC
CAGATGGAAGGATTTTCACAACCAAAGAATCATTGGACCGTGAAACATAT
GACATGCACTCGTTTTCTATCGAAGCTTGGGACAGTGGCCCAATAACCCA
TCGGGTTTCGGTTGACGTGGTCGTGAAAATTGAAGACCTAAATGATAATT
TTCCTCAGTGGTCTCATTCTTCAGACTTGGGTTTATCAATCAACATTACC
CGAGAGGAAACTGTCGGACGACTGGTCACGGTTCTCAAAGCTTTGGATAG
CGATTCGGGTTTAAATTCCTCATTGAATTACGAAATTATTCAAGGAAACG
AGCATGAGCTGTTCAAACTCAATCAAAAATCGGGTTCATTGTATCTGATG
AAGCAGCCCTTGTCAAATGACCCCGAAATCATTCGTCTCGTTGTCAAAGT
CTCAGACAGCGGTCCCAGTCCTTTGACAAATACAACAATTGTTAGGATTT
ATTTTCATTCAGAAGTGTCAAAGCTTCCGGCGGAAAGCCGATTTTTTGAA
AAGGACTTGGTGGTGATGATATGCATGATTACCGTGACATTAATTGTATC
TGGCATCCTCGTTGTGGCCATTGTTCTGCTCAAGTGCAAACATTGCTACA
GAAACTTACCGGGAATCACTTACCAGTCCAAAGAATATCGCCATGGGCAT
CCAGATGGTCAATCTTCCCCAACTGCGTCAGACATGTTTAGCTCAGCTGT
AAAATTATCCTCGGATGTGCCATTATATCACAACCAACTTTATCATCCAA
ATAGACTCATCTATGAAGCTCCTTCGGGCGTCATGAGCTTCCAGACGATT
CGGAAACCTGATAGTTTACCTCTCTATTATACTTTGAAACCGAAACGTTC
GCTGTCAGATGGAATTGGGGAACTGCCGGGAAATTATATGAAAACTCCAT
TTACAAACATTTATGATATTCAGCAGCGCCATTACGCTCTAGCACAAAAT
TTCATCTCAGTTCCACCGTTGACTCCAGAAAATGTGAACGCACATTATTT
TCAGCATTCTAACACGGTGCCCACCCCAACTGCCAGCACGCCCATGCTCA
ATGGTTCAGGTATATCCCAAGCTAATCCAAACTTTGAATCACCAACTCCA
CTGCACGGAGACATCAGGCTTAATAATACAGTGAAATGGTCTGACACGGT
TGATGATAAACGGATTTACGAGCGTATAACTAGCGCGGAAAACGCAGAAA
TCCATTGCAATCACAGCCTGATGACCAAAGATCAGATTTCTTCATTTGTG
TGATTTTATATATGTATTTGAAACCTGTGATCTATGGACGTTGTTTATGT
ATTTTTGATTAATATACATTGAGATGTTC
back to top

protein sequence of SMED30015204-orf-1

>SMED30015204-orf-1 ID=SMED30015204-orf-1|Name=SMED30015204-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1057bp
METLANLSKFIIFLIVVDFPMKMAKSISLQFQVKEHSEIGLLIGDLVENY
RIQDFDLSRRENLNFQMMKENNFVSLVNGKLFVKADIDRERICTKKNQCC
CLNLFVIVYNLKIQSNYFEIQISIEDINDHSPVWTQSKIVINIPEHSKIG
SRYYLPLAKDLDSSPDNSISRYTLKYVNNSQLKLFSIVYNSLPDKTYLNQ
LLLRVDANIDREKIEKIELLLLAEDSGSPPLTGSTHLTINITDINDNSPV
FLKPLTEISIKENNFIDQYLCQMFAKDLDISDNDKLTFSFGNSMNIEDRS
KFYINGKNGKIFVKQILDYDQEVNTYLLPIQVTDSTKFAETILLVKVQNE
NDNAPVISILPHVNSSNNVLLVEENIQDETAIASLSATDMDNSSTIISCA
SSSGGLKLSRVLTDLSVVTKYTILLTKPLDRETNEFFQATIKCQDDGYPP
QVTTKIINIQVLDKNDCTPHFPAAITTVYIDEGVPVESFVTKLNASDCDV
GVNSQLVYRIDHAHFSIDENTGVLRTNSIFDREKTGEYKLEATVYDRRNL
VDSDPTEKVLSSTTIIRVIIKDINDCAPVFKKLFYEFSIPEGSSPRMYVG
SVLAEDSDIEAINRQISYAMVIKPYETKSHISKLYFSVSPDGRIFTTKES
LDRETYDMHSFSIEAWDSGPITHRVSVDVVVKIEDLNDNFPQWSHSSDLG
LSINITREETVGRLVTVLKALDSDSGLNSSLNYEIIQGNEHELFKLNQKS
GSLYLMKQPLSNDPEIIRLVVKVSDSGPSPLTNTTIVRIYFHSEVSKLPA
ESRFFEKDLVVMICMITVTLIVSGILVVAIVLLKCKHCYRNLPGITYQSK
EYRHGHPDGQSSPTASDMFSSAVKLSSDVPLYHNQLYHPNRLIYEAPSGV
MSFQTIRKPDSLPLYYTLKPKRSLSDGIGELPGNYMKTPFTNIYDIQQRH
YALAQNFISVPPLTPENVNAHYFQHSNTVPTPTASTPMLNGSGISQANPN
FESPTPLHGDIRLNNTVKWSDTVDDKRIYERITSAENAEIHCNHSLMTKD
QISSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 675..692
score: 36.91
coord: 70..89
score: 28.24
coord: 134..163
score: 25.67
coord: 230..249
score: 41.1
coord: 641..667
score: 23.38
coord: 216..228
score: 30.32
coord: 578..591
score: 36.03
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 602..691
e-value: 2.7E-12
score: 56.8
coord: 718..799
e-value: 3.7E-4
score: 29.8
coord: 156..249
e-value: 2.0E-11
score: 53.9
coord: 493..578
e-value: 7.5E-17
score: 72.0
coord: 385..469
e-value: 2.6E-9
score: 47.0
coord: 50..132
e-value: 0.26
score: 9.8
coord: 273..355
e-value: 9.7E-13
score: 58.3
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 140..242
e-value: 1.9E-9
score: 37.8
coord: 257..348
e-value: 1.6E-8
score: 34.9
coord: 585..681
e-value: 7.5E-10
score: 39.1
coord: 708..789
e-value: 5.8E-12
score: 45.9
coord: 477..570
e-value: 1.9E-11
score: 44.3
coord: 372..462
e-value: 1.6E-7
score: 31.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 247..353
e-value: 3.1E-18
score: 68.2
coord: 576..691
e-value: 1.0E-20
score: 76.2
coord: 467..575
e-value: 3.3E-21
score: 77.9
coord: 128..246
e-value: 5.4E-21
score: 77.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 28..127
e-value: 2.1E-13
score: 52.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 354..466
e-value: 7.5E-16
score: 60.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 692..798
e-value: 2.9E-16
score: 61.8
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 553..880
coord: 19..548
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 581..693
score: 19.889
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 135..251
score: 21.752
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 364..471
score: 16.14
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 252..357
score: 18.946
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 25..134
score: 11.865
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 697..801
score: 12.545
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 472..580
score: 20.788
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 702..789
e-value: 1.61178E-16
score: 73.8869
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 585..689
e-value: 2.571E-19
score: 81.9761
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 372..466
e-value: 2.08635E-11
score: 59.2493
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 28..130
e-value: 1.91182E-4
score: 39.6042
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 477..575
e-value: 7.56569E-24
score: 94.6877
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 139..247
e-value: 6.62547E-18
score: 77.7389
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 257..353
e-value: 1.05453E-15
score: 71.5757
NoneNo IPR availableTMHMMTMhelixcoord: 809..831
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 29..108
e-value: 1.1E-8
score: 34.8
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 239..249
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 127..243
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 239..359
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 568..699
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 686..790
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 351..463
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 459..549